From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org X-Spam-Level: X-Spam-Status: No, score=-9.8 required=3.0 tests=DKIM_SIGNED,DKIM_VALID, DKIM_VALID_AU,HEADER_FROM_DIFFERENT_DOMAINS,INCLUDES_PATCH,MAILING_LIST_MULTI, SIGNED_OFF_BY,SPF_HELO_NONE,SPF_PASS,USER_AGENT_GIT autolearn=ham autolearn_force=no version=3.4.0 Received: from mail.kernel.org (mail.kernel.org [198.145.29.99]) by smtp.lore.kernel.org (Postfix) with ESMTP id 63C1EC33CA2 for ; Sun, 12 Jan 2020 19:24:47 +0000 (UTC) Received: from vger.kernel.org (vger.kernel.org [209.132.180.67]) by mail.kernel.org (Postfix) with ESMTP id 15F0F21556 for ; Sun, 12 Jan 2020 19:24:47 +0000 (UTC) Authentication-Results: mail.kernel.org; dkim=pass (2048-bit key) header.d=btinternet.com header.i=@btinternet.com header.b="UgIJAYg4" Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1732957AbgALTYq (ORCPT ); Sun, 12 Jan 2020 14:24:46 -0500 Received: from mailomta4-re.btinternet.com ([213.120.69.97]:38469 "EHLO re-prd-fep-048.btinternet.com" rhost-flags-OK-OK-OK-FAIL) by vger.kernel.org with ESMTP id S1733087AbgALTYq (ORCPT ); Sun, 12 Jan 2020 14:24:46 -0500 Received: from re-prd-rgout-003.btmx-prd.synchronoss.net ([10.2.54.6]) by re-prd-fep-048.btinternet.com with ESMTP id <20200112192437.FWCO14852.re-prd-fep-048.btinternet.com@re-prd-rgout-003.btmx-prd.synchronoss.net>; Sun, 12 Jan 2020 19:24:37 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=btinternet.com; s=btmx201904; t=1578857077; bh=ZRGbFU/Q3owWHRjxDoJ1SKRfX552lVi8/riNp8Jqx0A=; h=From:To:Cc:Subject:Date:Message-Id:X-Mailer:In-Reply-To:References:MIME-Version; b=UgIJAYg4tVjii8+5QJEqIIuonALolnBqaqpDVJuZ9jtO2go3yZIP55CyE12cmmTnImIXP3f9ZoxW//mux2RHysWoTbkKeJSeP5eut1+X/Z+od+5pU1M0fwS86F4mtg2nmL2w8pk8ODFtebd/EXjmsWsjc7cBni/FuaTBGdo1IpAuwLad3C7dCMNi7LwOKgc9j+S4kVT+BpDcYCP9iBUmTGP81oM4J+Au1MA2jmvkLuLms0r0BG0LveOeYxRIfAtO+YHS03gM7B0nrL25ef//cWByqnwreBDIP9PXgMvo3Lr9i3jtvd9FrOTraLtRC90PRWdOWOce2QOjpaJK6+zcVA== Authentication-Results: btinternet.com; none X-Originating-IP: [86.134.6.171] X-OWM-Source-IP: 86.134.6.171 (GB) X-OWM-Env-Sender: richard_c_haines@btinternet.com X-VadeSecure-score: verdict=clean score=0/300, class=clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedufedrvdeikedguddvgecutefuodetggdotefrodftvfcurfhrohhfihhlvgemuceutffkvffkuffjvffgnffgvefqofdpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffufffkofgjfhgggfestdekredtredttdenucfhrhhomheptfhitghhrghrugcujfgrihhnvghsuceorhhitghhrghruggptggphhgrihhnvghssegsthhinhhtvghrnhgvthdrtghomheqnecukfhppeekiedrudefgedriedrudejudenucfrrghrrghmpehhvghloheplhhotggrlhhhohhsthdrlhhotggrlhguohhmrghinhdpihhnvghtpeekiedrudefgedriedrudejuddpmhgrihhlfhhrohhmpeeorhhitghhrghruggptggphhgrihhnvghssegsthhinhhtvghrnhgvthdrtghomheqpdhrtghpthhtohepoehrihgthhgrrhgupggtpghhrghinhgvshessghtihhnthgvrhhnvghtrdgtohhmqecuqfftvefrvfeprhhftgekvddvnehrihgthhgrrhgupggtpghhrghinhgvshessghtihhnthgvrhhnvghtrdgtohhmpdhrtghpthhtohepoehsvghlihhnuhigsehvghgvrhdrkhgvrhhnvghlrdhorhhgqeenucevlhhushhtvghrufhiiigvpedt X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean Received: from localhost.localdomain (86.134.6.171) by re-prd-rgout-003.btmx-prd.synchronoss.net (5.8.337) (authenticated as richard_c_haines@btinternet.com) id 5DF6656304D208F8; Sun, 12 Jan 2020 19:24:37 +0000 From: Richard Haines To: selinux@vger.kernel.org Cc: Richard Haines Subject: [PATCH V3 1/1] selinux-testsuite: Add filesystem tests Date: Sun, 12 Jan 2020 19:24:32 +0000 Message-Id: <20200112192432.862800-2-richard_c_haines@btinternet.com> X-Mailer: git-send-email 2.24.1 In-Reply-To: <20200112192432.862800-1-richard_c_haines@btinternet.com> References: <20200112192432.862800-1-richard_c_haines@btinternet.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8bit Sender: selinux-owner@vger.kernel.org Precedence: bulk List-ID: X-Mailing-List: selinux@vger.kernel.org Test filesystem permissions, setfscreatecon(3), file { quotaon } and changing file context via 'name type_transition rule'. >From kernels 5.5 filesystem { watch } is also tested. Signed-off-by: Richard Haines --- defconfig | 6 + policy/Makefile | 4 + policy/test_filesystem.te | 343 +++++++ tests/Makefile | 7 + tests/filesystem/.gitignore | 11 + tests/filesystem/Makefile | 16 + tests/filesystem/check_file_context.c | 75 ++ tests/filesystem/check_mount_context.c | 127 +++ tests/filesystem/create_file.c | 112 +++ tests/filesystem/create_file_change_context.c | 146 +++ tests/filesystem/fanotify_fs.c | 79 ++ tests/filesystem/fs_relabel.c | 138 +++ tests/filesystem/grim_reaper.c | 89 ++ tests/filesystem/mount.c | 130 +++ tests/filesystem/quotas_test.c | 143 +++ tests/filesystem/statfs_test.c | 65 ++ tests/filesystem/test | 929 ++++++++++++++++++ tests/filesystem/umount.c | 84 ++ 18 files changed, 2504 insertions(+) create mode 100644 policy/test_filesystem.te create mode 100644 tests/filesystem/.gitignore create mode 100644 tests/filesystem/Makefile create mode 100644 tests/filesystem/check_file_context.c create mode 100644 tests/filesystem/check_mount_context.c create mode 100644 tests/filesystem/create_file.c create mode 100644 tests/filesystem/create_file_change_context.c create mode 100644 tests/filesystem/fanotify_fs.c create mode 100644 tests/filesystem/fs_relabel.c create mode 100644 tests/filesystem/grim_reaper.c create mode 100644 tests/filesystem/mount.c create mode 100644 tests/filesystem/quotas_test.c create mode 100644 tests/filesystem/statfs_test.c create mode 100755 tests/filesystem/test create mode 100644 tests/filesystem/umount.c diff --git a/defconfig b/defconfig index 3bea332..7cb6a2c 100644 --- a/defconfig +++ b/defconfig @@ -88,3 +88,9 @@ CONFIG_TUN=m CONFIG_HAVE_PERF_EVENTS=y CONFIG_PERF_EVENTS=y CONFIG_TRACEPOINTS=y + +# Test filesystem permissions. +# This is not required for SELinux operation itself. +CONFIG_BLK_DEV_LOOP=m +CONFIG_BLK_DEV_LOOP_MIN_COUNT=0 +CONFIG_QFMT_V2=y diff --git a/policy/Makefile b/policy/Makefile index 6f1db03..30896d8 100644 --- a/policy/Makefile +++ b/policy/Makefile @@ -114,6 +114,10 @@ TARGETS += test_lockdown.te export M4PARAM += -Dlockdown_defined endif +ifeq ($(shell grep -q filesystem $(POLDEV)/include/support/all_perms.spt && echo true),true) +TARGETS += test_filesystem.te +endif + ifeq (x$(DISTRO),$(filter x$(DISTRO),xRHEL4 xRHEL5 xRHEL6)) TARGETS:=$(filter-out test_overlayfs.te test_mqueue.te test_ibpkey.te, $(TARGETS)) endif diff --git a/policy/test_filesystem.te b/policy/test_filesystem.te new file mode 100644 index 0000000..29c11ab --- /dev/null +++ b/policy/test_filesystem.te @@ -0,0 +1,343 @@ +# +######### Test filesystem permissions policy module ########## +# +attribute filesystemdomain; +kernel_dontaudit_setsched(filesystemdomain) + +#################### Create test file contexts ###################### +type test_filesystem_filecon_t; +unconfined_runs_test(test_filesystem_filecon_t) + +type test_filesystem_filetranscon_t; +unconfined_runs_test(test_filesystem_filetranscon_t) + +################# Test all functions ########################## +type test_filesystem_t; +domain_type(test_filesystem_t) +unconfined_runs_test(test_filesystem_t) +typeattribute test_filesystem_t testdomain; +typeattribute test_filesystem_t filesystemdomain; + +allow test_filesystem_t self:capability { sys_admin }; +allow test_filesystem_t self:filesystem { mount remount quotamod relabelfrom relabelto unmount quotaget }; +allow test_filesystem_t self:dir { mounton add_name write }; +allow test_filesystem_t test_file_t:dir { mounton write remove_name rmdir }; +# Create test file +allow test_filesystem_t self:dir { add_name write }; +allow test_filesystem_t self:file { create relabelfrom relabelto }; + +fs_mount_all_fs(test_filesystem_t) +fs_remount_all_fs(test_filesystem_t) +fs_unmount_all_fs(test_filesystem_t) +fs_relabelfrom_all_fs(test_filesystem_t) +fs_get_xattr_fs_quotas(test_filesystem_t) +files_search_all(test_filesystem_t) +# Required for mount opts "rootcontext=system_u:object_r:test_filesystem_t:s0"; +fs_associate(test_filesystem_t) +fs_getattr_xattr_fs(test_filesystem_t) + +# For running quotacheck(8) +files_type(test_filesystem_t) +# Update quotas +fs_set_all_quotas(test_filesystem_t) +allow test_filesystem_t self:file { quotaon }; +# Create test file and change context via setfilecon(3): +fs_associate(test_filesystem_filecon_t) +allow test_filesystem_t test_filesystem_filecon_t:file { open read getattr relabelto write }; + +# Create file & change context via name type_transition rule: +fs_associate(test_filesystem_filetranscon_t) +type_transition test_filesystem_t test_filesystem_t:file test_filesystem_filetranscon_t "trans_test_file"; +allow test_filesystem_t test_filesystem_filetranscon_t:file { create getattr open write }; +dontaudit unconfined_t test_filesystem_filetranscon_t:file { getattr read }; + +#################### Deny filesystem { getattr } ###################### +type test_filesystem_no_getattr_t; +domain_type(test_filesystem_no_getattr_t) +unconfined_runs_test(test_filesystem_no_getattr_t) +typeattribute test_filesystem_no_getattr_t testdomain; +typeattribute test_filesystem_no_getattr_t filesystemdomain; + +allow test_filesystem_no_getattr_t self:capability { sys_admin }; +fs_mount_all_fs(test_filesystem_no_getattr_t) +fs_unmount_all_fs(test_filesystem_no_getattr_t) +fs_relabelfrom_all_fs(test_filesystem_no_getattr_t) +fs_associate(test_filesystem_no_getattr_t) +allow test_filesystem_no_getattr_t self:dir { mounton }; +allow test_filesystem_no_getattr_t test_file_t:dir { mounton