linux-mm.kvack.org archive mirror
 help / color / mirror / Atom feed
* incoming
@ 2020-07-03 22:14 Andrew Morton
  2020-07-03 22:15 ` [patch 1/5] mm/hugetlb.c: fix pages per hugetlb calculation Andrew Morton
                   ` (10 more replies)
  0 siblings, 11 replies; 203+ messages in thread
From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822.

Subsystems affected by this patch series:

  mm/hugetlb
  samples
  mm/cma
  mm/vmalloc
  mm/pagealloc

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb.c: fix pages per hugetlb calculation

Subsystem: samples

    Kees Cook <keescook@chromium.org>:
      samples/vfs: avoid warning in statx override

Subsystem: mm/cma

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/cma.c: use exact_nid true to fix possible per-numa cma leak

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
      vmalloc: fix the owner argument for the new __vmalloc_node_range callers

Subsystem: mm/pagealloc

    Joel Savitz <jsavitz@redhat.com>:
      mm/page_alloc: fix documentation error

 arch/arm64/kernel/probes/kprobes.c |    2 +-
 arch/x86/hyperv/hv_init.c          |    3 ++-
 kernel/module.c                    |    2 +-
 mm/cma.c                           |    4 ++--
 mm/hugetlb.c                       |    2 +-
 mm/page_alloc.c                    |    2 +-
 samples/vfs/test-statx.c           |    2 ++
 7 files changed, 10 insertions(+), 7 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* [patch 1/5] mm/hugetlb.c: fix pages per hugetlb calculation
  2020-07-03 22:14 incoming Andrew Morton
@ 2020-07-03 22:15 ` Andrew Morton
  2020-07-03 22:15 ` [patch 2/5] samples/vfs: avoid warning in statx override Andrew Morton
                   ` (9 subsequent siblings)
  10 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-07-03 22:15 UTC (permalink / raw)
  To: akpm, kirill.shutemov, linux-mm, mhocko, mike.kravetz,
	mm-commits, stable, torvalds, willy

From: Mike Kravetz <mike.kravetz@oracle.com>
Subject: mm/hugetlb.c: fix pages per hugetlb calculation

The routine hpage_nr_pages() was incorrectly used to calculate the number
of base pages in a hugetlb page.  hpage_nr_pages is designed to be called
for THP pages and will return HPAGE_PMD_NR for hugetlb pages of any size.

Due to the context in which hpage_nr_pages was called, it is unlikely to
produce a user visible error.  The routine with the incorrect call is only
exercised in the case of hugetlb memory error or migration.  In addition,
this would need to be on an architecture which supports huge page sizes
less than PMD_SIZE.  And, the vma containing the huge page would also need
to smaller than PMD_SIZE.

Link: http://lkml.kernel.org/r/20200629185003.97202-1-mike.kravetz@oracle.com
Fixes: c0d0381ade79 ("hugetlbfs: use i_mmap_rwsem for more pmd sharing synchronization")
Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Reported-by: Matthew Wilcox (Oracle) <willy@infradead.org>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: "Kirill A . Shutemov" <kirill.shutemov@linux.intel.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/hugetlb.c~hugetlb-fix-pages-per-hugetlb-calculation
+++ a/mm/hugetlb.c
@@ -1593,7 +1593,7 @@ static struct address_space *_get_hugetl
 
 	/* Use first found vma */
 	pgoff_start = page_to_pgoff(hpage);
-	pgoff_end = pgoff_start + hpage_nr_pages(hpage) - 1;
+	pgoff_end = pgoff_start + pages_per_huge_page(page_hstate(hpage)) - 1;
 	anon_vma_interval_tree_foreach(avc, &anon_vma->rb_root,
 					pgoff_start, pgoff_end) {
 		struct vm_area_struct *vma = avc->vma;
_


^ permalink raw reply	[flat|nested] 203+ messages in thread

* [patch 2/5] samples/vfs: avoid warning in statx override
  2020-07-03 22:14 incoming Andrew Morton
  2020-07-03 22:15 ` [patch 1/5] mm/hugetlb.c: fix pages per hugetlb calculation Andrew Morton
@ 2020-07-03 22:15 ` Andrew Morton
  2020-07-03 22:15 ` [patch 3/5] mm/cma.c: use exact_nid true to fix possible per-numa cma leak Andrew Morton
                   ` (8 subsequent siblings)
  10 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-07-03 22:15 UTC (permalink / raw)
  To: akpm, dhowells, keescook, linux-mm, mm-commits, mszeredi, torvalds, viro

From: Kees Cook <keescook@chromium.org>
Subject: samples/vfs: avoid warning in statx override

Something changed recently to uncover this warning:

samples/vfs/test-statx.c:24:15: warning: `struct foo' declared inside parameter list will not be visible outside of this definition or declaration
   24 | #define statx foo
      |               ^~~

Which is due the use of "struct statx" (here, "struct foo") in a function
prototype argument list before it has been defined:

 int
 # 56 "/usr/include/x86_64-linux-gnu/bits/statx-generic.h"
    foo
 # 56 "/usr/include/x86_64-linux-gnu/bits/statx-generic.h" 3 4
          (int __dirfd, const char *__restrict __path, int __flags,
            unsigned int __mask, struct
 # 57 "/usr/include/x86_64-linux-gnu/bits/statx-generic.h"
                                       foo
 # 57 "/usr/include/x86_64-linux-gnu/bits/statx-generic.h" 3 4
                                             *__restrict __buf)
   __attribute__ ((__nothrow__ , __leaf__)) __attribute__ ((__nonnull__ (2, 5)));

Add explicit struct before #include to avoid warning.

Link: http://lkml.kernel.org/r/202006282213.C516EA6@keescook
Fixes: f1b5618e013a ("vfs: Add a sample program for the new mount API")
Signed-off-by: Kees Cook <keescook@chromium.org>
Cc: Miklos Szeredi <mszeredi@redhat.com>
Cc: Al Viro <viro@zeniv.linux.org.uk>
Cc: David Howells <dhowells@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 samples/vfs/test-statx.c |    2 ++
 1 file changed, 2 insertions(+)

--- a/samples/vfs/test-statx.c~samples-vfs-avoid-warning-in-statx-override
+++ a/samples/vfs/test-statx.c
@@ -23,6 +23,8 @@
 #include <linux/fcntl.h>
 #define statx foo
 #define statx_timestamp foo_timestamp
+struct statx;
+struct statx_timestamp;
 #include <sys/stat.h>
 #undef statx
 #undef statx_timestamp
_


^ permalink raw reply	[flat|nested] 203+ messages in thread

* [patch 3/5] mm/cma.c: use exact_nid true to fix possible per-numa cma leak
  2020-07-03 22:14 incoming Andrew Morton
  2020-07-03 22:15 ` [patch 1/5] mm/hugetlb.c: fix pages per hugetlb calculation Andrew Morton
  2020-07-03 22:15 ` [patch 2/5] samples/vfs: avoid warning in statx override Andrew Morton
@ 2020-07-03 22:15 ` Andrew Morton
  2020-07-03 22:15 ` [patch 4/5] vmalloc: fix the owner argument for the new __vmalloc_node_range callers Andrew Morton
                   ` (7 subsequent siblings)
  10 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-07-03 22:15 UTC (permalink / raw)
  To: akpm, andreas.schaufler, aslan, guro, Jonathan.Cameron, js1304,
	linux-mm, mhocko, mike.kravetz, mm-commits, riel, robin.murphy,
	song.bao.hua, stable, torvalds

From: Barry Song <song.bao.hua@hisilicon.com>
Subject: mm/cma.c: use exact_nid true to fix possible per-numa cma leak

Calling cma_declare_contiguous_nid() with false exact_nid for per-numa
reservation can easily cause cma leak and various confusion.  For example,
mm/hugetlb.c is trying to reserve per-numa cma for gigantic pages.  But it
can easily leak cma and make users confused when system has memoryless
nodes.

In case the system has 4 numa nodes, and only numa node0 has memory.  if
we set hugetlb_cma=4G in bootargs, mm/hugetlb.c will get 4 cma areas for 4
different numa nodes.  since exact_nid=false in current code, all 4 numa
nodes will get cma successfully from node0, but hugetlb_cma[1 to 3] will
never be available to hugepage will only allocate memory from
hugetlb_cma[0].

In case the system has 4 numa nodes, both numa node0&2 has memory, other
nodes have no memory.  if we set hugetlb_cma=4G in bootargs, mm/hugetlb.c
will get 4 cma areas for 4 different numa nodes.  since exact_nid=false in
current code, all 4 numa nodes will get cma successfully from node0 or 2,
but hugetlb_cma[1] and [3] will never be available to hugepage as
mm/hugetlb.c will only allocate memory from hugetlb_cma[0] and
hugetlb_cma[2].  This causes permanent leak of the cma areas which are
supposed to be used by memoryless node.

Of cource we can workaround the issue by letting mm/hugetlb.c scan all cma
areas in alloc_gigantic_page() even node_mask includes node0 only.  that
means when node_mask includes node0 only, we can get page from
hugetlb_cma[1] to hugetlb_cma[3].  But this will cause kernel crash in
free_gigantic_page() while it wants to free page by:
cma_release(hugetlb_cma[page_to_nid(page)], page, 1 << order)

On the other hand, exact_nid=false won't consider numa distance, it might
be not that useful to leverage cma areas on remote nodes.  I feel it is
much simpler to make exact_nid true to make everything clear.  After that,
memoryless nodes won't be able to reserve per-numa CMA from other nodes
which have memory.

Link: http://lkml.kernel.org/r/20200628074345.27228-1-song.bao.hua@hisilicon.com
Fixes: cf11e85fc08c ("mm: hugetlb: optionally allocate gigantic hugepages using cma")
Signed-off-by: Barry Song <song.bao.hua@hisilicon.com>
Acked-by: Roman Gushchin <guro@fb.com>
Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com>
Cc: Aslan Bakirov <aslan@fb.com>
Cc: Michal Hocko <mhocko@kernel.org>
Cc: Andreas Schaufler <andreas.schaufler@gmx.de>
Cc: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Rik van Riel <riel@surriel.com>
Cc: Joonsoo Kim <js1304@gmail.com>
Cc: Robin Murphy <robin.murphy@arm.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/cma.c |    4 ++--
 1 file changed, 2 insertions(+), 2 deletions(-)

--- a/mm/cma.c~mm-cmac-use-exact_nid-true-to-fix-possible-per-numa-cma-leak
+++ a/mm/cma.c
@@ -339,13 +339,13 @@ int __init cma_declare_contiguous_nid(ph
 		 */
 		if (base < highmem_start && limit > highmem_start) {
 			addr = memblock_alloc_range_nid(size, alignment,
-					highmem_start, limit, nid, false);
+					highmem_start, limit, nid, true);
 			limit = highmem_start;
 		}
 
 		if (!addr) {
 			addr = memblock_alloc_range_nid(size, alignment, base,
-					limit, nid, false);
+					limit, nid, true);
 			if (!addr) {
 				ret = -ENOMEM;
 				goto err;
_


^ permalink raw reply	[flat|nested] 203+ messages in thread

* [patch 4/5] vmalloc: fix the owner argument for the new __vmalloc_node_range callers
  2020-07-03 22:14 incoming Andrew Morton
                   ` (2 preceding siblings ...)
  2020-07-03 22:15 ` [patch 3/5] mm/cma.c: use exact_nid true to fix possible per-numa cma leak Andrew Morton
@ 2020-07-03 22:15 ` Andrew Morton
  2020-07-03 22:15 ` [patch 5/5] mm/page_alloc: fix documentation error Andrew Morton
                   ` (6 subsequent siblings)
  10 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-07-03 22:15 UTC (permalink / raw)
  To: akpm, ardb, hch, linux-mm, mm-commits, torvalds

From: Christoph Hellwig <hch@lst.de>
Subject: vmalloc: fix the owner argument for the new __vmalloc_node_range callers

Fix the recently added new __vmalloc_node_range callers to pass the
correct values as the owner for display in /proc/vmallocinfo.

