From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from resqmta-ch2-02v.sys.comcast.net (resqmta-ch2-02v.sys.comcast.net [69.252.207.34]) by mx.groups.io with SMTP id smtpd.web12.20849.1596208779413702136 for ; Fri, 31 Jul 2020 08:19:39 -0700 Authentication-Results: mx.groups.io; dkim=pass header.i=@comcast.net header.s=20190202a header.b=ePhEwWui; spf=pass (domain: comcast.net, ip: 69.252.207.34, mailfrom: rprowel@comcast.net) Received: from resomta-ch2-12v.sys.comcast.net ([69.252.207.108]) by resqmta-ch2-02v.sys.comcast.net with ESMTP id 1WgVkmBxf8jIb1Workcjq9; Fri, 31 Jul 2020 15:19:38 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcast.net; s=20190202a; t=1596208778; bh=0ShsrID2ITYI2NAAxhX81FyBpsoKLlIBjnlTgmsxVtQ=; h=Received:Received:To:From:Subject:Message-ID:Date:MIME-Version: Content-Type; b=ePhEwWuinX/hXElBgFEJ8FcIDhDCoRvfK3KcF0eN+1qaLFf0Q2Z/TJVK0491d4ocO +Y7CgSgdK2KslXkqJFdl0L+jMjo6Kc2WAeMWRf/NGPtQ724RWP8UKu8VW9nyAE/cSj YnPDsmZDeXTrHcfbKCMh5nbIM1xzjWh+fYpGsuuXmXfa3CeevjXE65Pem8QuwdViIK VBzoQhBVNcn1oMGqI6A42X0GjeTIrmMnO5/niI7+ufYxs5JwPZgmFJewG7mbki3kA+ FYuAmNkqsDuwAbQUL486DdAeAMETBMewNOiEPbK5oHGsFS7jS+pXJltmrEhcZ6v9Ei 8w+tW7vBdGtFw== Received: from [10.1.11.102] ([73.174.24.42]) by resomta-ch2-12v.sys.comcast.net with ESMTPSA id 1WolkoJ0bQJHF1Womk68Bd; Fri, 31 Jul 2020 15:19:32 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduiedrieekgdekjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddtnecunecujfgurhepvffhuffkffgfgggtgfesthejredttdefheenucfhrhhomheptfhosgcurfhrohifvghluceorhhprhhofigvlhestghomhgtrghsthdrnhgvtheqnecuggftrfgrthhtvghrnhepveffkeffieekfeelieejgeejffffueekudefkeeuvdduieefieejveevjeeuudetnecuffhomhgrihhnpehpnhhgrdhnohenucfkphepjeefrddujeegrddvgedrgedvnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghloheplgdutddruddruddurddutddvngdpihhnvghtpeejfedrudejgedrvdegrdegvddpmhgrihhlfhhrohhmpehrphhrohifvghlsegtohhmtggrshhtrdhnvghtpdhrtghpthhtohephihotghtoheslhhishhtshdrhihotghtohhprhhojhgvtghtrdhorhhg X-Xfinity-VMeta: sc=0.00;st=legit To: yocto@lists.yoctoproject.org From: "Rob Prowel" Subject: cannot build PDF docs Message-ID: Date: Fri, 31 Jul 2020 11:19:31 -0400 User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:68.0) Gecko/20100101 Thunderbird/68.10.0 MIME-Version: 1.0 Content-Type: text/plain; charset=windows-1252; format=flowed Content-Language: en-US Content-Transfer-Encoding: 7bit Is there some magic to building the PDF versions of the yocto docs? I've tried on multiple machines running debian and differing versions of ubuntu and consistently the PDF docs fail to build. Font substitution errors are trivial, but not being able to locate the images that get are inserted is a pretty serious build bug. What's the secret to building PDF docs, or where are they online? and no, not interested in referring to cloud based HTML docs. I want offline PDF documentation. Thanks! $ make DOC=adt-manual pdf cd adt-manual; ../tools/poky-docbook-to-pdf adt-manual.xml ../template; cd .. Note: namesp. cut : stripped namespace before processing Yocto Project Application Developer's Guide Making portrait pages on A4 paper (210mmx297mm) Attributed 561 IDs for element, cleaned up 0 [warning] /usr/bin/fop: JVM flavor 'sun' not understood Picked up _JAVA_OPTIONS: -Dawt.useSystemAAFontSettings=on -Dswing.aatext=true [INFO] FopConfParser - Default page-height set to: 11in [INFO] FopConfParser - Default page-width set to: 8.26in [ERROR] FOUserAgent - Image not found. URI: figures/adt-title.png. (See position 2:38206) [WARN] FOUserAgent - Font "Symbol,normal,700" not found. Substituting with "Symbol,normal,400". [WARN] FOUserAgent - Font "ZapfDingbats,normal,700" not found. Substituting with "ZapfDingbats,normal,400". [ERROR] FOUserAgent - Image not found. URI: figures/adt-title.png. (No context info available) [INFO] FOUserAgent - Rendered page #1. [INFO] FOUserAgent - Rendered page #2. [INFO] FOUserAgent - Rendered page #3. [INFO] FOUserAgent - Rendered page #4. [INFO] FOUserAgent - Rendered page #5. [ERROR] FOUserAgent - Image not found. URI: figures/using-a-pre-built-image.png. (See position 736:275) [WARN] FOUserAgent - Font "veramono,italic,400" not found. Substituting with "veramono,normal,400". [WARN] FOUserAgent - The contents of fo:block line 1 exceed the available area in the inline-progression direction by more than 50 points. (See position 496:372) [WARN] FOUserAgent - The contents of fo:block line 1 exceed the available area in the inline-progression direction by more than 50 points. (See position 496:372) [WARN] FOUserAgent - The contents of fo:block line 1 exceed the available area in the inline-progression direction by more than 50 points. (See position 496:372) [WARN] FOUserAgent - The contents of fo:block line 1 exceed