write remove_name rmdir }; + +#################### Deny filesystem { remount } ###################### +type test_filesystem_no_remount_t; +domain_type(test_filesystem_no_remount_t) +unconfined_runs_test(test_filesystem_no_remount_t) +typeattribute test_filesystem_no_remount_t testdomain; +typeattribute test_filesystem_no_remount_t filesystemdomain; + +allow test_filesystem_no_remount_t self:capability { sys_admin }; +fs_mount_all_fs(test_filesystem_no_remount_t) +fs_unmount_all_fs(test_filesystem_no_remount_t) +fs_relabelfrom_all_fs(test_filesystem_no_remount_t) +fs_associate(test_filesystem_no_remount_t) +allow test_filesystem_no_remount_t self:dir { mounton }; +allow test_filesystem_no_remount_t test_file_t:dir { mounton write remove_name rmdir }; + +#################### Deny filesystem { mount } ###################### +type test_filesystem_no_mount_t; +domain_type(test_filesystem_no_mount_t) +unconfined_runs_test(test_filesystem_no_mount_t) +typeattribute test_filesystem_no_mount_t testdomain; +typeattribute test_filesystem_no_mount_t filesystemdomain; + +allow test_filesystem_no_mount_t self:capability { sys_admin }; +fs_relabelfrom_all_fs(test_filesystem_no_mount_t) +fs_associate(test_filesystem_no_mount_t) +allow test_filesystem_no_mount_t self:dir { mounton }; +allow test_filesystem_no_mount_t test_file_t:dir { mounton write remove_name rmdir }; + +#################### Deny filesystem { unmount } ###################### +type test_filesystem_no_unmount_t; +domain_type(test_filesystem_no_unmount_t) +unconfined_runs_test(test_filesystem_no_unmount_t) +typeattribute test_filesystem_no_unmount_t testdomain; +typeattribute test_filesystem_no_unmount_t filesystemdomain; + +allow test_filesystem_no_unmount_t self:capability { sys_admin }; +fs_mount_all_fs(test_filesystem_no_unmount_t) +fs_relabelfrom_all_fs(test_filesystem_no_unmount_t) +fs_associate(test_filesystem_no_unmount_t) +allow test_filesystem_no_unmount_t self:dir { mounton }; +allow test_filesystem_no_unmount_t test_file_t:dir { mounton write remove_name rmdir }; + +#################### Deny filesystem { relabelfrom } ###################### +type test_filesystem_no_relabelfrom_t; +domain_type(test_filesystem_no_relabelfrom_t) +unconfined_runs_test(test_filesystem_no_relabelfrom_t) +typeattribute test_filesystem_no_relabelfrom_t testdomain; +typeattribute test_filesystem_no_relabelfrom_t filesystemdomain; + +allow test_filesystem_no_relabelfrom_t self:capability { sys_admin }; +fs_associate(test_filesystem_no_relabelfrom_t) +allow test_filesystem_no_relabelfrom_t self:dir { mounton }; +allow test_filesystem_no_relabelfrom_t test_file_t:dir { mounton write remove_name rmdir }; + +#################### Deny filesystem { relabelto } ###################### +type test_filesystem_no_relabelto_t; +domain_type(test_filesystem_no_relabelto_t) +unconfined_runs_test(test_filesystem_no_relabelto_t) +typeattribute test_filesystem_no_relabelto_t testdomain; +typeattribute test_filesystem_no_relabelto_t filesystemdomain; + +allow test_filesystem_no_relabelto_t self:capability { sys_admin }; +fs_mount_all_fs(test_filesystem_no_relabelto_t) +fs_relabelfrom_all_fs(test_filesystem_no_relabelto_t) +fs_associate(test_filesystem_no_relabelto_t) +allow test_filesystem_no_relabelto_t self:dir { mounton }; +allow test_filesystem_no_relabelto_t test_file_t:dir { mounton write remove_name rmdir }; + +#################### Deny filesystem { associate } ###################### +type test_filesystem_no_associate_t; +type test_filesystem_no_associate1_t; +domain_type(test_filesystem_no_associate_t) +unconfined_runs_test(test_filesystem_no_associate_t) +typeattribute test_filesystem_no_associate_t testdomain; +typeattribute test_filesystem_no_associate_t filesystemdomain; + +allow test_filesystem_no_associate_t self:capability { sys_admin }; +allow test_filesystem_no_associate_t self:filesystem { relabelto mount relabelfrom }; +fs_mount_all_fs(test_filesystem_no_associate_t) +fs_relabelfrom_all_fs(test_filesystem_no_associate_t) +allow test_filesystem_no_associate_t self:dir { mounton }; +allow test_filesystem_no_associate_t test_file_t:dir { mounton write remove_name rmdir }; + +########## Deny filesystem { associate } for create file ################ +type test_filesystem_no_associate_file_t; +domain_type(test_filesystem_no_associate_file_t) +unconfined_runs_test(test_filesystem_no_associate_file_t) +typeattribute test_filesystem_no_associate_file_t testdomain; +typeattribute test_filesystem_no_associate_file_t filesystemdomain; + +allow test_filesystem_no_associate_file_t self:capability { sys_admin }; +allow test_filesystem_no_associate_file_t self:filesystem { mount relabelfrom relabelto unmount associate }; +allow test_filesystem_no_associate_file_t self:dir { mounton add_name write }; +allow test_filesystem_no_associate_file_t test_file_t:dir { mounton write remove_name rmdir }; + +fs_mount_all_fs(test_filesystem_no_associate_file_t) +fs_unmount_all_fs(test_filesystem_no_associate_file_t) +fs_relabelfrom_all_fs(test_filesystem_no_associate_file_t) +fs_associate(test_filesystem_no_associate_file_t) +fs_getattr_xattr_fs(test_filesystem_no_associate_file_t) + +# Create test file +allow test_filesystem_no_associate_file_t self:file { create relabelfrom relabelto }; +############ hooks.c may_create() FILESYSTEM__ASSOCIATE ############# +# FOR: neverallow unlabeled_t test_filesystem_no_associate_file_t:filesystem { associate }; +allow test_filesystem_no_associate_file_t unconfined_t:file { open read write }; +allow test_filesystem_no_associate_file_t unlabeled_t:dir { add_name search write }; +allow test_filesystem_no_associate_file_t unlabeled_t:file { create open relabelfrom write }; +############ hooks.c selinux_inode_setxattr() FILESYSTEM__ASSOCIATE ########## +# FOR: neverallow unconfined_t test_filesystem_no_associate_file_t:filesystem { associate }; +dontaudit unconfined_t test_filesystem_filecon_t:file { getattr read }; +allow test_filesystem_no_associate_file_t unconfined_t:dir { add_name write }; +allow test_filesystem_no_associate_file_t unconfined_t:file { create relabelfrom relabelto }; + +#################### Deny filesystem { quotamod } ###################### +type test_filesystem_no_quotamod_t; +domain_type(test_filesystem_no_quotamod_t) +unconfined_runs_test(test_filesystem_no_quotamod_t) +typeattribute test_filesystem_no_quotamod_t testdomain; +typeattribute test_filesystem_no_quotamod_t filesystemdomain; + +allow test_filesystem_no_quotamod_t self:capability { sys_admin }; +allow test_filesystem_no_quotamod_t self:filesystem { quotaget relabelto mount unmount}; +fs_mount_all_fs(test_filesystem_no_quotamod_t) +fs_relabelfrom_all_fs(test_filesystem_no_quotamod_t) +fs_associate(test_filesystem_no_quotamod_t) +# Required as $private_path to quota files +files_search_all(test_filesystem_no_quotamod_t) +allow test_filesystem_no_quotamod_t self:dir { mounton }; +allow test_filesystem_no_quotamod_t test_file_t:dir { mounton write remove_name rmdir }; + +#################### Deny filesystem { quotaget } ###################### +type test_filesystem_no_quotaget_t; +domain_type(test_filesystem_no_quotaget_t) +unconfined_runs_test(test_filesystem_no_quotaget_t) +typeattribute test_filesystem_no_quotaget_t testdomain; +typeattribute test_filesystem_no_quotaget_t filesystemdomain; + +allow test_filesystem_no_quotaget_t self:capability { sys_admin }; +allow test_filesystem_no_quotaget_t self:filesystem { quotamod relabelto mount unmount relabelfrom }; +allow test_filesystem_no_quotaget_t self:dir { mounton }; +allow test_filesystem_no_quotaget_t test_file_t:dir { mounton write remove_name rmdir }; +allow test_filesystem_no_quotaget_t self:file { quotaon }; +fs_mount_all_fs(test_filesystem_no_quotaget_t) +fs_relabelfrom_all_fs(test_filesystem_no_quotaget_t) +fs_associate(test_filesystem_no_quotaget_t) +# Required as $private_path to quota files +files_search_all(test_filesystem_no_quotaget_t) +# For running quotacheck(8) +files_type(test_filesystem_no_quotaget_t) + +#################### Deny file { quotaon } ###################### +type test_file_no_quotaon_t; +domain_type(test_file_no_quotaon_t) +unconfined_runs_test(test_file_no_quotaon_t) +typeattribute test_file_no_quotaon_t testdomain; +typeattribute test_file_no_quotaon_t filesystemdomain; + +allow test_file_no_quotaon_t self:capability { sys_admin }; +allow test_file_no_quotaon_t self:filesystem { quotamod relabelto mount unmount relabelfrom }; +allow test_file_no_quotaon_t self:dir { mounton }; +allow test_file_no_quotaon_t test_file_t:dir { mounton write remove_name rmdir }; +##allow test_file_no_quotaon_t self:file { quotaon }; +fs_mount_all_fs(test_file_no_quotaon_t) +fs_relabelfrom_all_fs(test_file_no_quotaon_t) +fs_associate(test_file_no_quotaon_t) +# Required as $private_path to quota files +files_search_all(test_file_no_quotaon_t) +# For running quotacheck(8) +files_type(test_file_no_quotaon_t) + +#################### Deny filesystem { watch } ###################### +type test_filesystem_no_watch_t; +domain_type(test_filesystem_no_watch_t) +unconfined_runs_test(test_filesystem_no_watch_t) +typeattribute test_filesystem_no_watch_t testdomain; +typeattribute test_filesystem_no_watch_t filesystemdomain; + +allow test_filesystem_no_watch_t self:capability { sys_admin }; +allow test_filesystem_no_watch_t self:filesystem { associate relabelto mount unmount relabelfrom }; +allow test_filesystem_no_watch_t self:dir { mounton }; +allow test_filesystem_no_watch_t test_file_t:dir { mounton write remove_name rmdir }; +fs_mount_all_fs(test_filesystem_no_watch_t) +fs_relabelfrom_all_fs(test_filesystem_no_watch_t) +fs_associate(test_filesystem_no_watch_t) + +################# Test process { setfscreate } ############# +type test_setfscreatecon_t; +domain_type(test_setfscreatecon_t) +unconfined_runs_test(test_setfscreatecon_t) +typeattribute test_setfscreatecon_t testdomain; +typeattribute test_setfscreatecon_t filesystemdomain; + +allow test_setfscreatecon_t self:capability { sys_admin }; +allow test_setfscreatecon_t self:process { setfscreate }; +allow test_setfscreatecon_t test_file_t:dir { add_name write remove_name }; + +# Set new context on fs: +type test_setfscreatecon_newcon_t; +unconfined_runs_test(test_setfscreatecon_newcon_t) +fs_associate(test_setfscreatecon_newcon_t) +allow test_setfscreatecon_t test_setfscreatecon_newcon_t:dir { create getattr rmdir }; + +################# deny process { setfscreate } ############# +type test_no_setfscreatecon_t; +domain_type(test_no_setfscreatecon_t) +unconfined_runs_test(test_no_setfscreatecon_t) +typeattribute test_no_setfscreatecon_t testdomain; +typeattribute test_no_setfscreatecon_t filesystemdomain; + +allow test_no_setfscreatecon_t self:capability { sys_admin }; +# neverallow test_no_setfscreatecon_t self:process { setfscreate }; + +################# Test fscontext= ########################## +type test_filesystem_fscontext_t; +domain_type(test_filesystem_fscontext_t) +unconfined_runs_test(test_filesystem_fscontext_t) +typeattribute test_filesystem_fscontext_t testdomain; +typeattribute test_filesystem_fscontext_t filesystemdomain; + +allow test_filesystem_fscontext_t self:capability { sys_admin }; +allow test_filesystem_fscontext_t self:filesystem { associate mount relabelfrom relabelto unmount }; +allow test_filesystem_fscontext_t self:dir { mounton add_name write }; +allow test_filesystem_fscontext_t test_file_t:dir { mounton write remove_name rmdir }; +# Create test file +allow test_filesystem_fscontext_t self:dir { add_name write }; +allow test_filesystem_fscontext_t self:file { create relabelfrom relabelto }; +allow test_filesystem_fscontext_t test_filesystem_filecon_t:file { relabelto }; +allow test_filesystem_filecon_t test_filesystem_fscontext_t:filesystem { associate }; +allow test_filesystem_fscontext_t test_filesystem_filecon_t:file { open getattr read write }; + +fs_mount_all_fs(test_filesystem_fscontext_t) +fs_unmount_all_fs(test_filesystem_fscontext_t) +fs_relabelfrom_all_fs(test_filesystem_fscontext_t) +files_search_all(test_filesystem_fscontext_t) + +########### Test context=, rootcontext= and defcontext ################# +type test_filesystem_context_t; +domain_type(test_filesystem_context_t) +unconfined_runs_test(test_filesystem_context_t) +typeattribute test_filesystem_context_t testdomain; +typeattribute test_filesystem_context_t filesystemdomain; + +allow test_filesystem_context_t self:capability { sys_admin }; +allow test_filesystem_context_t self:filesystem { associate mount relabelfrom relabelto unmount }; +allow test_filesystem_context_t self:dir { mounton add_name write }; +allow test_filesystem_context_t test_file_t:dir { mounton write remove_name rmdir }; +# Create test file +allow test_filesystem_context_t self:dir { add_name write }; +allow test_filesystem_context_t self:file { create relabelfrom relabelto }; +allow test_filesystem_context_t test_filesystem_filecon_t:file { open getattr read write relabelto }; +allow test_filesystem_filecon_t test_filesystem_context_t:filesystem { associate }; + +fs_mount_all_fs(test_filesystem_context_t) +fs_unmount_all_fs(test_filesystem_context_t) +fs_relabelfrom_all_fs(test_filesystem_context_t) +files_search_all(test_filesystem_context_t) +fs_associate(test_filesystem_context_t) +allow test_filesystem_context_t test_file_t:dir { add_name }; + +# For testing rootcontext= Set mountpoint to unlabeled first +allow test_filesystem_context_t test_file_t:dir { relabelfrom }; +allow test_filesystem_context_t unlabeled_t:dir { mounton relabelto }; + +# For testing defcontext= +allow test_filesystem_context_t test_filesystem_filecon_t:dir { search }; +allow test_filesystem_fscontext_t test_filesystem_context_t:dir { add_name search write }; +allow test_filesystem_fscontext_t test_filesystem_context_t:file { create getattr open write }; +dontaudit unconfined_t test_filesystem_filecon_t:dir { read search }; + +# +########### Allow these domains to be entered from sysadm domain ############ +# +miscfiles_domain_entry_test_files(filesystemdomain) +userdom_sysadm_entry_spec_domtrans_to(filesystemdomain) diff --git a/tests/Makefile b/tests/Makefile index e19ea2f..a1478f1 100644 --- a/tests/Makefile +++ b/tests/Makefile @@ -91,6 +91,13 @@ ifeq ($(shell grep -q lockdown $(POLDEV)/include/support/all_perms.spt && echo t SUBDIRS += lockdown endif +ifeq ($(shell grep -q filesystem $(POLDEV)/include/support/all_perms.spt && echo true),true) +SUBDIRS += filesystem +ifeq ($(shell grep -q all_filesystem_perms.*watch $(POLDEV)/include/support/all_perms.spt && echo true),true) +export CFLAGS += -DHAVE_FS_WATCH_PERM +endif +endif + ifeq ($(DISTRO),RHEL4) SUBDIRS:=$(filter-out bounds dyntrace dyntrans inet_socket mmap nnp_nosuid overlay unix_socket, $(SUBDIRS)) endif diff --git a/tests/filesystem/.gitignore b/tests/filesystem/.gitignore new file mode 100644 index 0000000..5ac18d0 --- /dev/null +++ b/tests/filesystem/.gitignore @@ -0,0 +1,11 @@ +mount +umount +quotas_test +statfs_test +fanotify_fs +create_file_change_context +fs_relabel +check_file_context +check_mount_context +create_file +grim_reaper diff --git a/tests/filesystem/Makefile b/tests/filesystem/Makefile new file mode 100644 index 0000000..d2fad63 --- /dev/null +++ b/tests/filesystem/Makefile @@ -0,0 +1,16 @@ +# Required for local building +#export CFLAGS += -DHAVE_FS_WATCH_PERM + +TARGETS = mount umount quotas_test statfs_test create_file_change_context \ +fs_relabel check_file_context grim_reaper check_mount_context create_file + +LDLIBS += -lselinux + +ifneq (,$(findstring -DHAVE_FS_WATCH_PERM,$(CFLAGS))) + TARGETS += fanotify_fs +endif + +all: $(TARGETS) + +clean: + rm -f $(TARGETS) diff --git a/tests/filesystem/check_file_context.c b/tests/filesystem/check_file_context.c new file mode 100644 index 0000000..a522e96 --- /dev/null +++ b/tests/filesystem/check_file_context.c @@ -0,0 +1,75 @@ +#include +#include +#include +#include +#include +#include +#include +#include +#include + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -f file -e cxt [-v]\n" + "Where:\n\t" + "-f File to check its context\n\t" + "-e Expected context\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char **argv) +{ + int opt, result, fd; + char *context = NULL, *expected = NULL, *file = NULL; + bool verbose = false; + + while ((opt = getopt(argc, argv, "f:e:v")) != -1) { + switch (opt) { + case 'f': + file = optarg; + break; + case 'e': + expected = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!file || !expected) + print_usage(argv[0]); + + fd = open(file, O_RDWR); + if (fd < 0) { + fprintf(stderr, "open(2) Failed: %s\n", strerror(errno)); + return -1; + } + + result = fgetfilecon(fd, &context); + if (result < 0) { + fprintf(stderr, "fgetfilecon(3) Failed: %s\n", + strerror(errno)); + result = -1; + goto err; + } + result = 0; + + if (strcmp(expected, context)) { + fprintf(stderr, "File context error, expected:\n\t%s\ngot:\n\t%s\n", + expected, context); + result = -1; + } else { + if (verbose) + printf("Pass - File contexts match: %s\n", context); + } +err: + free(context); + close(fd); + + return result; +} diff --git a/tests/filesystem/check_mount_context.c b/tests/filesystem/check_mount_context.c new file mode 100644 index 0000000..2899dea --- /dev/null +++ b/tests/filesystem/check_mount_context.c @@ -0,0 +1,127 @@ +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -m mp [-e ctx] [-r] [-v]\n" + "Where:\n\t" + "-m Mount point\n\t" + "-e Expected MP context\n\t" + "-r Reset MP context to 'unlabeled_t'\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char **argv) +{ + int opt, result; + char *context = NULL, *expected = NULL, *mount = NULL, *newcon = NULL; + bool verbose = false, reset = false; + const char *type = "unlabeled_t"; + context_t con_t; + + while ((opt = getopt(argc, argv, "m:e:rv")) != -1) { + switch (opt) { + case 'm': + mount = optarg; + break; + case 'e': + expected = optarg; + break; + case 'r': + reset = true; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!mount) + print_usage(argv[0]); + + result = getfilecon(mount, &context); + if (result < 0) { + fprintf(stderr, "getfilecon(3) Failed: %s\n", + strerror(errno)); + result = -1; + goto err; + } + if (verbose) + printf("Current MP context: %s\n", context); + + result = 0; + + if (reset) { + /* Set context to unlabeled_t */ + con_t = context_new(context); + if (!con_t) { + fprintf(stderr, "Unable to create context structure\n"); + result = -1; + goto err; + } + + if (context_type_set(con_t, type)) { + fprintf(stderr, "Unable to set new type\n"); + free(con_t); + result = -1; + goto err; + } + + newcon = context_str(con_t); + free(con_t); + if (!newcon) { + fprintf(stderr, "Unable to obtain new context string\n"); + result = -1; + goto err; + } + + result = setfilecon(mount, newcon); + free(newcon); + if (result < 0) { + fprintf(stderr, "setfilecon(3) Failed: %s\n", + strerror(errno)); + result = -1; + goto