Link: http://lkml.kernel.org/r/20200627075649.2455097-1-hch@lst.de
Fixes: 800e26b81311 ("x86/hyperv: allocate the hypercall page with only read and execute bits")
Fixes: 10d5e97c1bf8 ("arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page")
Fixes: 7a0e27b2a0ce ("mm: remove vmalloc_exec")
Signed-off-by: Christoph Hellwig <hch@lst.de>
Reported-by: Ard Biesheuvel <ardb@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm64/kernel/probes/kprobes.c |    2 +-
 arch/x86/hyperv/hv_init.c          |    3 ++-
 kernel/module.c                    |    2 +-
 3 files changed, 4 insertions(+), 3 deletions(-)

--- a/arch/arm64/kernel/probes/kprobes.c~vmalloc-fix-the-owner-argument-for-the-new-__vmalloc_node_range-callers
+++ a/arch/arm64/kernel/probes/kprobes.c
@@ -122,7 +122,7 @@ void *alloc_insn_page(void)
 {
 	return __vmalloc_node_range(PAGE_SIZE, 1, VMALLOC_START, VMALLOC_END,
 			GFP_KERNEL, PAGE_KERNEL_ROX, VM_FLUSH_RESET_PERMS,
-			NUMA_NO_NODE, __func__);
+			NUMA_NO_NODE, __builtin_return_address(0));
 }
 
 /* arm kprobe: install breakpoint in text */
--- a/arch/x86/hyperv/hv_init.c~vmalloc-fix-the-owner-argument-for-the-new-__vmalloc_node_range-callers
+++ a/arch/x86/hyperv/hv_init.c
@@ -377,7 +377,8 @@ void __init hyperv_init(void)
 
 	hv_hypercall_pg = __vmalloc_node_range(PAGE_SIZE, 1, VMALLOC_START,
 			VMALLOC_END, GFP_KERNEL, PAGE_KERNEL_ROX,
-			VM_FLUSH_RESET_PERMS, NUMA_NO_NODE, __func__);
+			VM_FLUSH_RESET_PERMS, NUMA_NO_NODE,
+			__builtin_return_address(0));
 	if (hv_hypercall_pg == NULL) {
 		wrmsrl(HV_X64_MSR_GUEST_OS_ID, 0);
 		goto remove_cpuhp_state;
--- a/kernel/module.c~vmalloc-fix-the-owner-argument-for-the-new-__vmalloc_node_range-callers
+++ a/kernel/module.c
@@ -2785,7 +2785,7 @@ void * __weak module_alloc(unsigned long
 {
 	return __vmalloc_node_range(size, 1, VMALLOC_START, VMALLOC_END,
 			GFP_KERNEL, PAGE_KERNEL_EXEC, VM_FLUSH_RESET_PERMS,
-			NUMA_NO_NODE, __func__);
+			NUMA_NO_NODE, __builtin_return_address(0));
 }
 
 bool __weak module_init_section(const char *name)
_


^ permalink raw reply	[flat|nested] 203+ messages in thread

* [patch 5/5] mm/page_alloc: fix documentation error
  2020-07-03 22:14 incoming Andrew Morton
                   ` (3 preceding siblings ...)
  2020-07-03 22:15 ` [patch 4/5] vmalloc: fix the owner argument for the new __vmalloc_node_range callers Andrew Morton
@ 2020-07-03 22:15 ` Andrew Morton
  2020-07-07  1:53 ` mmotm 2020-07-06-18-53 uploaded Andrew Morton
                   ` (5 subsequent siblings)
  10 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-07-03 22:15 UTC (permalink / raw)
  To: akpm, aquini, fdangelo, jsavitz, linux-mm, mm-commits, torvalds, willy

From: Joel Savitz <jsavitz@redhat.com>
Subject: mm/page_alloc: fix documentation error

When I increased the upper bound of the min_free_kbytes value in
ee8eb9a5fe863 ("mm/page_alloc: increase default min_free_kbytes bound") I
forgot to tweak the above comment to reflect the new value.  This patch
fixes that mistake.

Link: http://lkml.kernel.org/r/20200624221236.29560-1-jsavitz@redhat.com
Signed-off-by: Joel Savitz <jsavitz@redhat.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Rafael Aquini <aquini@redhat.com>
Cc: Fabrizio D'Angelo <fdangelo@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/page_alloc.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/page_alloc.c~mm-page_alloc-fix-documentation-error
+++ a/mm/page_alloc.c
@@ -7832,7 +7832,7 @@ void setup_per_zone_wmarks(void)
  * Initialise min_free_kbytes.
  *
  * For small machines we want it small (128k min).  For large machines
- * we want it large (64MB max).  But it is not linear, because network
+ * we want it large (256MB max).  But it is not linear, because network
  * bandwidth does not increase linearly with machine size.  We use
  *
  *	min_free_kbytes = 4 * sqrt(lowmem_kbytes), for better accuracy:
_


^ permalink raw reply	[flat|nested] 203+ messages in thread

* mmotm 2020-07-06-18-53 uploaded
  2020-07-03 22:14 incoming Andrew Morton
                   ` (4 preceding siblings ...)
  2020-07-03 22:15 ` [patch 5/5] mm/page_alloc: fix documentation error Andrew Morton
@ 2020-07-07  1:53 ` Andrew Morton
  2020-07-07  5:44   ` mmotm 2020-07-06-18-53 uploaded (sound/soc/amd/renoir/rn-pci-acp3x.c:) Randy Dunlap
  2020-07-09  2:29 ` mmotm 2020-07-08-19-28 uploaded Andrew Morton
                   ` (4 subsequent siblings)
  10 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2020-07-07  1:53 UTC (permalink / raw)
  To: broonie, linux-fsdevel, linux-kernel, linux-mm, linux-next,
	mhocko, mm-commits, sfr

The mm-of-the-moment snapshot 2020-07-06-18-53 has been uploaded to

   http://www.ozlabs.org/~akpm/mmotm/

mmotm-readme.txt says

README for mm-of-the-moment:

http://www.ozlabs.org/~akpm/mmotm/

This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
more than once a week.

You will need quilt to apply these patches to the latest Linus release (5.x
or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
http://ozlabs.org/~akpm/mmotm/series

The file broken-out.tar.gz contains two datestamp files: .DATE and
.DATE-yyyy-mm-dd-hh-mm-ss.  Both contain the string yyyy-mm-dd-hh-mm-ss,
followed by the base kernel version against which this patch series is to
be applied.

This tree is partially included in linux-next.  To see which patches are
included in linux-next, consult the `series' file.  Only the patches
within the #NEXT_PATCHES_START/#NEXT_PATCHES_END markers are included in
linux-next.


A full copy of the full kernel tree with the linux-next and mmotm patches
already applied is available through git within an hour of the mmotm
release.  Individual mmotm releases are tagged.  The master branch always
points to the latest release, so it's constantly rebasing.

	https://github.com/hnaz/linux-mm

The directory http://www.ozlabs.org/~akpm/mmots/ (mm-of-the-second)
contains daily snapshots of the -mm tree.  It is updated more frequently
than mmotm, and is untested.

A git copy of this tree is also available at

	https://github.com/hnaz/linux-mm



This mmotm tree contains the following patches against 5.8-rc4:
(patches marked "*" will be included in linux-next)

