From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: by yocto-www.yoctoproject.org (Postfix, from userid 118) id 16C64E00D42; Thu, 8 Sep 2016 05:40:29 -0700 (PDT) X-Spam-Checker-Version: SpamAssassin 3.3.1 (2010-03-16) on yocto-www.yoctoproject.org X-Spam-Level: X-Spam-Status: No, score=0.0 required=5.0 tests=BAYES_50,DKIM_SIGNED, DKIM_VALID, DKIM_VALID_AU, FREEMAIL_FROM, RCVD_IN_DNSWL_LOW autolearn=ham version=3.3.1 X-Spam-HAM-Report: * 0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider * (idealsim[at]laposte.net) * -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at http://www.dnswl.org/, low * trust * [194.117.213.100 listed in list.dnswl.org] * 0.8 BAYES_50 BODY: Bayes spam probability is 40 to 60% * [score: 0.4828] * -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's * domain * 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily * valid * -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature X-Greylist: delayed 1462 seconds by postgrey-1.32 at yocto-www; Thu, 08 Sep 2016 05:40:22 PDT Received: from smtp.laposte.net (smtpoutz25.laposte.net [194.117.213.100]) by yocto-www.yoctoproject.org (Postfix) with ESMTP id B2B7CE00D25 for ; Thu, 8 Sep 2016 05:40:22 -0700 (PDT) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout013 (Postfix) with ESMTP id D00BC104778 for ; Thu, 8 Sep 2016 14:15:58 +0200 (CEST) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail0; t=1473336958; bh=LVAHl1zxequ+iSR7T5TKEWx3Xfga8sUqiBkJmiySdys=; h=Date:To:Subject:From; b=N5E595LMbngWPohRgkRabjFKBzpw9UHJeVPPcrrqERv9BZniSLd2MHP/bf+dX+Qcl Y+fXNYt2keNmphUQivZZr7mdipMbboUr2yqLUD+eqz4HZMvlp/c8ix4MXbceyS6xq8 MfFIG+5vwZ0+G9QgHE4W/MgusRTLyBLJ31Wk915zWP2TbOVQAWBEqqSqZ+scxU1BXp OxfBZEMoFrEUA1ToFy+qlj42ZWq462baddbB+gGM4c8Rf7Supn1Cq4V5XJHEgQ/36E NEz2DiEWoFf0svezcEJuHs1LBSshoEkOfp47pSOPsx99x8FU2V6G8Fq+EQ3I2zsiQw rggvK3A+C9+LQ== Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout013 (Postfix) with ESMTP id C247A104783 for ; Thu, 8 Sep 2016 14:15:58 +0200 (CEST) Received: from lpn-prd-vrin001 (lpn-prd-vrin001.laposte [10.128.63.2]) by lpn-prd-vrout013 (Postfix) with ESMTP id BEC23104778 for ; Thu, 8 Sep 2016 14:15:58 +0200 (CEST) Received: from lpn-prd-vrin001 (localhost [127.0.0.1]) by lpn-prd-vrin001 (Postfix) with ESMTP id AC408366B5C for ; Thu, 8 Sep 2016 14:15:58 +0200 (CEST) Received: from pc-mls.ecafaros.local (unknown [212.234.36.135]) by lpn-prd-vrin001 (Postfix) with ESMTPA id 800FE366A3E for ; Thu, 8 Sep 2016 14:15:58 +0200 (CEST) Date: Thu, 08 Sep 2016 14:15:58 +0200 To: "meta-freescale@yoctoproject.org" MIME-Version: 1.0 From: idealsim Message-ID: User-Agent: Opera Mail/1.0 (Win32) X-VR-SrcIP: 212.234.36.135 X-VR-FullState: 0 X-VR-Score: 0 X-VR-Cause-1: gggruggvucftvghtrhhoucdtuddrfeeluddriedvgdehvdculddtuddrfeeltddrtddtmdcutefuodet X-VR-Cause-2: ggdotefrodftvfcurfhrohhfihhlvgemucfntefrqffuvffgnecuuegrihhlohhuthemucehtddtnecu X-VR-Cause-3: necujfgurheptgffvffuggfghffkfgesthejredttderleenucfhrhhomhepihguvggrlhhsihhmuceo X-VR-Cause-4: ihguvggrlhhsihhmsehlrghpohhsthgvrdhnvghtqeenucffohhmrghinhepohhpvghrrgdrtghomhdp X-VR-Cause-5: ghhithhhuhgsrdgtohhmnecukfhppedvuddvrddvfeegrdefiedrudefheenucfrrghrrghmpehmohgu X-VR-Cause-6: vgepshhmthhpohhuthdphhgvlhhopehptgdqmhhlshdrvggtrghfrghrohhsrdhlohgtrghlpdhinhgv X-VR-Cause-7: thepvdduvddrvdefgedrfeeirddufeehpdhmrghilhhfrhhomhepihguvggrlhhsihhmsehlrghpohhs X-VR-Cause-8: thgvrdhnvghtpdhrtghpthhtohepmhgvthgrqdhfrhgvvghstggrlhgvseihohgtthhophhrohhjvggt X-VR-Cause-9: thdrohhrgh X-VR-AvState: No X-VR-State: 0 X-VR-State: 0 Subject: qquickcontrols2 error Krogoth Branch X-BeenThere: meta-freescale@yoctoproject.org X-Mailman-Version: 2.1.13 Precedence: list List-Id: Usage and development list for the meta-fsl-* layers List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , X-List-Received-Date: Thu, 08 Sep 2016 12:40:29 -0000 Content-Type: text/plain; charset=iso-8859-15; format=flowed; delsp=yes Content-Transfer-Encoding: 7bit Hi i'm trying to build an image with qt5 krogoth branch. All work fine but i have an error with qquickcontols2, see here for the log : https://gist.github.com/modjo756/99d352746cc50244d57bcdd8aac31d88 apparently a problem with this function : void initializeObjectWithInitialProperties(QV4::QmlContext *qmlContext, const QV4::Value &valuemap, QObject *toCreate); candidate expects 3 arguments, 2 provided If someone can help ... Thanks in advance ! -- Utilisant le logiciel de courrier d'Opera : http://www.opera.com/mail/