err; + } + + free(context); + + result = getfilecon(mount, &context); + if (result < 0) { + fprintf(stderr, "getfilecon(3) Failed: %s\n", + strerror(errno)); + return result; + } + result = 0; + + if (verbose) + printf("Set new MP context: %s\n", context); + + } else { + if (strcmp(expected, context)) { + fprintf(stderr, "Mount context error, expected:\n\t%s\ngot:\n\t%s\n", + expected, context); + result = -1; + } else { + if (verbose) + printf("Pass - Mountpoint contexts match: %s\n", + context); + } + } + +err: + free(context); + return result; +} diff --git a/tests/filesystem/create_file.c b/tests/filesystem/create_file.c new file mode 100644 index 0000000..9771ab8 --- /dev/null +++ b/tests/filesystem/create_file.c @@ -0,0 +1,112 @@ +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -f file [-e type] [-v]\n" + "Where:\n\t" + "-f File to create\n\t" + "-e Expected file context type\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char **argv) +{ + int opt, result, fd, save_err; + char *context, *file = NULL, *type = NULL; + const char *file_type; + bool verbose = false; + context_t con_t; + + while ((opt = getopt(argc, argv, "f:e:v")) != -1) { + switch (opt) { + case 'f': + file = optarg; + break; + case 'e': + type = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!file) + print_usage(argv[0]); + + if (verbose) { + result = getcon(&context); + if (result < 0) { + fprintf(stderr, "Failed to obtain process context\n"); + exit(-1); + } + printf("Process context:\n\t%s\n", context); + free(context); + } + + fd = creat(file, O_RDWR); + save_err = errno; + if (fd < 0) { + fprintf(stderr, "creat(2) Failed: %s\n", strerror(errno)); + return save_err; + } + + context = NULL; + result = fgetfilecon(fd, &context); + if (result < 0) { + fprintf(stderr, "fgetfilecon(3) Failed: %s\n", + strerror(errno)); + result = -1; + goto err; + } + result = 0; + + if (verbose) + printf("File context is: %s\n", context); + + if (type) { + con_t = context_new(context); + if (!con_t) { + fprintf(stderr, "Unable to create context structure\n"); + result = -1; + goto err; + } + + file_type = context_type_get(con_t); + if (!file_type) { + fprintf(stderr, "Unable to get new type\n"); + free(con_t); + result = -1; + goto err; + } + + if (strcmp(type, file_type)) { + fprintf(stderr, "File context error, expected:\n\t%s\ngot:\n\t%s\n", + type, file_type); + result = -1; + } else { + result = 0; + } + free(con_t); + } + +err: + free(context); + close(fd); + + return result; +} diff --git a/tests/filesystem/create_file_change_context.c b/tests/filesystem/create_file_change_context.c new file mode 100644 index 0000000..83f780e --- /dev/null +++ b/tests/filesystem/create_file_change_context.c @@ -0,0 +1,146 @@ +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -f file -t type [-v]\n" + "Where:\n\t" + "-f File to create\n\t" + "-t Type for context of created file\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char **argv) +{ + int opt, result, fd, save_err; + char *newfcon = NULL, *orgfcon = NULL, *type = NULL, *file = NULL; + char *context; + bool verbose = false; + context_t con_t; + + while ((opt = getopt(argc, argv, "f:t:v")) != -1) { + switch (opt) { + case 'f': + file = optarg; + break; + case 't': + type = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!type || !file) + print_usage(argv[0]); + + if (verbose) { + result = getcon(&context); + if (result < 0) { + fprintf(stderr, "Failed to obtain process context\n"); + exit(-1); + } + + printf("Process context:\n\t%s\n", context); + free(context); + } + + /* hooks.c may_create() FILESYSTEM__ASSOCIATE */ + fd = creat(file, O_RDWR); + save_err = errno; + if (fd < 0) { + fprintf(stderr, "creat(2) Failed: %s\n", strerror(errno)); + return save_err; + } + if (verbose) + printf("Created file: %s\n", file); + + result = fgetfilecon(fd, &orgfcon); + if (result < 0) { + fprintf(stderr, "fgetfilecon(3) Failed: %s\n", + strerror(errno)); + close(fd); + return -1; + } + if (verbose) + printf("Current file context is: %s\n", orgfcon); + + /* Build new file context */ + con_t = context_new(orgfcon); + if (!con_t) { + fprintf(stderr, "Unable to create context structure\n"); + result = -1; + goto err; + } + + if (context_type_set(con_t, type)) { + fprintf(stderr, "Unable to set new type\n"); + free(con_t); + result = -1; + goto err; + } + + newfcon = context_str(con_t); + free(con_t); + if (!newfcon) { + fprintf(stderr, "Unable to obtain new context string\n"); + result = -1; + goto err; + } + + /* hooks.c selinux_inode_setxattr() FILESYSTEM__ASSOCIATE */ + result = fsetfilecon(fd, newfcon); + save_err = errno; + close(fd); + if (result < 0) { + fprintf(stderr, "fsetfilecon(3) Failed: %s\n", + strerror(errno)); + result = save_err; + goto err1; + } + + fd = open(file, O_RDWR); + if (fd < 0) { + fprintf(stderr, "open(2) Failed: %s\n", strerror(errno)); + result = -1; + goto err1; + } + + result = fgetfilecon(fd, &context); + if (result < 0) { + fprintf(stderr, "fgetfilecon(3) Failed: %s\n", + strerror(errno)); + result = -1; + goto err1; + } + if (verbose) + printf("New file context is: %s\n", context); + + result = 0; + if (strcmp(newfcon, context)) { + fprintf(stderr, "File context error, expected:\n\t%s\ngot:\n\t%s\n", + newfcon, context); + result = -1; + } + +err: + free(orgfcon); +err1: + free(newfcon); + close(fd); + + return result; +} diff --git a/tests/filesystem/fanotify_fs.c b/tests/filesystem/fanotify_fs.c new file mode 100644 index 0000000..c525d69 --- /dev/null +++ b/tests/filesystem/fanotify_fs.c @@ -0,0 +1,79 @@ +#include +#include +#include +#include +#include +#include +#include +#include +#include + +#ifndef FAN_MARK_FILESYSTEM +#define FAN_MARK_FILESYSTEM 0x00000100 +#endif + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -t path [-v]\n" + "Where:\n\t" + "-t Target mount point to mark\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char *argv[]) +{ + int mask = FAN_OPEN, flags = FAN_MARK_ADD | FAN_MARK_FILESYSTEM; + int fd, result, opt, save_err; + char *context, *tgt = NULL; + bool verbose = false; + + while ((opt = getopt(argc, argv, "t:v")) != -1) { + switch (opt) { + case 't': + tgt = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!tgt) + print_usage(argv[0]); + + if (verbose) { + result = getcon(&context); + if (result < 0) { + fprintf(stderr, "Failed to obtain process context\n"); + exit(-1); + } + printf("Process context:\n\t%s\n", context); + free(context); + } + + fd = fanotify_init(FAN_CLASS_CONTENT, O_RDWR); + if (fd < 0) { + fprintf(stderr, "fanotify_init(2) Failed: %s\n", + strerror(errno)); + exit(-1); + } + + result = fanotify_mark(fd, flags, mask, AT_FDCWD, tgt); + save_err = errno; + if (result < 0) { + fprintf(stderr, "fanotify_mark(2) Failed: %s\n", + strerror(errno)); + close(fd); + return save_err; + } + + if (verbose) + printf("Set fanotify_mark(2) on filesystem: %s\n", tgt); + + close(fd); + return 0; +} diff --git a/tests/filesystem/fs_relabel.c b/tests/filesystem/fs_relabel.c new file mode 100644 index 0000000..8ebc0bf --- /dev/null +++ b/tests/filesystem/fs_relabel.c @@ -0,0 +1,138 @@ +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -b path -t type [-v]\n" + "Where:\n\t" + "-b base directory\n\t" + "-t Type for fs context to generate on base/mp1\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char **argv) +{ + int opt, result, save_err; + char *context, *fs_con = NULL, *newcon = NULL, *base_dir, *type; + char fs_mount[PATH_MAX]; + bool verbose = false; + context_t con_t; + + while ((opt = getopt(argc, argv, "b:t:v")) != -1) { + switch (opt) { + case 'b': + base_dir = optarg; + break; + case 't': + type = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!type || !base_dir) + print_usage(argv[0]); + + if (verbose) { + result = getcon(&context); + if (result < 0) { + fprintf(stderr, "Failed to obtain process context\n"); + exit(-1); + } + printf("Process context:\n\t%s\n", context); + free(context); + } + + result = getfilecon(base_dir, &context); + if (result < 0) { + fprintf(stderr, "getfilecon(3) Failed: %s\n", + strerror(errno)); + return -1; + } + if (verbose) + printf("%s context is: %s\n", base_dir, context); + + /* Build new context for fs */ + con_t = context_new(context); + if (!con_t) { + fprintf(stderr, "Unable to create context structure\n"); + result = -1; + goto err; + } + + if (context_type_set(con_t, type)) { + fprintf(stderr, "Unable to set new type\n"); + free(con_t); + result = -1; + goto err; + } + + newcon = context_str(con_t); + free(con_t); + if (!newcon) { + fprintf(stderr, "Unable to obtain new context string\n"); + result = -1; + goto err; + } + + result = setfscreatecon(newcon); + save_err = errno; + if (result < 0) { + fprintf(stderr, "Failed setfscreatecon(3): %s\n", + strerror(errno)); + result = save_err; + goto err; + } + + sprintf(fs_mount, "%s/%s", base_dir, "mp1"); + + result = mkdir(fs_mount, 0777); + if (result < 0) { + fprintf(stderr, "mkdir(2) Failed: %s\n", strerror(errno)); + goto err; + } + + result = getfilecon(fs_mount, &fs_con); + if (result < 0) { + fprintf(stderr, "getfilecon(3) Failed: %s\n", + strerror(errno)); + goto err; + } + if (verbose) + printf("%s context is: %s\n", fs_mount, fs_con); + + result = rmdir(fs_mount); + if (result < 0) { + fprintf(stderr, "rmdir(2) Failed: %s\n", strerror(errno)); + goto err; + } + + if (strcmp(newcon, fs_con)) { + fprintf(stderr, "FS context error, expected:\n\t%s\ngot:\n\t%s\n", + newcon, fs_con); + result = -1; + } +err: + free(context); + free(newcon); + free(fs_con); + + return result; +} diff --git a/tests/filesystem/grim_reaper.c b/tests/filesystem/grim_reaper.c new file mode 100644 index 0000000..340546a --- /dev/null +++ b/tests/filesystem/grim_reaper.c @@ -0,0 +1,89 @@ +#include +#include +#include +#include +#include +#include +#include +#include + +#define WAIT_COUNT 60 +#define USLEEP_TIME 10000 + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -t tgt [-v]\n" + "Where:\n\t" + "-t target to unmount if active\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char *argv[]) +{ + FILE *fp; + size_t len; + ssize_t num; + int opt, index = 0, i, result = 0; + char *mount_info[2], *buf = NULL, *item, *tgt; + bool verbose = false; + + while ((opt = getopt(argc, argv, "t:v")) != -1) { + switch (opt) { + case 't': + tgt = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!tgt) + print_usage(argv[0]); + + fp = fopen("/proc/mounts", "re"); + if (!fp) { + fprintf(stderr, "Failed to open /proc/mounts: %s\n", + strerror(errno)); + return -1; + } + + while ((num = getline(&buf, &len, fp)) != -1) { + index = 0; + item = strtok(buf, " "); + while (item != NULL) { + mount_info[index] = item; + index++; + if (index == 2) + break; + item = strtok(NULL, " "); + } + + if (strcmp(mount_info[0], tgt) == 0) { + if (verbose) + printf("Unmounting %s from %s\n", + mount_info[1], mount_info[0]); + + for (i = 0; i < WAIT_COUNT; i++) { + result = umount(mount_info[1]); + if (!result) + break; + + if (errno != EBUSY) { + fprintf(stderr, "Failed umount(2): %s\n", + strerror(errno)); + break; + } + usleep(USLEEP_TIME); + } + } + } + + free(buf); + fclose(fp); + return result; +} diff --git a/tests/filesystem/mount.c b/tests/filesystem/mount.c new file mode 100644 index 0000000..034f0ec --- /dev/null +++ b/tests/filesystem/mount.c @@ -0,0 +1,130 @@ +#include +#include +#include +#include +#include +#include +#include +#include + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s [-s src] -t tgt [-f fs_type] [-o options] [-bmprv]\n" + "Where:\n\t" + "-s Source path\n\t" + "-t Target path\n\t" + "-f Filesystem type\n\t" + "-o Options list (comma separated list)\n\t" + "Zero or one of the following flags:\n\t" + "\t-b MS_BIND\n\t" + "\t-m MS_MOVE\n\t" + "\t-p MS_PRIVATE\n\t" + "\t-r MS_REMOUNT\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +static int ck_mount(char *mntpoint) +{ + int result = 0; + FILE *fp; + size_t len; + ssize_t num; + char *buf = NULL; + + fp = fopen("/proc/mounts", "re"); + if (fp == NULL) { + fprintf(stderr, "Failed to open /proc/mounts: %s\n", + strerror(errno)); + return -1; + } + + while ((num = getline(&buf, &len, fp)) != -1) { + if (strstr(buf, mntpoint) != NULL) { + result = 1; + break; + } + } + + free(buf); + fclose(fp); + return result; +} + +int main(int argc, char *argv[]) +{ + int opt, result, save_err, flags = 0; + char *context, *src = NULL, *tgt = NULL, *fs_type = NULL, *opts = NULL; + bool verbose = false; + + while ((opt = getopt(argc, argv, "s:t:f:o:pbmrv")) != -1) { + switch (opt) { + case 's': + src = optarg; + break; + case 't': + tgt = optarg; + break; + case 'f': + fs_type = optarg; + break; + case 'o': + opts = optarg; + break; + case 'b': + flags = MS_BIND; + break; + case 'p': + flags = MS_PRIVATE; + break; + case 'm': + flags = MS_MOVE; + break; + case 'r': + flags = MS_REMOUNT; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!tgt) + print_usage(argv[0]); + + if (verbose) { + result = getcon(&context); + if (result < 0) { + fprintf(stderr, "Failed to obtain process context\n"); + return -1; + } + printf("Process context:\n\t%s\n", context); + free(context); + } + + if (verbose) + printf("Mounting\n\tsrc: %s\n\ttgt: %s\n\tfs_type: %s flags: 0x%x\n\topts: %s\n", + src, tgt, fs_type, flags, opts); + + result = mount(src, tgt, fs_type, flags, opts); + save_err = errno; + if (result < 0) { + fprintf(stderr, "Failed mount(2): %s\n", strerror(errno)); + return save_err; + } + + if (flags == MS_MOVE) { + if (!ck_mount(src) && ck_mount(tgt)) { + if (verbose) + printf("MS_MOVE: Moved mountpoint\n"); + } else { + fprintf(stderr, "MS_MOVE: Move mountpoint failed\n"); + return -1; + } + } + + return 0; +} diff --git a/tests/filesystem/quotas_test.c b/tests/filesystem/quotas_test.c new file mode 100644 index 0000000..8359811 --- /dev/null +++ b/tests/filesystem/quotas_test.c @@ -0,0 +1,143 @@ +#include +#include +#include +#include +#include +#include +#include +#include + +/* + * This is required so that the code compiles on RHEL/CentOS 7 and below. + * There doesn't contain the definition and it conflicts + * with + */ +#ifndef QFMT_VFS_V0 +#define QFMT_VFS_V0 2 +#endif + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -s src -t tgt [-v]\n" + "Where:\n\t" + "-s Source path (e.g. /dev/loop0)\n\t" + "-t Target quota file (Full path with either 'aquota.user'\n\t" + " or 'aquota.group' appended)\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char *argv[]) +{ + int opt, result, qcmd, save_err, test_id = geteuid(); + char *context, *src = NULL, *tgt = NULL; + bool verbose = false; + char fmt_buf[2]; + + while ((opt = getopt(argc, argv, "s:t:v")) != -1) { + switch (opt) { + case 's': + src = optarg; + break; + case 't': + tgt = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!src || !tgt) + print_usage(argv[0]); + + if (verbose) { + result = getcon(&context); + if (result < 0) { + fprintf(stderr, "Failed to obtain process context\n"); + return -1; + } + printf("Process context:\n\t%s\n", context); + free(context); + } + + if (strstr(tgt, "aquota.user") != NULL) { + qcmd = QCMD(Q_QUOTAON, USRQUOTA); + result = quotactl(qcmd, src, QFMT_VFS_V0, tgt); + save_err = errno; + if (result < 0) { + fprintf(stderr, "quotactl(Q_QUOTAON, USRQUOTA) Failed: %s\n", + strerror(errno)); + return save_err; + } + if (verbose) + printf("User Quota - ON\n"); + + qcmd = QCMD(Q_GETFMT, USRQUOTA); + result = quotactl(qcmd, src, test_id, fmt_buf); + save_err = errno; + if (result < 0) { + fprintf(stderr, "quotactl(Q_GETFMT, USRQUOTA) Failed: %s\n", + strerror(errno)); + return save_err; + } + if (verbose) + printf("User Format: 0x%x\n", fmt_buf[0]); + + qcmd = QCMD(Q_QUOTAOFF, USRQUOTA); + result = quotactl(qcmd, src, QFMT_VFS_V0, tgt); + save_err = errno; + if (result < 0) { + fprintf(stderr, "quotactl(Q_QUOTAOFF, USRQUOTA) Failed: %s\n", + strerror(errno)); + return save_err; + } + if (verbose) + printf("User Quota - OFF\n"); + + return 0; + + } else if (strstr(tgt, "aquota.group") != NULL) { + qcmd = QCMD(Q_QUOTAON, GRPQUOTA); + result = quotactl(qcmd, src, QFMT_VFS_V0, tgt); + save_err = errno; + if (result < 0) { + fprintf(stderr, "quotactl(Q_QUOTAON, GRPQUOTA) Failed: %s\n", + strerror(errno)); + return save_err; + } + if (verbose) + printf("Group Quota - ON\n"); + + qcmd = QCMD(Q_GETFMT, GRPQUOTA); + result = quotactl(qcmd, src, test_id, fmt_buf); + save_err = errno; + if (result < 0) { + fprintf(stderr, "quotactl(Q_GETFMT, GRPQUOTA) Failed: %s\n", + strerror(errno)); + return save_err; + } + if (verbose) + printf("Group Format: 0x%x\n", fmt_buf[0]); + + qcmd = QCMD(Q_QUOTAOFF, GRPQUOTA); + result = quotactl(qcmd, src, QFMT_VFS_V0, tgt); + save_err = errno; + if (result < 0) { + fprintf(stderr, "quotactl(Q_QUOTAOFF, GRPQUOTA) Failed: %s\n", + strerror(errno)); + return save_err; + } + if (verbose) + printf("Group Quota - OFF\n"); + + return 0; + } + + fprintf(stderr, "Required %s to specify 'aquota.user' or 'aquota.group' file\n", + tgt); + return -1; +} diff --git a/tests/filesystem/statfs_test.c b/tests/filesystem/statfs_test.c new file mode 100644 index 0000000..310b66d --- /dev/null +++ b/tests/filesystem/statfs_test.c @@ -0,0 +1,65 @@ +#include +#include +#include +#include +#include +#include +#include +#include + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s -t path [-v]\n" + "Where:\n\t" + "-t Target path to statfs(2)\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +int main(int argc, char *argv[]) +{ + int opt, result, save_err; + char *context, *tgt = NULL; + bool verbose = false; + struct statfs statfs_t; + + while ((opt = getopt(argc, argv, "t:v")) != -1) { + switch (opt) { + case 't': + tgt = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!tgt) + print_usage(argv[0]); + + if (verbose) { + result = getcon(&context); + if (result < 0) { + fprintf(stderr, "Failed to obtain process context\n"); + return -1; + } + printf("Process context:\n\t%s\n", context); + free(context); + } + + result = statfs(tgt, &statfs_t); + save_err = errno; + if (result < 0) { + fprintf(stderr, "statfs(2) Failed: %s\n", strerror(errno)); + return save_err; + } + + if (verbose) + printf("statfs(2) returned magic filesystem: 0x%lx\n", + statfs_t.f_type); + + return 0; +} diff --git a/tests/filesystem/test b/tests/filesystem/test new file mode 100755 index 0000000..c5227d6 --- /dev/null +++ b/tests/filesystem/test @@ -0,0 +1,929 @@ +#!/usr/bin/perl +use Test::More; + +BEGIN { + $basedir = $0; + $basedir =~ s|(.