  origin.patch
* mm-shuffle-dont-move-pages-between-zones-and-dont-read-garbage-memmaps.patch
* vfs-xattr-mm-shmem-kernfs-release-simple-xattr-entry-in-a-right-way.patch
* mm-initialize-return-of-vm_insert_pages.patch
* mm-memcontrol-fix-oops-inside-mem_cgroup_get_nr_swap_pages.patch
* proc-kpageflags-prevent-an-integer-overflow-in-stable_page_flags.patch
* proc-kpageflags-do-not-use-uninitialized-struct-pages.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan.patch
* checkpatch-test-git_dir-changes.patch
* kthread-work-could-not-be-queued-when-worker-being-destroyed.patch
* scripts-tagssh-collect-compiled-source-precisely.patch
* scripts-tagssh-collect-compiled-source-precisely-v2.patch
* bloat-o-meter-support-comparing-library-archives.patch
* scripts-decode_stacktrace-skip-missing-symbols.patch
* scripts-decode_stacktrace-guess-basepath-if-not-specified.patch
* scripts-decode_stacktrace-guess-path-to-modules.patch
* scripts-decode_stacktrace-guess-path-to-vmlinux-by-release-name.patch
* ocfs2-clear-links-count-in-ocfs2_mknod-if-an-error-occurs.patch
* ocfs2-fix-ocfs2-corrupt-when-iputting-an-inode.patch
* ocfs2-change-slot-number-type-s16-to-u16.patch
* ramfs-support-o_tmpfile.patch
* kernel-watchdog-flush-all-printk-nmi-buffers-when-hardlockup-detected.patch
  mm.patch
* mm-treewide-rename-kzfree-to-kfree_sensitive.patch
* mm-ksize-should-silently-accept-a-null-pointer.patch
* mm-expand-config_slab_freelist_hardened-to-include-slab.patch
* slab-add-naive-detection-of-double-free.patch
* slab-add-naive-detection-of-double-free-fix.patch
* mm-slab-check-gfp_slab_bug_mask-before-alloc_pages-in-kmalloc_order.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks-fix.patch
* mm-slub-make-some-slub_debug-related-attributes-read-only.patch
* mm-slub-remove-runtime-allocation-order-changes.patch
* mm-slub-make-remaining-slub_debug-related-attributes-read-only.patch
* mm-slub-make-reclaim_account-attribute-read-only.patch
* mm-slub-introduce-static-key-for-slub_debug.patch
* mm-slub-introduce-kmem_cache_debug_flags.patch
* mm-slub-introduce-kmem_cache_debug_flags-fix.patch
* mm-slub-extend-checks-guarded-by-slub_debug-static-key.patch
* mm-slab-slub-move-and-improve-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj-fix.patch
* slub-drop-lockdep_assert_held-from-put_map.patch
* mm-kcsan-instrument-slab-slub-free-with-assert_exclusive_access.patch
* mm-debug_vm_pgtable-add-tests-validating-arch-helpers-for-core-mm-features.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers.patch
* mm-debug_vm_pgtable-add-debug-prints-for-individual-tests.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers.patch
* mm-filemap-clear-idle-flag-for-writes.patch
* mm-filemap-add-missing-fgp_-flags-in-kerneldoc-comment-for-pagecache_get_page.patch
* mm-kmem-make-memcg_kmem_enabled-irreversible.patch
* mm-memcg-factor-out-memcg-and-lruvec-level-changes-out-of-__mod_lruvec_state.patch
* mm-memcg-prepare-for-byte-sized-vmstat-items.patch
* mm-memcg-convert-vmstat-slab-counters-to-bytes.patch
* mm-slub-implement-slub-version-of-obj_to_index.patch
* mm-memcontrol-decouple-reference-counting-from-page-accounting.patch
* mm-memcg-slab-obj_cgroup-api.patch
* mm-memcg-slab-allocate-obj_cgroups-for-non-root-slab-pages.patch
* mm-memcg-slab-save-obj_cgroup-for-non-root-slab-objects.patch
* mm-memcg-slab-charge-individual-slab-objects-instead-of-pages.patch
* mm-memcg-slab-deprecate-memorykmemslabinfo.patch
* mm-memcg-slab-move-memcg_kmem_bypass-to-memcontrolh.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-accounted-allocations.patch
* mm-memcg-slab-simplify-memcg-cache-creation.patch
* mm-memcg-slab-remove-memcg_kmem_get_cache.patch
* mm-memcg-slab-deprecate-slab_root_caches.patch
* mm-memcg-slab-remove-redundant-check-in-memcg_accumulate_slabinfo.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-allocations.patch
* kselftests-cgroup-add-kernel-memory-accounting-tests.patch
* tools-cgroup-add-memcg_slabinfopy-tool.patch
* percpu-return-number-of-released-bytes-from-pcpu_free_area.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix-fix.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics-v3.patch
* mm-memcg-charge-memcg-percpu-memory-to-the-parent-cgroup.patch
* kselftests-cgroup-add-perpcu-memory-accounting-test.patch
* mm-memcontrol-account-kernel-stack-per-node.patch
* mm-remove-redundant-check-non_swap_entry.patch
* mm-memoryc-make-remap_pfn_range-reject-unaligned-addr.patch
* mm-remove-unneeded-includes-of-asm-pgalloch.patch
* opeinrisc-switch-to-generic-version-of-pte-allocation.patch
* xtensa-switch-to-generic-version-of-pte-allocation.patch
* asm-generic-pgalloc-provide-generic-pmd_alloc_one-and-pmd_free_one.patch
* asm-generic-pgalloc-provide-generic-pud_alloc_one-and-pud_free_one.patch
* asm-generic-pgalloc-provide-generic-pgd_free.patch
* mm-move-lib-ioremapc-to-mm.patch
* mm-move-pd_alloc_track-to-separate-header-file.patch
* mm-mmap-fix-the-adjusted-length-error.patch
* proc-meminfo-avoid-open-coded-reading-of-vm_committed_as.patch
* mm-utilc-make-vm_memory_committed-more-accurate.patch
* mm-adjust-vm_committed_as_batch-according-to-vm-overcommit-policy.patch
* mm-mmap-optimize-a-branch-judgment-in-ksys_mmap_pgoff.patch
* mm-sparse-never-partially-remove-memmap-for-early-section.patch
* mm-sparse-only-sub-section-aligned-range-would-be-populated.patch
* vmalloc-convert-to-xarray.patch
* mm-vmalloc-simplify-merge_or_add_vmap_area-func.patch
* mm-vmalloc-simplify-augment_tree_propagate_check-func.patch
* mm-vmalloc-switch-to-propagate-callback.patch
* mm-vmalloc-update-the-header-about-kva-rework.patch
* kasan-improve-and-simplify-kconfigkasan.patch
* kasan-update-required-compiler-versions-in-documentation.patch
* rcu-kasan-record-and-print-call_rcu-call-stack.patch
* kasan-record-and-print-the-free-track.patch
* kasan-add-tests-for-call_rcu-stack-recording.patch
* kasan-update-documentation-for-generic-kasan.patch
* kasan-remove-kasan_unpoison_stack_above_sp_to.patch
* mm-page_alloc-use-unlikely-in-task_capc.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast-v5.patch
* mm-page_alloc-skip-waternark_boost-for-atomic-order-0-allocations.patch
* mm-page_alloc-skip-watermark_boost-for-atomic-order-0-allocations-fix.patch
* mm-drop-vm_total_pages.patch
* mm-page_alloc-drop-nr_free_pagecache_pages.patch
* mm-memory_hotplug-document-why-shuffle_zone-is-relevant.patch
* mm-shuffle-remove-dynamic-reconfiguration.patch
* powerpc-numa-set-numa_node-for-all-possible-cpus.patch
* powerpc-numa-prefer-node-id-queried-from-vphn.patch
* mm-page_alloc-keep-memoryless-cpuless-node-0-offline.patch
* mm-page_allocc-replace-the-definition-of-nr_migratetype_bits-with-pb_migratetype_bits.patch
* mm-page_allocc-extract-the-common-part-in-pfn_to_bitidx.patch
* mm-page_allocc-simplify-pageblock-bitmap-access.patch
* mm-page_allocc-remove-unnecessary-end_bitidx-for-_pfnblock_flags_mask.patch
* mm-page_alloc-silence-a-kasan-false-positive.patch
* mm-page_alloc-fallbacks-at-most-has-3-elements.patch
* mm-page_alloc-skip-setting-nodemask-when-we-are-in-interrupt.patch
* mm-huge_memoryc-update-tlb-entry-if-pmd-is-changed.patch
* mips-do-not-call-flush_tlb_all-when-setting-pmd-entry.patch
* mm-vmscanc-fixed-typo.patch
* mm-proactive-compaction.patch
* mm-proactive-compaction-fix.patch
* mm-use-unsigned-types-for-fragmentation-score.patch
* hugetlbfs-prevent-filesystem-stacking-of-hugetlbfs.patch
* mm-page_isolation-prefer-the-node-of-the-source-page.patch
* mm-migrate-move-migration-helper-from-h-to-c.patch
* mm-hugetlb-unify-migration-callbacks.patch
* mm-hugetlb-make-hugetlb-migration-callback-cma-aware.patch
* mm-migrate-make-a-standard-migration-target-allocation-function.patch
* mm-gup-use-a-standard-migration-target-allocation-callback.patch
* mm-mempolicy-use-a-standard-migration-target-allocation-callback.patch
* mm-page_alloc-remove-a-wrapper-for-alloc_migration_target.patch
* mm-thp-remove-debug_cow-switch.patch
* mm-vmstat-add-events-for-pmd-based-thp-migration-without-split.patch
* mm-vmstat-add-events-for-pmd-based-thp-migration-without-split-fix.patch
* mm-vmstat-add-events-for-pmd-based-thp-migration-without-split-update.patch
* mm-store-compound_nr-as-well-as-compound_order.patch
* mm-move-page-flags-include-to-top-of-file.patch
* mm-add-thp_order.patch
* mm-add-thp_size.patch
* mm-replace-hpage_nr_pages-with-thp_nr_pages.patch
* mm-add-thp_head.patch
* mm-introduce-offset_in_thp.patch
* mm-cma-fix-null-pointer-dereference-when-cma-could-not-be-activated.patch
* mm-cma-fix-the-name-of-cma-areas.patch
* mm-cma-fix-the-name-of-cma-areas-fix.patch
* mm-hugetlb-fix-the-name-of-hugetlb-cma.patch
* mmhwpoison-cleanup-unused-pagehuge-check.patch
* mm-hwpoison-remove-recalculating-hpage.patch
* mmmadvise-call-soft_offline_page-without-mf_count_increased.patch
* mmmadvise-refactor-madvise_inject_error.patch
* mmhwpoison-inject-dont-pin-for-hwpoison_filter.patch
* mmhwpoison-un-export-get_hwpoison_page-and-make-it-static.patch
* mmhwpoison-kill-put_hwpoison_page.patch
* mmhwpoison-remove-mf_count_increased.patch
* mmhwpoison-remove-flag-argument-from-soft-offline-functions.patch
* mmhwpoison-unify-thp-handling-for-hard-and-soft-offline.patch
* mmhwpoison-rework-soft-offline-for-free-pages.patch
* mmhwpoison-rework-soft-offline-for-free-pages-fix.patch
* mmhwpoison-rework-soft-offline-for-in-use-pages.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page-fix.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page-fix-fix.patch
* mmhwpoison-return-0-if-the-page-is-already-poisoned-in-soft-offline.patch
* mmhwpoison-introduce-mf_msg_unsplit_thp.patch
* sched-mm-optimize-current_gfp_context.patch
* x86-mm-use-max-memory-block-size-on-bare-metal.patch
* info-task-hung-in-generic_file_write_iter.patch
* info-task-hung-in-generic_file_write-fix.patch
* kernel-hung_taskc-monitor-killed-tasks.patch
* fix-annotation-of-ioreadwrite1632be.patch
* sparse-group-the-defines-by-functionality.patch
* bitmap-fix-bitmap_cut-for-partial-overlapping-case.patch
* bitmap-add-test-for-bitmap_cut.patch
* lib-generic-radix-treec-remove-unneeded-__rcu.patch
* lib-test_bitops-do-the-full-test-during-module-init.patch
* lib-optimize-cpumask_local_spread.patch
* bits-add-tests-of-genmask.patch
* bits-add-tests-of-genmask-fix.patch
* bits-add-tests-of-genmask-fix-2.patch
* checkpatch-add-test-for-possible-misuse-of-is_enabled-without-config_.patch
* checkpatch-support-deprecated-terms-checking.patch
* scripts-deprecated_terms-recommend-denylist-allowlist-instead-of-blacklist-whitelist.patch
* checkpatch-add-fix-option-for-assign_in_if.patch
* checkpatch-fix-const_struct-when-const_structscheckpatch-is-missing.patch
* fatfs-switch-write_lock-to-read_lock-in-fat_ioctl_get_attributes.patch
* fs-signalfdc-fix-inconsistent-return-codes-for-signalfd4.patch
* selftests-kmod-use-variable-name-in-kmod_test_0001.patch
* kmod-remove-redundant-be-an-in-the-comment.patch
* test_kmod-avoid-potential-double-free-in-trigger_config_run_type.patch
* coredump-add-%f-for-executable-filename.patch
* exec-change-uselib2-is_sreg-failure-to-eacces.patch
* exec-move-s_isreg-check-earlier.patch
* exec-move-path_noexec-check-earlier.patch
* umh-fix-refcount-underflow-in-fork_usermode_blob.patch
* kdump-append-kernel-build-id-string-to-vmcoreinfo.patch
* rapidio-rio_mport_cdev-use-struct_size-helper.patch
* rapidio-use-struct_size-helper.patch
* kernel-panicc-make-oops_may_print-return-bool.patch
* lib-kconfigdebug-fix-typo-in-the-help-text-of-config_panic_timeout.patch
* aio-simplify-read_events.patch
* kcov-unconditionally-add-fno-stack-protector-to-compiler-options.patch
* kcov-make-some-symbols-static.patch
  linux-next.patch
  linux-next-rejects.patch
* mm-madvise-pass-task-and-mm-to-do_madvise.patch
* pid-move-pidfd_get_pid-to-pidc.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix-2.patch
* mm-madvise-check-fatal-signal-pending-of-target-process.patch
* all-arch-remove-system-call-sys_sysctl.patch
* all-arch-remove-system-call-sys_sysctl-fix.patch
* mm-kmemleak-silence-kcsan-splats-in-checksum.patch
* mm-frontswap-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races-v2.patch
* mm-swap_state-mark-various-intentional-data-races.patch
* mm-filemap-fix-a-data-race-in-filemap_fault.patch
* mm-swapfile-fix-and-annotate-various-data-races.patch
* mm-swapfile-fix-and-annotate-various-data-races-v2.patch
* mm-page_counter-fix-various-data-races-at-memsw.patch
* mm-memcontrol-fix-a-data-race-in-scan-count.patch
* mm-list_lru-fix-a-data-race-in-list_lru_count_one.patch
* mm-mempool-fix-a-data-race-in-mempool_free.patch
* mm-rmap-annotate-a-data-race-at-tlb_flush_batched.patch
* mm-swap-annotate-data-races-for-lru_rotate_pvecs.patch
* mm-annotate-a-data-race-in-page_zonenum.patch
* include-asm-generic-vmlinuxldsh-align-ro_after_init.patch
* sh-clkfwk-remove-r8-r16-r32.patch
* sh-remove-call-to-memset-after-dma_alloc_coherent.patch
* sh-use-generic-strncpy.patch
* sh-add-missing-export_symbol-for-__delay.patch
  make-sure-nobodys-leaking-resources.patch
  releasing-resources-with-children.patch
  mutex-subsystem-synchro-test-module.patch
  kernel-forkc-export-kernel_thread-to-modules.patch
  workaround-for-a-pci-restoring-bug.patch


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-06-18-53 uploaded (sound/soc/amd/renoir/rn-pci-acp3x.c:)
  2020-07-07  1:53 ` mmotm 2020-07-06-18-53 uploaded Andrew Morton
@ 2020-07-07  5:44   ` Randy Dunlap
  2020-07-07  6:15     ` Mukunda,Vijendar
  0 siblings, 1 reply; 203+ messages in thread
From: Randy Dunlap @ 2020-07-07  5:44 UTC (permalink / raw)
  To: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, moderated for non-subscribers, sfr,
	Vijendar Mukunda

On 7/6/20 6:53 PM, Andrew Morton wrote:
> The mm-of-the-moment snapshot 2020-07-06-18-53 has been uploaded to
> 
>    http://www.ozlabs.org/~akpm/mmotm/
> 
> mmotm-readme.txt says
> 
> README for mm-of-the-moment:
> 
> http://www.ozlabs.org/~akpm/mmotm/
> 
> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
> more than once a week.
> 
> You will need quilt to apply these patches to the latest Linus release (5.x
> or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
> http://ozlabs.org/~akpm/mmotm/series
> 

on i386:

when CONFIG_ACPI is not set/enabled:

../sound/soc/amd/renoir/rn-pci-acp3x.c: In function ‘snd_rn_acp_probe’:
../sound/soc/amd/renoir/rn-pci-acp3x.c:222:9: error: implicit declaration of function ‘acpi_evaluate_integer’; did you mean ‘acpi_evaluate_object’? [-Werror=implicit-function-declaration]
   ret = acpi_evaluate_integer(handle, "_WOV", NULL, &dmic_status);
         ^~~~~~~~~~~~~~~~~~~~~
         acpi_evaluate_object



-- 
~Randy
Reported-by: Randy Dunlap <rdunlap@infradead.org>


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-06-18-53 uploaded (sound/soc/amd/renoir/rn-pci-acp3x.c:)
  2020-07-07  6:15     ` Mukunda,Vijendar
@ 2020-07-07  6:08       ` Randy Dunlap
  2020-07-07 10:50         ` Mukunda,Vijendar
  0 siblings, 1 reply; 203+ messages in thread
From: Randy Dunlap @ 2020-07-07  6:08 UTC (permalink / raw)
  To: Mukunda,Vijendar, Andrew Morton, broonie, linux-fsdevel,
	linux-kernel, linux-mm, linux-next, mhocko,
	moderated for non-subscribers, sfr

On 7/6/20 11:15 PM, Mukunda,Vijendar wrote:
> 
> 
> On 07/07/20 11:14 am, Randy Dunlap wrote:
>> On 7/6/20 6:53 PM, Andrew Morton wrote:
>>> The mm-of-the-moment snapshot 2020-07-06-18-53 has been uploaded to
>>>
>>>     https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fwww.ozlabs.org%2F~akpm%2Fmmotm%2F&amp;data=02%7C01%7CVijendar.Mukunda%40amd.com%7C34f06090b5394f9ccb9d08d82238c5cf%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296974530250787&amp;sdata=K8z5g9P5S7Ct%2BojnITdP0xuz159sYOiDWOyUy3abDpo%3D&amp;reserved=0
>>>
>>> mmotm-readme.txt says
>>>
>>> README for mm-of-the-moment:
>>>
>>> https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fwww.ozlabs.org%2F~akpm%2Fmmotm%2F&amp;data=02%7C01%7CVijendar.Mukunda%40amd.com%7C34f06090b5394f9ccb9d08d82238c5cf%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296974530250787&amp;sdata=K8z5g9P5S7Ct%2BojnITdP0xuz159sYOiDWOyUy3abDpo%3D&amp;reserved=0
>>>
>>> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
>>> more than once a week.
>>>
>>> You will need quilt to apply these patches to the latest Linus release (5.x
>>> or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
>>> https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fozlabs.org%2F~akpm%2Fmmotm%2Fseries&amp;data=02%7C01%7CVijendar.Mukunda%40amd.com%7C34f06090b5394f9ccb9d08d82238c5cf%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296974530250787&amp;sdata=6CpbYkoZTJ%2FxqhyFKdZMjH%2BdG5kjOgogt8KqqNK%2BzSI%3D&amp;reserved=0
>>>
>>
>> on i386:
>>
>> when CONFIG_ACPI is not set/enabled:
>>
>> ../sound/soc/amd/renoir/rn-pci-acp3x.c: In function ‘snd_rn_acp_probe’:
>> ../sound/soc/amd/renoir/rn-pci-acp3x.c:222:9: error: implicit declaration of function ‘acpi_evaluate_integer’; did you mean ‘acpi_evaluate_object’? [-Werror=implicit-function-declaration]
>>     ret = acpi_evaluate_integer(handle, "_WOV", NULL, &dmic_status);
> Will add ACPI as dependency in Kconfig for Renoir ACP driver.
> Do i need to upload new version of the patch? or should i submit the incremental patch as a fix >>           ^~~~~~~~~~~~~~~~~~~~~
>>           acpi_evaluate_object

Hi,
Not my call, but I would go with an incremental patch.


thanks.
-- 
~Randy



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-06-18-53 uploaded (sound/soc/amd/renoir/rn-pci-acp3x.c:)
  2020-07-07  5:44   ` mmotm 2020-07-06-18-53 uploaded (sound/soc/amd/renoir/rn-pci-acp3x.c:) Randy Dunlap
@ 2020-07-07  6:15     ` Mukunda,Vijendar
  2020-07-07  6:08       ` Randy Dunlap
  0 siblings, 1 reply; 203+ messages in thread
From: Mukunda,Vijendar @ 2020-07-07  6:15 UTC (permalink / raw)
  To: Randy Dunlap, Andrew Morton, broonie, linux-fsdevel,
	linux-kernel, linux-mm, linux-next, mhocko,
	moderated for non-subscribers, sfr



On 07/07/20 11:14 am, Randy Dunlap wrote:
> On 7/6/20 6:53 PM, Andrew Morton wrote:
>> The mm-of-the-moment snapshot 2020-07-06-18-53 has been uploaded to
>>
>>     https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fwww.ozlabs.org%2F~akpm%2Fmmotm%2F&amp;data=02%7C01%7CVijendar.Mukunda%40amd.com%7C34f06090b5394f9ccb9d08d82238c5cf%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296974530250787&amp;sdata=K8z5g9P5S7Ct%2BojnITdP0xuz159sYOiDWOyUy3abDpo%3D&amp;reserved=0
>>
>> mmotm-readme.txt says
>>
>> README for mm-of-the-moment:
>>
>> https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fwww.ozlabs.org%2F~akpm%2Fmmotm%2F&amp;data=02%7C01%7CVijendar.Mukunda%40amd.com%7C34f06090b5394f9ccb9d08d82238c5cf%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296974530250787&amp;sdata=K8z5g9P5S7Ct%2BojnITdP0xuz159sYOiDWOyUy3abDpo%3D&amp;reserved=0
>>
>> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
>> more than once a week.
>>
>> You will need quilt to apply these patches to the latest Linus release (5.x
>> or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
>> https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fozlabs.org%2F~akpm%2Fmmotm%2Fseries&amp;data=02%7C01%7CVijendar.Mukunda%40amd.com%7C34f06090b5394f9ccb9d08d82238c5cf%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296974530250787&amp;sdata=6CpbYkoZTJ%2FxqhyFKdZMjH%2BdG5kjOgogt8KqqNK%2BzSI%3D&amp;reserved=0
>>
> 
> on i386:
> 
> when CONFIG_ACPI is not set/enabled:
> 
> ../sound/soc/amd/renoir/rn-pci-acp3x.c: In function ‘snd_rn_acp_probe’:
> ../sound/soc/amd/renoir/rn-pci-acp3x.c:222:9: error: implicit declaration of function ‘acpi_evaluate_integer’; did you mean ‘acpi_evaluate_object’? [-Werror=implicit-function-declaration]
>     ret = acpi_evaluate_integer(handle, "_WOV", NULL, &dmic_status);
Will add ACPI as dependency in Kconfig for Renoir ACP driver.
Do i need to upload new version of the patch? or should i submit the 
incremental patch as a fix ?
>           ^~~~~~~~~~~~~~~~~~~~~
>           acpi_evaluate_object
> 
>
> 


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-06-18-53 uploaded (sound/soc/amd/renoir/rn-pci-acp3x.c:)
  2020-07-07  6:08       ` Randy Dunlap
@ 2020-07-07 10:50         ` Mukunda,Vijendar
  0 siblings, 0 replies; 203+ messages in thread
From: Mukunda,Vijendar @ 2020-07-07 10:50 UTC (permalink / raw)
  To: Randy Dunlap, Andrew Morton, broonie, linux-fsdevel,
	linux-kernel, linux-mm, linux-next, mhocko,
	moderated for non-subscribers, sfr



On 07/07/20 11:38 am, Randy Dunlap wrote:
> On 7/6/20 11:15 PM, Mukunda,Vijendar wrote:
>>
>>
>> On 07/07/20 11:14 am, Randy Dunlap wrote:
>>> On 7/6/20 6:53 PM, Andrew Morton wrote:
>>>> The mm-of-the-moment snapshot 2020-07-06-18-53 has been uploaded to
>>>>
>>>>      https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fwww.ozlabs.org%2F~akpm%2Fmmotm%2F&amp;data=02%7C01%7Cvijendar.mukunda%40amd.com%7C1707f719e862439351d808d8223c28f6%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296989101868555&amp;sdata=zwcKEzTT4zHSr38qU6hHYI5qLCdid1Af0YJZsp9n8W0%3D&amp;reserved=0
>>>>
>>>> mmotm-readme.txt says
>>>>
>>>> README for mm-of-the-moment:
>>>>
>>>> https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fwww.ozlabs.org%2F~akpm%2Fmmotm%2F&amp;data=02%7C01%7Cvijendar.mukunda%40amd.com%7C1707f719e862439351d808d8223c28f6%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296989101868555&amp;sdata=zwcKEzTT4zHSr38qU6hHYI5qLCdid1Af0YJZsp9n8W0%3D&amp;reserved=0
>>>>
>>>> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
>>>> more than once a week.
>>>>
>>>> You will need quilt to apply these patches to the latest Linus release (5.x
>>>> or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
>>>> https://nam11.safelinks.protection.outlook.com/?url=http:%2F%2Fozlabs.org%2F~akpm%2Fmmotm%2Fseries&amp;data=02%7C01%7Cvijendar.mukunda%40amd.com%7C1707f719e862439351d808d8223c28f6%7C3dd8961fe4884e608e11a82d994e183d%7C0%7C0%7C637296989101868555&amp;sdata=mzNHUR0CpjfaXX6Syq4sjkR3i3JU3jGRm7CcjKxFmMc%3D&amp;reserved=0
>>>>
>>>
>>> on i386:
>>>
>>> when CONFIG_ACPI is not set/enabled:
>>>
>>> ../sound/soc/amd/renoir/rn-pci-acp3x.c: In function ‘snd_rn_acp_probe’:
>>> ../sound/soc/amd/renoir/rn-pci-acp3x.c:222:9: error: implicit declaration of function ‘acpi_evaluate_integer’; did you mean ‘acpi_evaluate_object’? [-Werror=implicit-function-declaration]
>>>      ret = acpi_evaluate_integer(handle, "_WOV", NULL, &dmic_status);
>> Will add ACPI as dependency in Kconfig for Renoir ACP driver.
>> Do i need to upload new version of the patch? or should i submit the incremental patch as a fix >>           ^~~~~~~~~~~~~~~~~~~~~
>>>            acpi_evaluate_object
> 
> Hi,
> Not my call, but I would go with an incremental patch.
> 
> 
> thanks.

Submitted fix as an incremental patch for upstream review.
> 


^ permalink raw reply	[flat|nested] 203+ messages in thread

* mmotm 2020-07-08-19-28 uploaded
  2020-07-03 22:14 incoming Andrew Morton
                   ` (5 preceding siblings ...)
  2020-07-07  1:53 ` mmotm 2020-07-06-18-53 uploaded Andrew Morton
@ 2020-07-09  2:29 ` Andrew Morton
  2020-07-09  3:47   ` mmotm 2020-07-08-19-28 uploaded (mm/migrate.c) Randy Dunlap
  2020-07-10  4:00 ` mmotm 2020-07-09-21-00 uploaded Andrew Morton
                   ` (3 subsequent siblings)
  10 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2020-07-09  2:29 UTC (permalink / raw)
  To: broonie, linux-fsdevel, linux-kernel, linux-mm, linux-next,
	mhocko, mm-commits, sfr

The mm-of-the-moment snapshot 2020-07-08-19-28 has been uploaded to

   http://www.ozlabs.org/~akpm/mmotm/

mmotm-readme.txt says

README for mm-of-the-moment:

http://www.ozlabs.org/~akpm/mmotm/

This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
more than once a week.

You will need quilt to apply these patches to the latest Linus release (5.x
or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
http://ozlabs.org/~akpm/mmotm/series

The file broken-out.tar.gz contains two datestamp files: .DATE and
.DATE-yyyy-mm-dd-hh-mm-ss.  Both contain the string yyyy-mm-dd-hh-mm-ss,
followed by the base kernel version against which this patch series is to
be applied.

This tree is partially included in linux-next.  To see which patches are
included in linux-next, consult the `series' file.  Only the patches
within the #NEXT_PATCHES_START/#NEXT_PATCHES_END markers are included in
linux-next.


A full copy of the full kernel tree with the linux-next and mmotm patches
already applied is available through git within an hour of the mmotm
release.  Individual mmotm releases are tagged.  The master branch always
points to the latest release, so it's constantly rebasing.

	https://github.com/hnaz/linux-mm

The directory http://www.ozlabs.org/~akpm/mmots/ (mm-of-the-second)
contains daily snapshots of the -mm tree.  It is updated more frequently
than mmotm, and is untested.