*)/[^/]*|$1|; + + $test_count = 68; + + # Options: -v = Verbose, -d disable udisks(8) daemon + $v = " "; + $disable_udisks = 0; + $udisks2_status = 0; + foreach $arg (@ARGV) { + if ( $arg eq "-v" ) { + $v = $arg; + } + elsif ( $arg eq "-d" ) { + $disable_udisks = 1; + } + } + + # From kernel 5.5 support for fanotify(7) with filesystem { watch } + $kvercur = `uname -r`; + chomp($kvercur); + $kverminstream = "5.5"; + + $result = `$basedir/../kvercmp $kvercur $kverminstream`; + if ( $result > 0 && -e "$basedir/fanotify_fs" ) { + $test_watch = 1; + $test_count += 4; + } + + plan tests => $test_count; +} + +# mount(2) MS_BIND | MS_PRIVATE requires an absolute path to a private mount +# point before MS_MOVE +$cwd = `pwd 2>/dev/null`; +chomp($cwd); +$private_path = "$cwd"; +if ( $basedir eq "." ) { + $private_path = "$cwd/mntpoint"; +} +else { + $private_path = "$cwd/$basedir/mntpoint"; +} + +# Set initial filesystem type +$fs_type = "ext4"; + +# For list of devices used +$device_count = 0; + +# Optionally stop the udisks(8) daemon, then restart on exit. +sub udisks2_stop { + if ( not $disable_udisks ) { + return; + } + + if ( -e "/usr/bin/systemctl" ) { + $u_status_cmd = "/usr/bin/systemctl status udisks2 >& /dev/null"; + $u_stop_cmd = "/usr/bin/systemctl stop udisks2 >& /dev/null"; + } + elsif ( -e "/usr/sbin/service" ) { + $u_status_cmd = "/usr/sbin/service udisks2 status >& /dev/null"; + $u_stop_cmd = "/usr/sbin/service udisks2 stop >& /dev/null"; + } + + if ($u_status_cmd) { + $result = system("$u_status_cmd"); + $udisks2_status = $result >> 8; + if ( $udisks2_status eq 0 ) { + print "Stopping udisks2 service for these tests.\n"; + system("$u_stop_cmd"); + $udisks2_status = 3; + } + else { + $udisks2_status = 4; + } + } +} + +sub udisks2_restart { + if ( not $disable_udisks ) { + return; + } + + if ( $udisks2_status eq 3 ) { + print "Restarting udisks2 service.\n"; + if ( -e "/usr/bin/systemctl" ) { + system("/usr/bin/systemctl start udisks2 >& /dev/null"); + } + elsif ( -e "/usr/sbin/service" ) { + system("/usr/sbin/service udisks2 start >& /dev/null"); + } + } +} + +sub get_loop_dev { + system("udevadm settle"); + print "Finding free /dev/loop entry\n"; + $dev = `losetup -f 2>/dev/null`; + chomp($dev); + if ( $dev eq "" ) { + print "losetup failed to obtain /dev/loop entry\n"; + cleanup(); + reaper(); + udisks2_restart(); + exit -1; + } + system("udevadm settle"); + + # Keep list of devices for cleanup later + if ( $device_count eq 0 ) { + $device_list[$device_count] = $dev; + $device_count += 1; + } + elsif ( $dev ne $device_list[ $device_count - 1 ] ) { + $device_list[$device_count] = $dev; + $device_count += 1; + } +} + +sub attach_dev { + system("udevadm settle"); + print "Attaching $basedir/fstest to $dev\n"; + $result = system("losetup $dev $basedir/fstest 2>/dev/null"); + if ( $result != 0 ) { + print "Failed to attach $basedir/fstest to $dev\n"; + cleanup(); + reaper(); + udisks2_restart(); + exit -1; + } + system("udevadm settle"); +} + +sub make_fs { + my ($mk_type) = @_; + + get_loop_dev(); + + if ( $mk_type eq "tmpfs" ) { + return; + } + + print "Create $basedir/fstest with dd\n"; + $result = system( + "dd if=/dev/zero of=$basedir/fstest bs=1024 count=10240 2>/dev/null"); + if ( $result != 0 ) { + print "dd failed to create fstest\n"; + reaper(); + udisks2_restart(); + exit -1; + } + + attach_dev(); + + print "Make $mk_type filesystem on $dev\n"; + $result = system("mkfs.$mk_type $dev >& /dev/null"); + if ( $result != 0 ) { + system("losetup -d $dev 2>/dev/null"); + cleanup(); + print "mkfs.$mk_type failed to create filesystem on $dev\n"; + reaper(); + udisks2_restart(); + exit -1; + } +} + +sub mk_mntpoint_1 { + system("rm -rf $private_path/mp1 2>/dev/null"); + system("mkdir -p $private_path/mp1 2>/dev/null"); +} + +sub mk_mntpoint_2 { + system("rm -rf $private_path/mp2 2>/dev/null"); + system("mkdir -p $private_path/mp2 2>/dev/null"); +} + +sub cleanup { + system("rm -rf $basedir/fstest 2>/dev/null"); + system("rm -rf $basedir/mntpoint 2>/dev/null"); +} + +sub cleanup1 { + system("losetup -d $dev 2>/dev/null"); + system("udevadm settle"); + system("rm -rf $basedir/fstest 2>/dev/null"); + system("rm -rf $basedir/mntpoint 2>/dev/null"); +} + +# Cleanup any attached /dev/loop entries +sub reaper { + foreach my $n (@device_list) { + system("$basedir/grim_reaper -t $n $v 2>/dev/null"); + } +} + +udisks2_stop(); +cleanup(); + +############### Test setfscreatecon(3) ########################## +system("mkdir -p $basedir/mntpoint 2>/dev/null"); + +print "Test setfscreatecon(3)\n"; +$result = system +"runcon -t test_setfscreatecon_t $basedir/fs_relabel $v -b $basedir/mntpoint -t test_setfscreatecon_newcon_t"; +ok( $result eq 0 ); + +$result = system +"runcon -t test_no_setfscreatecon_t $basedir/fs_relabel $v -b $basedir/mntpoint -t test_setfscreatecon_newcon_t 2>&1"; +ok( $result >> 8 eq 13 ); + +system("rm -rf $basedir/mntpoint 2>/dev/null"); + +############### Test Basic Mount/Unmount ########################## +mk_mntpoint_1(); +make_fs($fs_type); +$mount_opts1 = + "quota,usrquota,grpquota,defcontext=system_u:object_r:test_filesystem_t:s0"; + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$mount_opts1\n"; +$result = system( +"runcon -t test_filesystem_t $basedir/mount -s $dev -t $private_path/mp1 -f $fs_type -o $mount_opts1 $v" +); +ok( $result eq 0 ); + +print "Then remount\n"; +$result = system( +"runcon -t test_filesystem_t $basedir/mount -r -s $dev -t $private_path/mp1 -f $fs_type -o $mount_opts1 $v" +); +ok( $result eq 0 ); + +print "Running quotacheck(8) to init user/group quota files\n"; + +# On RHEL-6, there is a type transition to quota_t when running quotacheck +# as unconfined_t. Using "runcon `id -Z` quotacheck ..." resolves this. +$result = system("runcon `id -Z` quotacheck -ugF vfsv0 $private_path/mp1"); +ok( $result eq 0 ); + +print "Toggle User & Group quotas on/off\n"; +$result = system( +"runcon -t test_filesystem_t $basedir/quotas_test -s $dev -t $private_path/mp1/aquota.user $v" +); +ok( $result eq 0 ); +$result = system( +"runcon -t test_filesystem_t $basedir/quotas_test -s $dev -t $private_path/mp1/aquota.group $v" +); +ok( $result eq 0 ); + +print "Get statfs(2)\n"; +$result = + system( + "runcon -t test_filesystem_t $basedir/statfs_test -t $basedir/mntpoint $v"); +ok( $result eq 0 ); + +print +"Creating test file & changing its context via setfilecon(3) $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -t test_filesystem_t $basedir/create_file_change_context -t test_filesystem_filecon_t -f $private_path/mp1/test_file $v" + ); +ok( $result eq 0 ); + +print +"Creating test file & changing its context via 'name type_transition rule' $basedir/mntpoint/mp1/trans_test_file\n"; +$result = + system( +"runcon -t test_filesystem_t $basedir/create_file -f $private_path/mp1/trans_test_file -e test_filesystem_filetranscon_t $v" + ); +ok( $result eq 0 ); + +if ($test_watch) { + print "fanotify(7) test\n"; + $result = system( +"runcon -t test_filesystem_t $basedir/fanotify_fs $v -t $basedir/mntpoint/mp1" + ); + ok( $result eq 0 ); +} + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = + system("runcon -t test_filesystem_t $basedir/umount -t $private_path/mp1 $v"); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Test Move Mount ########################## +mk_mntpoint_1(); +make_fs($fs_type); +$mount_opts2 = + "quota,usrquota,grpquota,rootcontext=system_u:object_r:test_filesystem_t:s0"; + +print "Set mount MS_BIND on filesystem\n"; +$result = system( +"runcon -t test_filesystem_t $basedir/mount -s $private_path -t $private_path -b $v" +); +ok( $result eq 0 ); + +print "Set mount MS_PRIVATE on filesystem\n"; +$result = + system("runcon -t test_filesystem_t $basedir/mount -t $private_path -p $v"); +ok( $result eq 0 ); + +mk_mntpoint_2(); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$mount_opts2\n"; +$result = system( +"runcon -t test_filesystem_t $basedir/mount -s $dev -t $private_path/mp1 -f $fs_type -o $mount_opts2 $v" +); +ok( $result eq 0 ); + +print "Set mount MS_MOVE on filesystem\n"; +$result = system( +"runcon -t test_filesystem_t $basedir/mount -s $private_path/mp1 -t $private_path/mp2 -m $v" +); +ok( $result eq 0 ); + +print "Unmount filesystem from $basedir/mntpoint/mp2\n"; +$result = + system("runcon -t test_filesystem_t $basedir/umount -t $private_path/mp2 $v"); +ok( $result eq 0 ); + +print "Unmount filesystem from $basedir/mntpoint\n"; +$result = + system("runcon -t test_filesystem_t $basedir/umount -t $private_path $v"); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { relabelfrom } ########################## +# hooks.c may_context_mount_sb_relabel() FILESYSTEM__RELABELFROM +$opts_no_relabelfrom = +"defcontext=system_u:object_r:test_filesystem_no_relabelfrom_t:s0,fscontext=system_u:object_r:test_filesystem_no_relabelfrom_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_relabelfrom\n"; +$result = system( +"runcon -t test_filesystem_no_relabelfrom_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_relabelfrom $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { relabelto } ########################## +# hooks.c may_context_mount_sb_relabel() FILESYSTEM__RELABELTO +$opts_no_relabelto = + "fscontext=system_u:object_r:test_filesystem_no_relabelto_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_relabelto\n"; +$result = system( +"runcon -t test_filesystem_no_relabelto_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_relabelto $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { relabelfrom } ########################## +# hooks.c may_context_mount_inode_relabel() FILESYSTEM__RELABELFROM +$opts_no_relabelfrom = + "rootcontext=system_u:object_r:test_filesystem_no_relabelfrom_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_relabelfrom\n"; +$result = system( +"runcon -t test_filesystem_no_relabelfrom_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_relabelfrom $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { associate } ########################## +# hooks.c may_context_mount_inode_relabel() FILESYSTEM__ASSOCIATE +$opts_no_associate = +"defcontext=system_u:object_r:test_filesystem_no_associate_t:s0,fscontext=system_u:object_r:test_filesystem_no_associate_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_associate\n"; +$result = system( +"runcon -t test_filesystem_no_associate_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_associate $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { associate } ########################## +# hooks.c may_create() FILESYSTEM__ASSOCIATE +mk_mntpoint_1(); +make_fs($fs_type); +$opts_no_associate_file = + "fscontext=system_u:object_r:test_filesystem_no_associate_file_t:s0"; + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_associate_file\n"; +$result = system( +"runcon -t test_filesystem_no_associate_file_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_associate_file $v" +); +ok( $result eq 0 ); + +print "Creating test file $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -t test_filesystem_no_associate_file_t $basedir/create_file_change_context -t unconfined_t -f $basedir/mntpoint/mp1/test_file $v 2>&1" + ); +ok( $result >> 8 eq 13 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = + system( +"runcon -t test_filesystem_no_associate_file_t $basedir/umount -t $basedir/mntpoint/mp1 $v" + ); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { quotamod } ########################## +# hooks.c selinux_quotactl() FILESYSTEM__QUOTAMOD +$opts_no_quotamod = +"quota,usrquota,grpquota,fscontext=system_u:object_r:test_filesystem_no_quotamod_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); +system("mkdir -p $private_path 2>/dev/null"); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_quotamod\n"; +$result = system( +"runcon -t test_filesystem_no_quotamod_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_quotamod $v 2>&1" +); +ok( $result eq 0 ); + +# No need to run quotacheck(8) as never gets far enough to read quota file +print "Toggle User & Group quotas on/off\n"; # Must have full path +$result = system( +"runcon -t test_filesystem_no_quotamod_t $basedir/quotas_test -s $dev -t $private_path/mp1/aquota.user $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_filesystem_no_quotamod_t $basedir/umount -t $basedir/mntpoint/mp1 $v" +); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { quotaget } ########################## +# hooks.c selinux_quotactl() FILESYSTEM__QUOTAGET +$opts_no_quotaget = +"quota,usrquota,grpquota,context=system_u:object_r:test_filesystem_no_quotaget_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_quotaget\n"; +$result = system( +"runcon -t test_filesystem_no_quotaget_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_quotaget $v" +); +ok( $result eq 0 ); + +print "Running quotacheck(8) to init user/group quota files\n"; +$result = system("runcon `id -Z` quotacheck -ugF vfsv0 $private_path/mp1"); +ok( $result eq 0 ); + +print "Toggle User & Group quotas on/off\n"; # Must have full path +$result = system( +"runcon -t test_filesystem_no_quotaget_t $basedir/quotas_test -s $dev -t $private_path/mp1/aquota.user $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_filesystem_no_quotaget_t $basedir/umount -t $basedir/mntpoint/mp1 $v" +); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny file { quotaon } ########################## +# hooks.c selinux_quota_on() FILE__QUOTAON +$opts_no_quotaon = + "quota,usrquota,grpquota,context=system_u:object_r:test_file_no_quotaon_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_quotaon\n"; +$result = system( +"runcon -t test_file_no_quotaon_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_quotaon $v" +); +ok( $result eq 0 ); + +print "Running quotacheck(8) to init user/group quota files\n"; +$result = system("runcon `id -Z` quotacheck -ugF vfsv0 $private_path/mp1"); +ok( $result eq 0 ); + +print "Toggle User quotas on/off\n"; # Must have full path +$result = system( +"runcon -t test_file_no_quotaon_t $basedir/quotas_test -s $dev -t $private_path/mp1/aquota.user $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_file_no_quotaon_t $basedir/umount -t $basedir/mntpoint/mp1 $v" +); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { mount } ########################## +# hooks.c selinux_sb_kern_mount() FILESYSTEM__MOUNT +$opts_no_mount = "rootcontext=system_u:object_r:test_filesystem_no_mount_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_mount\n"; +$result = system( +"runcon -t test_filesystem_no_mount_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_mount $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { getattr } ########################## +# hooks.c selinux_sb_statfs() FILESYSTEM__GETATTR +$opts_no_getattr = + "rootcontext=system_u:object_r:test_filesystem_no_getattr_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_getattr\n"; +$result = system( +"runcon -t test_filesystem_no_getattr_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_getattr $v" +); +ok( $result eq 0 ); + +$result = system( +"runcon -t test_filesystem_no_getattr_t $basedir/statfs_test -t $basedir/mntpoint $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_filesystem_no_getattr_t $basedir/umount -t $basedir/mntpoint/mp1 $v" +); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { remount } ########################## +# hooks.c selinux_mount() FILESYSTEM__REMOUNT +$opts_no_remount = + "rootcontext=system_u:object_r:test_filesystem_no_remount_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_remount\n"; +$result = system( +"runcon -t test_filesystem_no_remount_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_remount $v" +); +ok( $result eq 0 ); + +print "Then remount\n"; +$result = system( +"runcon -t test_filesystem_no_remount_t $basedir/mount -r -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_remount $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_filesystem_no_remount_t $basedir/umount -t $basedir/mntpoint/mp1 $v" +); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { unmount } ########################## +# hooks.c selinux_umount() FILESYSTEM__UNMOUNT +$opts_no_unmount = + "rootcontext=system_u:object_r:test_filesystem_no_unmount_t:s0"; +mk_mntpoint_1(); +make_fs($fs_type); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_unmount\n"; +$result = system( +"runcon -t test_filesystem_no_unmount_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_unmount $v" +); +ok( $result eq 0 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_filesystem_no_unmount_t $basedir/umount -t $basedir/mntpoint/mp1 $v 2>&1" +); +ok( $result >> 8 eq 13 ); + +# Make sure it does get unmounted +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = + system( + "runcon -t test_filesystem_t $basedir/umount -t $basedir/mntpoint/mp1 $v"); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { associate } ########################## +# hooks.c selinux_inode_setxattr() FILESYSTEM__ASSOCIATE +mk_mntpoint_1(); +make_fs($fs_type); +$opts_no_associate_file = +"defcontext=system_u:object_r:test_filesystem_no_associate_file_t:s0,fscontext=system_u:object_r:test_filesystem_no_associate_file_t:s0"; + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$opts_no_associate_file\n"; +$result = system( +"runcon -t test_filesystem_no_associate_file_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_associate_file $v" +); +ok( $result eq 0 ); + +print "Creating test file $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -t test_filesystem_no_associate_file_t $basedir/create_file_change_context -t unconfined_t -f $basedir/mntpoint/mp1/test_file $v 2>&1" + ); +ok( $result >> 8 eq 13 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = + system( +"runcon -t test_filesystem_no_associate_file_t $basedir/umount -t $basedir/mntpoint/mp1 $v" + ); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +############### Deny filesystem { watch } ########################## +# hooks.c selinux_path_notify() FILESYSTEM__WATCH +if ($test_watch) { + mk_mntpoint_1(); + make_fs($fs_type); + $opts_no_watch = "context=system_u:object_r:test_filesystem_no_watch_t:s0"; + + print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; + print "Using mount options:\n\t$opts_no_watch\n"; + $result = system( +"runcon -t test_filesystem_no_watch_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $opts_no_watch $v" + ); + ok( $result eq 0 ); + + print "test_fanotify\n"; + $result = system( +"runcon -t test_filesystem_no_watch_t $basedir/fanotify_fs $v -t $basedir/mntpoint/mp1 2>&1" + ); + ok( $result >> 8 eq 13 ); + + print "Unmount filesystem from $basedir/mntpoint/mp1\n"; + $result = system( +"runcon -t test_filesystem_no_watch_t $basedir/umount -t $basedir/mntpoint/mp1 $v" + ); + ok( $result eq 0 ); + + print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; + cleanup1(); +} + +########################################################################## +# context - Useful when mounting filesystems that do not support extended +# attributes. +# Tested by - Creating a filesystem that has xattrs set to a different value, +# then mount with context= and confirm that the files have that +# context as well as any newly created files (even if fscreate +# was set to something else), and that setfilecon/setxattr() on +# files within the mount fails with errno EOPNOTSUPP. +########################################################################## +mk_mntpoint_1(); +make_fs($fs_type); + +# Mount with xttrs to create a file