A git copy of this tree is also available at

	https://github.com/hnaz/linux-mm



This mmotm tree contains the following patches against 5.8-rc4:
(patches marked "*" will be included in linux-next)

  origin.patch
* mm-shuffle-dont-move-pages-between-zones-and-dont-read-garbage-memmaps.patch
* mm-avoid-access-flag-update-tlb-flush-for-retried-page-fault.patch
* vfs-xattr-mm-shmem-kernfs-release-simple-xattr-entry-in-a-right-way.patch
* mm-initialize-return-of-vm_insert_pages.patch
* mm-memcontrol-fix-oops-inside-mem_cgroup_get_nr_swap_pages.patch
* proc-kpageflags-prevent-an-integer-overflow-in-stable_page_flags.patch
* proc-kpageflags-do-not-use-uninitialized-struct-pages.patch
* mm-memcg-fix-refcount-error-while-moving-and-swapping.patch
* mm-hugetlb-avoid-hardcoding-while-checking-if-cma-is-enable.patch
* mailmap-add-entry-for-mike-rapoport.patch
* checkpatch-test-git_dir-changes.patch
* kthread-remove-incorrect-comment-in-kthread_create_on_cpu.patch
* kbuild-move-wtype-limits-to-w=2.patch
* scripts-tagssh-collect-compiled-source-precisely.patch
* scripts-tagssh-collect-compiled-source-precisely-v2.patch
* bloat-o-meter-support-comparing-library-archives.patch
* scripts-decode_stacktrace-skip-missing-symbols.patch
* scripts-decode_stacktrace-guess-basepath-if-not-specified.patch
* scripts-decode_stacktrace-guess-path-to-modules.patch
* scripts-decode_stacktrace-guess-path-to-vmlinux-by-release-name.patch
* ocfs2-clear-links-count-in-ocfs2_mknod-if-an-error-occurs.patch
* ocfs2-fix-ocfs2-corrupt-when-iputting-an-inode.patch
* ocfs2-change-slot-number-type-s16-to-u16.patch
* ramfs-support-o_tmpfile.patch
* kernel-watchdog-flush-all-printk-nmi-buffers-when-hardlockup-detected.patch
  mm.patch
* mm-treewide-rename-kzfree-to-kfree_sensitive.patch
* mm-ksize-should-silently-accept-a-null-pointer.patch
* mm-expand-config_slab_freelist_hardened-to-include-slab.patch
* slab-add-naive-detection-of-double-free.patch
* slab-add-naive-detection-of-double-free-fix.patch
* mm-slab-check-gfp_slab_bug_mask-before-alloc_pages-in-kmalloc_order.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks-fix.patch
* mm-slub-make-some-slub_debug-related-attributes-read-only.patch
* mm-slub-remove-runtime-allocation-order-changes.patch
* mm-slub-make-remaining-slub_debug-related-attributes-read-only.patch
* mm-slub-make-reclaim_account-attribute-read-only.patch
* mm-slub-introduce-static-key-for-slub_debug.patch
* mm-slub-introduce-kmem_cache_debug_flags.patch
* mm-slub-introduce-kmem_cache_debug_flags-fix.patch
* mm-slub-extend-checks-guarded-by-slub_debug-static-key.patch
* mm-slab-slub-move-and-improve-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj-fix.patch
* slub-drop-lockdep_assert_held-from-put_map.patch
* mm-kcsan-instrument-slab-slub-free-with-assert_exclusive_access.patch
* mm-debug_vm_pgtable-add-tests-validating-arch-helpers-for-core-mm-features.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers.patch
* mm-debug_vm_pgtable-add-debug-prints-for-individual-tests.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers.patch
* mm-filemap-clear-idle-flag-for-writes.patch
* mm-filemap-add-missing-fgp_-flags-in-kerneldoc-comment-for-pagecache_get_page.patch
* mm-swap-simplify-alloc_swap_slot_cache.patch
* mm-swap-simplify-enable_swap_slots_cache.patch
* mm-swap-remove-redundant-check-for-swap_slot_cache_initialized.patch
* mm-kmem-make-memcg_kmem_enabled-irreversible.patch
* mm-memcg-factor-out-memcg-and-lruvec-level-changes-out-of-__mod_lruvec_state.patch
* mm-memcg-prepare-for-byte-sized-vmstat-items.patch
* mm-memcg-convert-vmstat-slab-counters-to-bytes.patch
* mm-slub-implement-slub-version-of-obj_to_index.patch
* mm-memcontrol-decouple-reference-counting-from-page-accounting.patch
* mm-memcg-slab-obj_cgroup-api.patch
* mm-memcg-slab-allocate-obj_cgroups-for-non-root-slab-pages.patch
* mm-memcg-slab-save-obj_cgroup-for-non-root-slab-objects.patch
* mm-memcg-slab-charge-individual-slab-objects-instead-of-pages.patch
* mm-memcg-slab-deprecate-memorykmemslabinfo.patch
* mm-memcg-slab-move-memcg_kmem_bypass-to-memcontrolh.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-accounted-allocations.patch
* mm-memcg-slab-simplify-memcg-cache-creation.patch
* mm-memcg-slab-remove-memcg_kmem_get_cache.patch
* mm-memcg-slab-deprecate-slab_root_caches.patch
* mm-memcg-slab-remove-redundant-check-in-memcg_accumulate_slabinfo.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-allocations.patch
* kselftests-cgroup-add-kernel-memory-accounting-tests.patch
* tools-cgroup-add-memcg_slabinfopy-tool.patch
* percpu-return-number-of-released-bytes-from-pcpu_free_area.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix-fix.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics-v3.patch
* mm-memcg-charge-memcg-percpu-memory-to-the-parent-cgroup.patch
* kselftests-cgroup-add-perpcu-memory-accounting-test.patch
* mm-memcontrol-account-kernel-stack-per-node.patch
* mm-memcg-slab-remove-unused-argument-by-charge_slab_page.patch
* mm-slab-rename-uncharge_slab_page-to-unaccount_slab_page.patch
* mm-kmem-switch-to-static_branch_likely-in-memcg_kmem_enabled.patch
* mm-remove-redundant-check-non_swap_entry.patch
* mm-memoryc-make-remap_pfn_range-reject-unaligned-addr.patch
* mm-remove-unneeded-includes-of-asm-pgalloch.patch
* mm-remove-unneeded-includes-of-asm-pgalloch-fix.patch
* opeinrisc-switch-to-generic-version-of-pte-allocation.patch
* xtensa-switch-to-generic-version-of-pte-allocation.patch
* asm-generic-pgalloc-provide-generic-pmd_alloc_one-and-pmd_free_one.patch
* asm-generic-pgalloc-provide-generic-pud_alloc_one-and-pud_free_one.patch
* asm-generic-pgalloc-provide-generic-pgd_free.patch
* mm-move-lib-ioremapc-to-mm.patch
* mm-move-pd_alloc_track-to-separate-header-file.patch
* mm-mmap-fix-the-adjusted-length-error.patch
* proc-meminfo-avoid-open-coded-reading-of-vm_committed_as.patch
* mm-utilc-make-vm_memory_committed-more-accurate.patch
* mm-adjust-vm_committed_as_batch-according-to-vm-overcommit-policy.patch
* mm-mmap-optimize-a-branch-judgment-in-ksys_mmap_pgoff.patch
* mm-do-page-fault-accounting-in-handle_mm_fault.patch
* mm-alpha-use-general-page-fault-accounting.patch
* mm-arc-use-general-page-fault-accounting.patch
* mm-arm-use-general-page-fault-accounting.patch
* mm-arm64-use-general-page-fault-accounting.patch
* mm-csky-use-general-page-fault-accounting.patch
* mm-hexagon-use-general-page-fault-accounting.patch
* mm-ia64-use-general-page-fault-accounting.patch
* mm-m68k-use-general-page-fault-accounting.patch
* mm-microblaze-use-general-page-fault-accounting.patch
* mm-mips-use-general-page-fault-accounting.patch
* mm-nds32-use-general-page-fault-accounting.patch
* mm-nios2-use-general-page-fault-accounting.patch
* mm-openrisc-use-general-page-fault-accounting.patch
* mm-parisc-use-general-page-fault-accounting.patch
* mm-powerpc-use-general-page-fault-accounting.patch
* mm-riscv-use-general-page-fault-accounting.patch
* mm-s390-use-general-page-fault-accounting.patch
* mm-sh-use-general-page-fault-accounting.patch
* mm-sparc32-use-general-page-fault-accounting.patch
* mm-sparc64-use-general-page-fault-accounting.patch
* mm-x86-use-general-page-fault-accounting.patch
* mm-xtensa-use-general-page-fault-accounting.patch
* mm-clean-up-the-last-pieces-of-page-fault-accountings.patch
* mm-gup-remove-task_struct-pointer-for-all-gup-code.patch
* mm-mremap-it-is-sure-to-have-enough-space-when-extent-meets-requirement.patch
* mm-mremap-calculate-extent-in-one-place.patch
* mm-mremap-start-addresses-are-properly-aligned.patch
* mm-mremap-use-pmd_addr_end-to-simplify-the-calculate-of-extent.patch
* mm-sparse-never-partially-remove-memmap-for-early-section.patch
* mm-sparse-only-sub-section-aligned-range-would-be-populated.patch
* vmalloc-convert-to-xarray.patch
* mm-vmalloc-simplify-merge_or_add_vmap_area-func.patch
* mm-vmalloc-simplify-augment_tree_propagate_check-func.patch
* mm-vmalloc-switch-to-propagate-callback.patch
* mm-vmalloc-update-the-header-about-kva-rework.patch
* mm-vmalloc-remove-redundant-asignmnet-in-unmap_kernel_range_noflush.patch
* kasan-improve-and-simplify-kconfigkasan.patch
* kasan-update-required-compiler-versions-in-documentation.patch
* rcu-kasan-record-and-print-call_rcu-call-stack.patch
* kasan-record-and-print-the-free-track.patch
* kasan-add-tests-for-call_rcu-stack-recording.patch
* kasan-update-documentation-for-generic-kasan.patch
* kasan-remove-kasan_unpoison_stack_above_sp_to.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan-v4.patch
* mm-page_alloc-use-unlikely-in-task_capc.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast-v5.patch
* mm-page_alloc-skip-waternark_boost-for-atomic-order-0-allocations.patch
* mm-page_alloc-skip-watermark_boost-for-atomic-order-0-allocations-fix.patch
* mm-drop-vm_total_pages.patch
* mm-page_alloc-drop-nr_free_pagecache_pages.patch
* mm-memory_hotplug-document-why-shuffle_zone-is-relevant.patch
* mm-shuffle-remove-dynamic-reconfiguration.patch
* powerpc-numa-set-numa_node-for-all-possible-cpus.patch
* powerpc-numa-prefer-node-id-queried-from-vphn.patch
* mm-page_alloc-keep-memoryless-cpuless-node-0-offline.patch
* mm-page_allocc-replace-the-definition-of-nr_migratetype_bits-with-pb_migratetype_bits.patch
* mm-page_allocc-extract-the-common-part-in-pfn_to_bitidx.patch
* mm-page_allocc-simplify-pageblock-bitmap-access.patch
* mm-page_allocc-remove-unnecessary-end_bitidx-for-_pfnblock_flags_mask.patch
* mm-page_alloc-silence-a-kasan-false-positive.patch
* mm-page_alloc-fallbacks-at-most-has-3-elements.patch
* mm-page_alloc-skip-setting-nodemask-when-we-are-in-interrupt.patch
* mm-huge_memoryc-update-tlb-entry-if-pmd-is-changed.patch
* mips-do-not-call-flush_tlb_all-when-setting-pmd-entry.patch
* mm-vmscanc-fixed-typo.patch
* mm-proactive-compaction.patch
* mm-proactive-compaction-fix.patch
* mm-use-unsigned-types-for-fragmentation-score.patch
* hugetlbfs-prevent-filesystem-stacking-of-hugetlbfs.patch
* mm-thp-remove-debug_cow-switch.patch
* mm-store-compound_nr-as-well-as-compound_order.patch
* mm-move-page-flags-include-to-top-of-file.patch
* mm-add-thp_order.patch
* mm-add-thp_size.patch
* mm-replace-hpage_nr_pages-with-thp_nr_pages.patch
* mm-add-thp_head.patch
* mm-introduce-offset_in_thp.patch
* mm-vmstat-add-events-for-thp-migration-without-split.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix.patch
* mm-cma-fix-null-pointer-dereference-when-cma-could-not-be-activated.patch
* mm-cma-fix-the-name-of-cma-areas.patch
* mm-cma-fix-the-name-of-cma-areas-fix.patch
* mm-hugetlb-fix-the-name-of-hugetlb-cma.patch
* mmhwpoison-cleanup-unused-pagehuge-check.patch
* mm-hwpoison-remove-recalculating-hpage.patch
* mmmadvise-call-soft_offline_page-without-mf_count_increased.patch
* mmmadvise-refactor-madvise_inject_error.patch
* mmhwpoison-inject-dont-pin-for-hwpoison_filter.patch
* mmhwpoison-un-export-get_hwpoison_page-and-make-it-static.patch
* mmhwpoison-kill-put_hwpoison_page.patch
* mmhwpoison-remove-mf_count_increased.patch
* mmhwpoison-remove-flag-argument-from-soft-offline-functions.patch
* mmhwpoison-unify-thp-handling-for-hard-and-soft-offline.patch
* mmhwpoison-rework-soft-offline-for-free-pages.patch
* mmhwpoison-rework-soft-offline-for-free-pages-fix.patch
* mmhwpoison-rework-soft-offline-for-in-use-pages.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page-fix.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page-fix-fix.patch
* mmhwpoison-return-0-if-the-page-is-already-poisoned-in-soft-offline.patch
* mmhwpoison-introduce-mf_msg_unsplit_thp.patch
* sched-mm-optimize-current_gfp_context.patch
* x86-mm-use-max-memory-block-size-on-bare-metal.patch
* info-task-hung-in-generic_file_write_iter.patch
* info-task-hung-in-generic_file_write-fix.patch
* kernel-hung_taskc-monitor-killed-tasks.patch
* fix-annotation-of-ioreadwrite1632be.patch
* sparse-group-the-defines-by-functionality.patch
* bitmap-fix-bitmap_cut-for-partial-overlapping-case.patch
* bitmap-add-test-for-bitmap_cut.patch
* lib-generic-radix-treec-remove-unneeded-__rcu.patch
* lib-test_bitops-do-the-full-test-during-module-init.patch
* lib-optimize-cpumask_local_spread.patch
* lib-test_lockupc-make-symbol-test_works-static.patch
* bits-add-tests-of-genmask.patch
* bits-add-tests-of-genmask-fix.patch
* bits-add-tests-of-genmask-fix-2.patch
* checkpatch-add-test-for-possible-misuse-of-is_enabled-without-config_.patch
* checkpatch-support-deprecated-terms-checking.patch
* scripts-deprecated_terms-recommend-denylist-allowlist-instead-of-blacklist-whitelist.patch
* checkpatch-add-fix-option-for-assign_in_if.patch
* checkpatch-fix-const_struct-when-const_structscheckpatch-is-missing.patch
* fs-minix-check-return-value-of-sb_getblk.patch
* fs-minix-dont-allow-getting-deleted-inodes.patch
* fs-minix-reject-too-large-maximum-file-size.patch
* fs-minix-set-s_maxbytes-correctly.patch
* fs-minix-fix-block-limit-check-for-v1-filesystems.patch
* fs-minix-remove-expected-error-message-in-block_to_path.patch
* fatfs-switch-write_lock-to-read_lock-in-fat_ioctl_get_attributes.patch
* vfat-fat-msdos-filesystem-replace-http-links-with-https-ones.patch
* fs-signalfdc-fix-inconsistent-return-codes-for-signalfd4.patch
* selftests-kmod-use-variable-name-in-kmod_test_0001.patch
* kmod-remove-redundant-be-an-in-the-comment.patch
* test_kmod-avoid-potential-double-free-in-trigger_config_run_type.patch
* coredump-add-%f-for-executable-filename.patch
* exec-change-uselib2-is_sreg-failure-to-eacces.patch
* exec-move-s_isreg-check-earlier.patch
* exec-move-path_noexec-check-earlier.patch
* umh-fix-refcount-underflow-in-fork_usermode_blob.patch
* kdump-append-kernel-build-id-string-to-vmcoreinfo.patch
* rapidio-rio_mport_cdev-use-struct_size-helper.patch
* rapidio-use-struct_size-helper.patch
* kernel-panicc-make-oops_may_print-return-bool.patch
* lib-kconfigdebug-fix-typo-in-the-help-text-of-config_panic_timeout.patch
* aio-simplify-read_events.patch
* kcov-unconditionally-add-fno-stack-protector-to-compiler-options.patch
* kcov-make-some-symbols-static.patch
  linux-next.patch
  linux-next-rejects.patch
* mm-madvise-pass-task-and-mm-to-do_madvise.patch
* pid-move-pidfd_get_pid-to-pidc.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix-2.patch
* mm-madvise-check-fatal-signal-pending-of-target-process.patch
* all-arch-remove-system-call-sys_sysctl.patch
* all-arch-remove-system-call-sys_sysctl-fix.patch
* mm-kmemleak-silence-kcsan-splats-in-checksum.patch
* mm-frontswap-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races-v2.patch
* mm-swap_state-mark-various-intentional-data-races.patch
* mm-filemap-fix-a-data-race-in-filemap_fault.patch
* mm-swapfile-fix-and-annotate-various-data-races.patch
* mm-swapfile-fix-and-annotate-various-data-races-v2.patch
* mm-page_counter-fix-various-data-races-at-memsw.patch
* mm-memcontrol-fix-a-data-race-in-scan-count.patch
* mm-list_lru-fix-a-data-race-in-list_lru_count_one.patch
* mm-mempool-fix-a-data-race-in-mempool_free.patch
* mm-rmap-annotate-a-data-race-at-tlb_flush_batched.patch
* mm-swap-annotate-data-races-for-lru_rotate_pvecs.patch
* mm-annotate-a-data-race-in-page_zonenum.patch
* include-asm-generic-vmlinuxldsh-align-ro_after_init.patch
* sh-clkfwk-remove-r8-r16-r32.patch
* sh-remove-call-to-memset-after-dma_alloc_coherent.patch
* sh-use-generic-strncpy.patch
* sh-add-missing-export_symbol-for-__delay.patch
  make-sure-nobodys-leaking-resources.patch
  releasing-resources-with-children.patch
  mutex-subsystem-synchro-test-module.patch
  kernel-forkc-export-kernel_thread-to-modules.patch
  workaround-for-a-pci-restoring-bug.patch


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-08-19-28 uploaded (mm/migrate.c)
  2020-07-09  2:29 ` mmotm 2020-07-08-19-28 uploaded Andrew Morton
@ 2020-07-09  3:47   ` Randy Dunlap
  2020-07-09  3:56     ` Anshuman Khandual
  0 siblings, 1 reply; 203+ messages in thread
From: Randy Dunlap @ 2020-07-09  3:47 UTC (permalink / raw)
  To: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, sfr, Anshuman Khandual

On 7/8/20 7:29 PM, Andrew Morton wrote:
> The mm-of-the-moment snapshot 2020-07-08-19-28 has been uploaded to
> 
>    http://www.ozlabs.org/~akpm/mmotm/
> 
> mmotm-readme.txt says
> 
> README for mm-of-the-moment:
> 
> http://www.ozlabs.org/~akpm/mmotm/
> 
> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
> more than once a week.
> 

on i386:

CONFIG_MIGRATION=y
# CONFIG_TRANSPARENT_HUGEPAGE is not set

../mm/migrate.c: In function ‘migrate_pages’:
../mm/migrate.c:1528:19: error: ‘THP_MIGRATION_SUCCESS’ undeclared (first use in this function); did you mean ‘PGMIGRATE_SUCCESS’?
   count_vm_events(THP_MIGRATION_SUCCESS, nr_thp_succeeded);
                   ^~~~~~~~~~~~~~~~~~~~~
                   PGMIGRATE_SUCCESS
../mm/migrate.c:1528:19: note: each undeclared identifier is reported only once for each function it appears in
../mm/migrate.c:1530:19: error: ‘THP_MIGRATION_FAILURE’ undeclared (first use in this function); did you mean ‘THP_MIGRATION_SUCCESS’?
   count_vm_events(THP_MIGRATION_FAILURE, nr_thp_failed);
                   ^~~~~~~~~~~~~~~~~~~~~
                   THP_MIGRATION_SUCCESS
../mm/migrate.c:1532:19: error: ‘THP_MIGRATION_SPLIT’ undeclared (first use in this function); did you mean ‘THP_MIGRATION_FAILURE’?
   count_vm_events(THP_MIGRATION_SPLIT, nr_thp_split);
                   ^~~~~~~~~~~~~~~~~~~
                   THP_MIGRATION_FAILURE


from: mm-vmstat-add-events-for-thp-migration-without-split.patch


-- 
~Randy
Reported-by: Randy Dunlap <rdunlap@infradead.org>


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-08-19-28 uploaded (mm/migrate.c)
  2020-07-09  3:47   ` mmotm 2020-07-08-19-28 uploaded (mm/migrate.c) Randy Dunlap
@ 2020-07-09  3:56     ` Anshuman Khandual
  0 siblings, 0 replies; 203+ messages in thread
From: Anshuman Khandual @ 2020-07-09  3:56 UTC (permalink / raw)
  To: Randy Dunlap, Andrew Morton, broonie, linux-fsdevel,
	linux-kernel, linux-mm, linux-next, mhocko, mm-commits, sfr



On 07/09/2020 09:17 AM, Randy Dunlap wrote:
> On 7/8/20 7:29 PM, Andrew Morton wrote:
>> The mm-of-the-moment snapshot 2020-07-08-19-28 has been uploaded to
>>
>>    http://www.ozlabs.org/~akpm/mmotm/
>>
>> mmotm-readme.txt says
>>
>> README for mm-of-the-moment:
>>
>> http://www.ozlabs.org/~akpm/mmotm/
>>
>> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
>> more than once a week.
>>
> 
> on i386:
> 
> CONFIG_MIGRATION=y
> # CONFIG_TRANSPARENT_HUGEPAGE is not set
> 
> ../mm/migrate.c: In function ‘migrate_pages’:
> ../mm/migrate.c:1528:19: error: ‘THP_MIGRATION_SUCCESS’ undeclared (first use in this function); did you mean ‘PGMIGRATE_SUCCESS’?
>    count_vm_events(THP_MIGRATION_SUCCESS, nr_thp_succeeded);
>                    ^~~~~~~~~~~~~~~~~~~~~
>                    PGMIGRATE_SUCCESS
> ../mm/migrate.c:1528:19: note: each undeclared identifier is reported only once for each function it appears in
> ../mm/migrate.c:1530:19: error: ‘THP_MIGRATION_FAILURE’ undeclared (first use in this function); did you mean ‘THP_MIGRATION_SUCCESS’?
>    count_vm_events(THP_MIGRATION_FAILURE, nr_thp_failed);
>                    ^~~~~~~~~~~~~~~~~~~~~
>                    THP_MIGRATION_SUCCESS
> ../mm/migrate.c:1532:19: error: ‘THP_MIGRATION_SPLIT’ undeclared (first use in this function); did you mean ‘THP_MIGRATION_FAILURE’?
>    count_vm_events(THP_MIGRATION_SPLIT, nr_thp_split);
>                    ^~~~~~~~~~~~~~~~~~~
>                    THP_MIGRATION_FAILURE

These events should always be available without any config dependency
including CONFIG_TRANSPARENT_HUGEPAGE. Will fix this and update the
patch.


^ permalink raw reply	[flat|nested] 203+ messages in thread

* mmotm 2020-07-09-21-00 uploaded
  2020-07-03 22:14 incoming Andrew Morton
                   ` (6 preceding siblings ...)
  2020-07-09  2:29 ` mmotm 2020-07-08-19-28 uploaded Andrew Morton
@ 2020-07-10  4:00 ` Andrew Morton
  2020-07-10 17:40   ` mmotm 2020-07-09-21-00 uploaded (drivers/net/ethernet/mellanox/mlx5/core/en_main.c) Randy Dunlap
  2020-07-14  2:49 ` mmotm 2020-07-13-19-49 uploaded Andrew Morton
                   ` (2 subsequent siblings)
  10 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2020-07-10  4:00 UTC (permalink / raw)
  To: broonie, linux-fsdevel, linux-kernel, linux-mm, linux-next,
	mhocko, mm-commits, sfr

The mm-of-the-moment snapshot 2020-07-09-21-00 has been uploaded to

   http://www.ozlabs.org/~akpm/mmotm/

mmotm-readme.txt says

README for mm-of-the-moment:

http://www.ozlabs.org/~akpm/mmotm/

This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
more than once a week.

You will need quilt to apply these patches to the latest Linus release (5.x
or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
http://ozlabs.org/~akpm/mmotm/series

The file broken-out.tar.gz contains two datestamp files: .DATE and
.DATE-yyyy-mm-dd-hh-mm-ss.  Both contain the string yyyy-mm-dd-hh-mm-ss,
followed by the base kernel version against which this patch series is to
be applied.

This tree is partially included in linux-next.  To see which patches are
included in linux-next, consult the `series' file.  Only the patches
within the #NEXT_PATCHES_START/#NEXT_PATCHES_END markers are included in
linux-next.