with specific context. +$context1_opts = "defcontext=system_u:object_r:test_filesystem_context_t:s0"; + +print "Testing 'context=' mount option\n"; +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$context1_opts\n"; +$result = system( +"runcon -t test_filesystem_context_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $context1_opts $v" +); +ok( $result eq 0 ); + +# Create file with 'test_filesystem_filecon_t' context +print "Creating test file $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -t test_filesystem_context_t $basedir/create_file_change_context -t test_filesystem_filecon_t -f $private_path/mp1/test_file $v" + ); +ok( $result eq 0 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_filesystem_context_t $basedir/umount -t $basedir/mntpoint/mp1 $v" +); +ok( $result eq 0 ); + +# Need to free the loop device, then get new one and attach +system("losetup -d $dev 2>/dev/null"); +get_loop_dev(); +attach_dev(); + +# Mount again with no xttr support +$context2_opts = "context=system_u:object_r:test_filesystem_context_t:s0"; +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$context2_opts\n"; +$result = system( +"runcon -t test_filesystem_context_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $context2_opts $v" +); +ok( $result eq 0 ); + +# Now check the context on file is system_u:object_r:test_filesystem_context_t:s0 +print "Check test file context $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -t test_filesystem_context_t $basedir/check_file_context -f $private_path/mp1/test_file -e system_u:object_r:test_filesystem_context_t:s0 $v" + ); +ok( $result eq 0 ); + +# Then create a file with 'test_filesystem_filecon_t' context, this should fail with EOPNOTSUPP +print "Creating test file $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -t test_filesystem_context_t $basedir/create_file_change_context -t test_filesystem_filecon_t -f $private_path/mp1/test_file $v 2>/dev/null" + ); +ok( $result >> 8 eq 95 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = + system( +"runcon -t test_filesystem_context_t $basedir/umount -t $basedir/mntpoint/mp1 $v" + ); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +########################################################################## +# rootcontext - Explicitly label the root inode of the filesystem being +# mounted before that filesystem or inode becomes visible +# to userspace. +# Tested by - Set mountpoint to unlabeled_t and then check that the +# context of the root directory matches rootcontext= after +# the mount operation. +########################################################################## +mk_mntpoint_1(); +make_fs($fs_type); +$root_opts = "rootcontext=system_u:object_r:test_filesystem_context_t:s0"; + +print "Testing 'rootcontext=' mount option\n"; + +# Reset mountpoint to 'unlabeled_t' so it is different to any other possible test values. +print "Resetting MP to unlabeled_t $basedir/mntpoint/mp1\n"; +$result = + system( +"runcon -t test_filesystem_context_t $basedir/check_mount_context -r -m $basedir/mntpoint/mp1 $v" + ); +ok( $result eq 0 ); + +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$root_opts\n"; +$result = system( +"runcon -t test_filesystem_context_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $root_opts $v" +); +ok( $result eq 0 ); + +# Now check the mountpoint is the 'rootcontext=' value +print "Check MP context $basedir/mntpoint/mp1\n"; +$result = + system( +"runcon -t test_filesystem_context_t $basedir/check_mount_context -m $basedir/mntpoint/mp1 -e system_u:object_r:test_filesystem_context_t:s0 $v" + ); +ok( $result eq 0 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_filesystem_context_t $basedir/umount -t $basedir/mntpoint/mp1 $v" +); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +########################################################################## +# defcontext - Set default security context for unlabeled files. +# This overrides the value set for unlabeled files in policy +# and requires a filesystem that supports xattr labeling. +# Tested by - Create filesystem that has files w/o xattrs and then confirm +# that they are mapped to the specified defcontext upon mount, +# where defcontext differs from the policy default. +########################################################################## +mk_mntpoint_1(); +make_fs($fs_type); + +$test_opts = "context=system_u:object_r:test_filesystem_context_t:s0"; + +print "Testing 'defcontext=' mount option\n"; +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$test_opts\n"; +$result = system( +"runcon -t test_filesystem_context_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $test_opts $v" +); +ok( $result eq 0 ); + +# Create file, its context will be system_u:object_r:test_filesystem_context_t:s0 from $test_opts +print "Creating test file $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -u system_u -t test_filesystem_fscontext_t $basedir/create_file -f $basedir/mntpoint/mp1/test_file -e test_filesystem_context_t $v" + ); +ok( $result eq 0 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = system( +"runcon -t test_filesystem_context_t $basedir/umount -t $basedir/mntpoint/mp1 $v" +); +ok( $result eq 0 ); + +# Need to free the loop device, then get new dev one and attach +system("losetup -d $dev 2>/dev/null"); +get_loop_dev(); +attach_dev(); + +# Mount again with defcontext= +$defcontext_opts = "defcontext=system_u:object_r:test_filesystem_filecon_t:s0"; +print "Mount $fs_type filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$defcontext_opts\n"; +$result = system( +"runcon -t test_filesystem_context_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $defcontext_opts $v" +); +ok( $result eq 0 ); + +# Now check the file context is now system_u:object_r:test_filesystem_filecon_t:s0 +print "Check test file context $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -t test_filesystem_context_t $basedir/check_file_context -f $basedir/mntpoint/mp1/test_file -e system_u:object_r:test_filesystem_filecon_t:s0 $v" + ); +ok( $result eq 0 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = + system( +"runcon -t test_filesystem_context_t $basedir/umount -t $basedir/mntpoint/mp1 $v" + ); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +########################################################################## +# fscontext - Sets the overarching filesystem label to a specific security +# context. This filesystem label is separate from the individual +# labels on the files. +# Tested by - Mount a tmpfs (fs_use_trans) filesystem with fscontext= and +# then create a file within it, checking its context. +########################################################################## +$fs_type = "tmpfs"; +mk_mntpoint_1(); +make_fs($fs_type); +$fscontext_opts = +"fscontext=system_u:object_r:test_filesystem_fscontext_t:s0,size=10M,mode=0770"; + +print "Testing 'fscontext=' mount option\n"; +print "Mount tmpfs filesystem on $basedir/mntpoint/mp1\n"; +print "Using mount options:\n\t$fscontext_opts\n"; +$result = system( +"runcon -t test_filesystem_fscontext_t $basedir/mount -s $dev -t $basedir/mntpoint/mp1 -f $fs_type -o $fscontext_opts $v" +); +ok( $result eq 0 ); + +print "Creating test file $basedir/mntpoint/mp1/test_file\n"; +$result = + system( +"runcon -t test_filesystem_fscontext_t $basedir/create_file_change_context -t test_filesystem_filecon_t -f $private_path/mp1/test_file $v" + ); +ok( $result eq 0 ); + +print "Unmount filesystem from $basedir/mntpoint/mp1\n"; +$result = + system( +"runcon -t test_filesystem_fscontext_t $basedir/umount -t $basedir/mntpoint/mp1 $v" + ); +ok( $result eq 0 ); + +print "Removing: $dev $basedir/mntpoint $basedir/fstest\n"; +cleanup1(); + +reaper(); + +udisks2_restart(); + +exit; diff --git a/tests/filesystem/umount.c b/tests/filesystem/umount.c new file mode 100644 index 0000000..3029741 --- /dev/null +++ b/tests/filesystem/umount.c @@ -0,0 +1,84 @@ +#include +#include +#include +#include +#include +#include +#include +#include + +static void print_usage(char *progname) +{ + fprintf(stderr, + "usage: %s [-t] [-v]\n" + "Where:\n\t" + "-t Target path\n\t" + "-v Print information.\n", progname); + exit(-1); +} + +#define WAIT_COUNT 60 +#define USLEEP_TIME 100000 + +int main(int argc, char *argv[]) +{ + char *context, *tgt = NULL; + int opt, result, i, save_err; + bool verbose = false; + + while ((opt = getopt(argc, argv, "t:v")) != -1) { + switch (opt) { + case 't': + tgt = optarg; + break; + case 'v': + verbose = true; + break; + default: + print_usage(argv[0]); + } + } + + if (!tgt) + print_usage(argv[0]); + + if (verbose) { + result = getcon(&context); + if (result < 0) { + fprintf(stderr, "Failed to obtain process context\n"); + exit(-1); + } + printf("Process context:\n\t%s\n", context); + free(context); + } + + /* + * umount(2) will sometimes return EBUSY when other tasks are + * checking mounts so wait around before bailing out. + */ + for (i = 0; i < WAIT_COUNT; i++) { + result = umount(tgt); + save_err = errno; + if (!result) { + if (verbose) + printf("Unmounted: %s\n", tgt); + + return 0; + } + + if (verbose && save_err == EBUSY) + printf("umount(2) returned EBUSY %d times\n", i + 1); + + if (save_err != EBUSY) { + fprintf(stderr, "Failed umount(2): %s\n", + strerror(save_err)); + return save_err; + } + usleep(USLEEP_TIME); + } + + fprintf(stderr, "Failed to umount(2) after %d retries with: %s\n", + WAIT_COUNT, strerror(save_err)); + + return save_err; +} -- 2.24.1