A full copy of the full kernel tree with the linux-next and mmotm patches
already applied is available through git within an hour of the mmotm
release.  Individual mmotm releases are tagged.  The master branch always
points to the latest release, so it's constantly rebasing.

	https://github.com/hnaz/linux-mm

The directory http://www.ozlabs.org/~akpm/mmots/ (mm-of-the-second)
contains daily snapshots of the -mm tree.  It is updated more frequently
than mmotm, and is untested.

A git copy of this tree is also available at

	https://github.com/hnaz/linux-mm



This mmotm tree contains the following patches against 5.8-rc4:
(patches marked "*" will be included in linux-next)

  origin.patch
* mm-shuffle-dont-move-pages-between-zones-and-dont-read-garbage-memmaps.patch
* mm-avoid-access-flag-update-tlb-flush-for-retried-page-fault.patch
* mm-close-race-between-munmap-and-expand_upwards-downwards.patch
* mm-close-race-between-munmap-and-expand_upwards-downwards-fix.patch
* vfs-xattr-mm-shmem-kernfs-release-simple-xattr-entry-in-a-right-way.patch
* mm-initialize-return-of-vm_insert_pages.patch
* mm-memcontrol-fix-oops-inside-mem_cgroup_get_nr_swap_pages.patch
* proc-kpageflags-prevent-an-integer-overflow-in-stable_page_flags.patch
* proc-kpageflags-do-not-use-uninitialized-struct-pages.patch
* mm-memcg-fix-refcount-error-while-moving-and-swapping.patch
* mm-hugetlb-avoid-hardcoding-while-checking-if-cma-is-enable.patch
* mailmap-add-entry-for-mike-rapoport.patch
* checkpatch-test-git_dir-changes.patch
* kthread-remove-incorrect-comment-in-kthread_create_on_cpu.patch
* kbuild-move-wtype-limits-to-w=2.patch
* scripts-tagssh-collect-compiled-source-precisely.patch
* scripts-tagssh-collect-compiled-source-precisely-v2.patch
* bloat-o-meter-support-comparing-library-archives.patch
* scripts-decode_stacktrace-skip-missing-symbols.patch
* scripts-decode_stacktrace-guess-basepath-if-not-specified.patch
* scripts-decode_stacktrace-guess-path-to-modules.patch
* scripts-decode_stacktrace-guess-path-to-vmlinux-by-release-name.patch
* ocfs2-clear-links-count-in-ocfs2_mknod-if-an-error-occurs.patch
* ocfs2-fix-ocfs2-corrupt-when-iputting-an-inode.patch
* ocfs2-change-slot-number-type-s16-to-u16.patch
* ramfs-support-o_tmpfile.patch
* kernel-watchdog-flush-all-printk-nmi-buffers-when-hardlockup-detected.patch
  mm.patch
* mm-treewide-rename-kzfree-to-kfree_sensitive.patch
* mm-ksize-should-silently-accept-a-null-pointer.patch
* mm-expand-config_slab_freelist_hardened-to-include-slab.patch
* slab-add-naive-detection-of-double-free.patch
* slab-add-naive-detection-of-double-free-fix.patch
* mm-slab-check-gfp_slab_bug_mask-before-alloc_pages-in-kmalloc_order.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks-fix.patch
* mm-slub-make-some-slub_debug-related-attributes-read-only.patch
* mm-slub-remove-runtime-allocation-order-changes.patch
* mm-slub-make-remaining-slub_debug-related-attributes-read-only.patch
* mm-slub-make-reclaim_account-attribute-read-only.patch
* mm-slub-introduce-static-key-for-slub_debug.patch
* mm-slub-introduce-kmem_cache_debug_flags.patch
* mm-slub-introduce-kmem_cache_debug_flags-fix.patch
* mm-slub-extend-checks-guarded-by-slub_debug-static-key.patch
* mm-slab-slub-move-and-improve-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj-fix.patch
* slub-drop-lockdep_assert_held-from-put_map.patch
* mm-kcsan-instrument-slab-slub-free-with-assert_exclusive_access.patch
* mm-debug_vm_pgtable-add-tests-validating-arch-helpers-for-core-mm-features.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers.patch
* mm-debug_vm_pgtable-add-debug-prints-for-individual-tests.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers.patch
* mm-handle-page-mapping-better-in-dump_page.patch
* mm-dump-compound-page-information-on-a-second-line.patch
* mm-print-head-flags-in-dump_page.patch
* mm-switch-dump_page-to-get_kernel_nofault.patch
* mm-print-the-inode-number-in-dump_page.patch
* mm-print-hashed-address-of-struct-page.patch
* mm-filemap-clear-idle-flag-for-writes.patch
* mm-filemap-add-missing-fgp_-flags-in-kerneldoc-comment-for-pagecache_get_page.patch
* mm-swap-simplify-alloc_swap_slot_cache.patch
* mm-swap-simplify-enable_swap_slots_cache.patch
* mm-swap-remove-redundant-check-for-swap_slot_cache_initialized.patch
* mm-kmem-make-memcg_kmem_enabled-irreversible.patch
* mm-memcg-factor-out-memcg-and-lruvec-level-changes-out-of-__mod_lruvec_state.patch
* mm-memcg-prepare-for-byte-sized-vmstat-items.patch
* mm-memcg-convert-vmstat-slab-counters-to-bytes.patch
* mm-slub-implement-slub-version-of-obj_to_index.patch
* mm-memcontrol-decouple-reference-counting-from-page-accounting.patch
* mm-memcg-slab-obj_cgroup-api.patch
* mm-memcg-slab-allocate-obj_cgroups-for-non-root-slab-pages.patch
* mm-memcg-slab-save-obj_cgroup-for-non-root-slab-objects.patch
* mm-memcg-slab-charge-individual-slab-objects-instead-of-pages.patch
* mm-memcg-slab-deprecate-memorykmemslabinfo.patch
* mm-memcg-slab-move-memcg_kmem_bypass-to-memcontrolh.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-accounted-allocations.patch
* mm-memcg-slab-simplify-memcg-cache-creation.patch
* mm-memcg-slab-remove-memcg_kmem_get_cache.patch
* mm-memcg-slab-deprecate-slab_root_caches.patch
* mm-memcg-slab-remove-redundant-check-in-memcg_accumulate_slabinfo.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-allocations.patch
* kselftests-cgroup-add-kernel-memory-accounting-tests.patch
* tools-cgroup-add-memcg_slabinfopy-tool.patch
* percpu-return-number-of-released-bytes-from-pcpu_free_area.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix-fix.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics-v3.patch
* mm-memcg-charge-memcg-percpu-memory-to-the-parent-cgroup.patch
* kselftests-cgroup-add-perpcu-memory-accounting-test.patch
* mm-memcontrol-account-kernel-stack-per-node.patch
* mm-memcg-slab-remove-unused-argument-by-charge_slab_page.patch
* mm-slab-rename-uncharge_slab_page-to-unaccount_slab_page.patch
* mm-kmem-switch-to-static_branch_likely-in-memcg_kmem_enabled.patch
* mm-memcontrol-avoid-workload-stalls-when-lowering-memoryhigh.patch
* mm-remove-redundant-check-non_swap_entry.patch
* mm-memoryc-make-remap_pfn_range-reject-unaligned-addr.patch
* mm-remove-unneeded-includes-of-asm-pgalloch.patch
* mm-remove-unneeded-includes-of-asm-pgalloch-fix.patch
* opeinrisc-switch-to-generic-version-of-pte-allocation.patch
* xtensa-switch-to-generic-version-of-pte-allocation.patch
* asm-generic-pgalloc-provide-generic-pmd_alloc_one-and-pmd_free_one.patch
* asm-generic-pgalloc-provide-generic-pud_alloc_one-and-pud_free_one.patch
* asm-generic-pgalloc-provide-generic-pgd_free.patch
* mm-move-lib-ioremapc-to-mm.patch
* mm-move-pd_alloc_track-to-separate-header-file.patch
* mm-mmap-fix-the-adjusted-length-error.patch
* mm-mmap-optimize-a-branch-judgment-in-ksys_mmap_pgoff.patch
* mm-do-page-fault-accounting-in-handle_mm_fault.patch
* mm-alpha-use-general-page-fault-accounting.patch
* mm-arc-use-general-page-fault-accounting.patch
* mm-arm-use-general-page-fault-accounting.patch
* mm-arm64-use-general-page-fault-accounting.patch
* mm-csky-use-general-page-fault-accounting.patch
* mm-hexagon-use-general-page-fault-accounting.patch
* mm-ia64-use-general-page-fault-accounting.patch
* mm-m68k-use-general-page-fault-accounting.patch
* mm-microblaze-use-general-page-fault-accounting.patch
* mm-mips-use-general-page-fault-accounting.patch
* mm-nds32-use-general-page-fault-accounting.patch
* mm-nios2-use-general-page-fault-accounting.patch
* mm-openrisc-use-general-page-fault-accounting.patch
* mm-parisc-use-general-page-fault-accounting.patch
* mm-powerpc-use-general-page-fault-accounting.patch
* mm-riscv-use-general-page-fault-accounting.patch
* mm-s390-use-general-page-fault-accounting.patch
* mm-sh-use-general-page-fault-accounting.patch
* mm-sparc32-use-general-page-fault-accounting.patch
* mm-sparc64-use-general-page-fault-accounting.patch
* mm-x86-use-general-page-fault-accounting.patch
* mm-xtensa-use-general-page-fault-accounting.patch
* mm-clean-up-the-last-pieces-of-page-fault-accountings.patch
* mm-gup-remove-task_struct-pointer-for-all-gup-code.patch
* mm-sparse-never-partially-remove-memmap-for-early-section.patch
* mm-sparse-only-sub-section-aligned-range-would-be-populated.patch
* vmalloc-convert-to-xarray.patch
* mm-vmalloc-simplify-merge_or_add_vmap_area-func.patch
* mm-vmalloc-simplify-augment_tree_propagate_check-func.patch
* mm-vmalloc-switch-to-propagate-callback.patch
* mm-vmalloc-update-the-header-about-kva-rework.patch
* mm-vmalloc-remove-redundant-asignmnet-in-unmap_kernel_range_noflush.patch
* kasan-improve-and-simplify-kconfigkasan.patch
* kasan-update-required-compiler-versions-in-documentation.patch
* rcu-kasan-record-and-print-call_rcu-call-stack.patch
* kasan-record-and-print-the-free-track.patch
* kasan-add-tests-for-call_rcu-stack-recording.patch
* kasan-update-documentation-for-generic-kasan.patch
* kasan-remove-kasan_unpoison_stack_above_sp_to.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan-v4.patch
* mm-page_alloc-use-unlikely-in-task_capc.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast-v5.patch
* mm-page_alloc-skip-waternark_boost-for-atomic-order-0-allocations.patch
* mm-page_alloc-skip-watermark_boost-for-atomic-order-0-allocations-fix.patch
* mm-drop-vm_total_pages.patch
* mm-page_alloc-drop-nr_free_pagecache_pages.patch
* mm-memory_hotplug-document-why-shuffle_zone-is-relevant.patch
* mm-shuffle-remove-dynamic-reconfiguration.patch
* powerpc-numa-set-numa_node-for-all-possible-cpus.patch
* powerpc-numa-prefer-node-id-queried-from-vphn.patch
* mm-page_alloc-keep-memoryless-cpuless-node-0-offline.patch
* mm-page_allocc-replace-the-definition-of-nr_migratetype_bits-with-pb_migratetype_bits.patch
* mm-page_allocc-extract-the-common-part-in-pfn_to_bitidx.patch
* mm-page_allocc-simplify-pageblock-bitmap-access.patch
* mm-page_allocc-remove-unnecessary-end_bitidx-for-_pfnblock_flags_mask.patch
* mm-page_alloc-silence-a-kasan-false-positive.patch
* mm-page_alloc-fallbacks-at-most-has-3-elements.patch
* mm-page_alloc-skip-setting-nodemask-when-we-are-in-interrupt.patch
* mm-huge_memoryc-update-tlb-entry-if-pmd-is-changed.patch
* mips-do-not-call-flush_tlb_all-when-setting-pmd-entry.patch
* mm-vmscanc-fixed-typo.patch
* mm-proactive-compaction.patch
* mm-proactive-compaction-fix.patch
* mm-use-unsigned-types-for-fragmentation-score.patch
* mm-oom-make-the-calculation-of-oom-badness-more-accurate.patch
* doc-mm-sync-up-oom_score_adj-documentation.patch
* doc-mm-clarify-proc-pid-oom_score-value-range.patch
* hugetlbfs-prevent-filesystem-stacking-of-hugetlbfs.patch
* mm-migrate-optimize-migrate_vma_setup-for-holes.patch
* mm-migrate-add-migrate-shared-test-for-migrate_vma_.patch
* mm-thp-remove-debug_cow-switch.patch
* mm-store-compound_nr-as-well-as-compound_order.patch
* mm-move-page-flags-include-to-top-of-file.patch
* mm-add-thp_order.patch
* mm-add-thp_size.patch
* mm-replace-hpage_nr_pages-with-thp_nr_pages.patch
* mm-add-thp_head.patch
* mm-introduce-offset_in_thp.patch
* mm-vmstat-add-events-for-thp-migration-without-split.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix-2.patch
* mm-cma-fix-null-pointer-dereference-when-cma-could-not-be-activated.patch
* mm-cma-fix-the-name-of-cma-areas.patch
* mm-cma-fix-the-name-of-cma-areas-fix.patch
* mm-hugetlb-fix-the-name-of-hugetlb-cma.patch
* mmhwpoison-cleanup-unused-pagehuge-check.patch
* mm-hwpoison-remove-recalculating-hpage.patch
* mmmadvise-call-soft_offline_page-without-mf_count_increased.patch
* mmmadvise-refactor-madvise_inject_error.patch
* mmhwpoison-inject-dont-pin-for-hwpoison_filter.patch
* mmhwpoison-un-export-get_hwpoison_page-and-make-it-static.patch
* mmhwpoison-kill-put_hwpoison_page.patch
* mmhwpoison-remove-mf_count_increased.patch
* mmhwpoison-remove-flag-argument-from-soft-offline-functions.patch
* mmhwpoison-unify-thp-handling-for-hard-and-soft-offline.patch
* mmhwpoison-rework-soft-offline-for-free-pages.patch
* mmhwpoison-rework-soft-offline-for-free-pages-fix.patch
* mmhwpoison-rework-soft-offline-for-in-use-pages.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page-fix.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page-fix-fix.patch
* mmhwpoison-return-0-if-the-page-is-already-poisoned-in-soft-offline.patch
* mmhwpoison-introduce-mf_msg_unsplit_thp.patch
* sched-mm-optimize-current_gfp_context.patch
* x86-mm-use-max-memory-block-size-on-bare-metal.patch
* info-task-hung-in-generic_file_write_iter.patch
* info-task-hung-in-generic_file_write-fix.patch
* kernel-hung_taskc-monitor-killed-tasks.patch
* fix-annotation-of-ioreadwrite1632be.patch
* sparse-group-the-defines-by-functionality.patch
* bitmap-fix-bitmap_cut-for-partial-overlapping-case.patch
* bitmap-add-test-for-bitmap_cut.patch
* lib-generic-radix-treec-remove-unneeded-__rcu.patch
* lib-test_bitops-do-the-full-test-during-module-init.patch
* lib-optimize-cpumask_local_spread.patch
* lib-test_lockupc-make-symbol-test_works-static.patch
* iomap-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* rtl818x-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* ntb-intel-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* virtio-pci-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* bits-add-tests-of-genmask.patch
* bits-add-tests-of-genmask-fix.patch
* bits-add-tests-of-genmask-fix-2.patch
* checkpatch-add-test-for-possible-misuse-of-is_enabled-without-config_.patch
* checkpatch-support-deprecated-terms-checking.patch
* scripts-deprecated_terms-recommend-denylist-allowlist-instead-of-blacklist-whitelist.patch
* checkpatch-add-fix-option-for-assign_in_if.patch
* checkpatch-fix-const_struct-when-const_structscheckpatch-is-missing.patch
* fs-minix-check-return-value-of-sb_getblk.patch
* fs-minix-dont-allow-getting-deleted-inodes.patch
* fs-minix-reject-too-large-maximum-file-size.patch
* fs-minix-set-s_maxbytes-correctly.patch
* fs-minix-fix-block-limit-check-for-v1-filesystems.patch
* fs-minix-remove-expected-error-message-in-block_to_path.patch
* fatfs-switch-write_lock-to-read_lock-in-fat_ioctl_get_attributes.patch
* vfat-fat-msdos-filesystem-replace-http-links-with-https-ones.patch
* fs-signalfdc-fix-inconsistent-return-codes-for-signalfd4.patch
* selftests-kmod-use-variable-name-in-kmod_test_0001.patch
* kmod-remove-redundant-be-an-in-the-comment.patch
* test_kmod-avoid-potential-double-free-in-trigger_config_run_type.patch
* coredump-add-%f-for-executable-filename.patch
* exec-change-uselib2-is_sreg-failure-to-eacces.patch
* exec-move-s_isreg-check-earlier.patch
* exec-move-path_noexec-check-earlier.patch
* kdump-append-kernel-build-id-string-to-vmcoreinfo.patch
* rapidio-rio_mport_cdev-use-struct_size-helper.patch
* rapidio-use-struct_size-helper.patch
* kernel-panicc-make-oops_may_print-return-bool.patch
* lib-kconfigdebug-fix-typo-in-the-help-text-of-config_panic_timeout.patch
* aio-simplify-read_events.patch
* kcov-unconditionally-add-fno-stack-protector-to-compiler-options.patch
* kcov-make-some-symbols-static.patch
  linux-next.patch
  linux-next-rejects.patch
* mm-madvise-pass-task-and-mm-to-do_madvise.patch
* pid-move-pidfd_get_pid-to-pidc.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix-2.patch
* mm-madvise-check-fatal-signal-pending-of-target-process.patch
* all-arch-remove-system-call-sys_sysctl.patch
* all-arch-remove-system-call-sys_sysctl-fix.patch
* mm-kmemleak-silence-kcsan-splats-in-checksum.patch
* mm-frontswap-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races-v2.patch
* mm-swap_state-mark-various-intentional-data-races.patch
* mm-filemap-fix-a-data-race-in-filemap_fault.patch
* mm-swapfile-fix-and-annotate-various-data-races.patch
* mm-swapfile-fix-and-annotate-various-data-races-v2.patch
* mm-page_counter-fix-various-data-races-at-memsw.patch
* mm-memcontrol-fix-a-data-race-in-scan-count.patch
* mm-list_lru-fix-a-data-race-in-list_lru_count_one.patch
* mm-mempool-fix-a-data-race-in-mempool_free.patch
* mm-rmap-annotate-a-data-race-at-tlb_flush_batched.patch
* mm-swap-annotate-data-races-for-lru_rotate_pvecs.patch
* mm-annotate-a-data-race-in-page_zonenum.patch
* include-asm-generic-vmlinuxldsh-align-ro_after_init.patch
* sh-clkfwk-remove-r8-r16-r32.patch
* sh-use-generic-strncpy.patch
* sh-add-missing-export_symbol-for-__delay.patch
  make-sure-nobodys-leaking-resources.patch
  releasing-resources-with-children.patch
  mutex-subsystem-synchro-test-module.patch
  kernel-forkc-export-kernel_thread-to-modules.patch
  workaround-for-a-pci-restoring-bug.patch


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-09-21-00 uploaded (drivers/net/ethernet/mellanox/mlx5/core/en_main.c)
  2020-07-10  4:00 ` mmotm 2020-07-09-21-00 uploaded Andrew Morton
@ 2020-07-10 17:40   ` Randy Dunlap
  2020-07-13  4:02     ` Stephen Rothwell
  0 siblings, 1 reply; 203+ messages in thread
From: Randy Dunlap @ 2020-07-10 17:40 UTC (permalink / raw)
  To: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, sfr, netdev, Saeed Mahameed,
	Leon Romanovsky, linux-rdma

On 7/9/20 9:00 PM, Andrew Morton wrote:
> The mm-of-the-moment snapshot 2020-07-09-21-00 has been uploaded to
> 
>    http://www.ozlabs.org/~akpm/mmotm/
> 
> mmotm-readme.txt says
> 
> README for mm-of-the-moment:
> 
> http://www.ozlabs.org/~akpm/mmotm/
> 
> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
> more than once a week.
> 
> You will need quilt to apply these patches to the latest Linus release (5.x
> or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
> http://ozlabs.org/~akpm/mmotm/series
> 

on i386:

In file included from ../drivers/net/ethernet/mellanox/mlx5/core/en_main.c:49:0:
../drivers/net/ethernet/mellanox/mlx5/core/en_accel/en_accel.h: In function ‘mlx5e_accel_sk_get_rxq’:
../drivers/net/ethernet/mellanox/mlx5/core/en_accel/en_accel.h:153:12: error: implicit declaration of function ‘sk_rx_queue_get’; did you mean ‘sk_rx_queue_set’? [-Werror=implicit-function-declaration]
  int rxq = sk_rx_queue_get(sk);
            ^~~~~~~~~~~~~~~
            sk_rx_queue_set



-- 
~Randy
Reported-by: Randy Dunlap <rdunlap@infradead.org>


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-09-21-00 uploaded (drivers/net/ethernet/mellanox/mlx5/core/en_main.c)
  2020-07-10 17:40   ` mmotm 2020-07-09-21-00 uploaded (drivers/net/ethernet/mellanox/mlx5/core/en_main.c) Randy Dunlap
@ 2020-07-13  4:02     ` Stephen Rothwell
  2020-07-13  4:17       ` Randy Dunlap
  0 siblings, 1 reply; 203+ messages in thread
From: Stephen Rothwell @ 2020-07-13  4:02 UTC (permalink / raw)
  To: Randy Dunlap
  Cc: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, netdev, Saeed Mahameed,
	Leon Romanovsky, linux-rdma, Tariq Toukan

[-- Attachment #1: Type: text/plain, Size: 802 bytes --]

Hi Randy,

On Fri, 10 Jul 2020 10:40:29 -0700 Randy Dunlap <rdunlap@infradead.org> wrote:
>
> on i386:
> 
> In file included from ../drivers/net/ethernet/mellanox/mlx5/core/en_main.c:49:0:
> ../drivers/net/ethernet/mellanox/mlx5/core/en_accel/en_accel.h: In function ‘mlx5e_accel_sk_get_rxq’:
> ../drivers/net/ethernet/mellanox/mlx5/core/en_accel/en_accel.h:153:12: error: implicit declaration of function ‘sk_rx_queue_get’; did you mean ‘sk_rx_queue_set’? [-Werror=implicit-function-declaration]
>   int rxq = sk_rx_queue_get(sk);
>             ^~~~~~~~~~~~~~~
>             sk_rx_queue_set

Caused by commit

  1182f3659357 ("net/mlx5e: kTLS, Add kTLS RX HW offload support")

from the net-next tree.  Presumably CONFIG_XPS is not set.

-- 
Cheers,
Stephen Rothwell

[-- Attachment #2: OpenPGP digital signature --]
[-- Type: application/pgp-signature, Size: 488 bytes --]

^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-09-21-00 uploaded (drivers/net/ethernet/mellanox/mlx5/core/en_main.c)
  2020-07-13  4:02     ` Stephen Rothwell
@ 2020-07-13  4:17       ` Randy Dunlap
  2020-07-14 23:58         ` Saeed Mahameed
  0 siblings, 1 reply; 203+ messages in thread
From: Randy Dunlap @ 2020-07-13  4:17 UTC (permalink / raw)
  To: Stephen Rothwell
  Cc: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, netdev, Saeed Mahameed,
	Leon Romanovsky, linux-rdma, Tariq Toukan

On 7/12/20 9:02 PM, Stephen Rothwell wrote:
> Hi Randy,
> 
> On Fri, 10 Jul 2020 10:40:29 -0700 Randy Dunlap <rdunlap@infradead.org> wrote:
>>
>> on i386:
>>
>> In file included from ../drivers/net/ethernet/mellanox/mlx5/core/en_main.c:49:0:
>> ../drivers/net/ethernet/mellanox/mlx5/core/en_accel/en_accel.h: In function ‘mlx5e_accel_sk_get_rxq’:
>> ../drivers/net/ethernet/mellanox/mlx5/core/en_accel/en_accel.h:153:12: error: implicit declaration of function ‘sk_rx_queue_get’; did you mean ‘sk_rx_queue_set’? [-Werror=implicit-function-declaration]
>>   int rxq = sk_rx_queue_get(sk);
>>             ^~~~~~~~~~~~~~~
>>             sk_rx_queue_set
> 
> Caused by commit
> 
>   1182f3659357 ("net/mlx5e: kTLS, Add kTLS RX HW offload support")
> 
> from the net-next tree.  Presumably CONFIG_XPS is not set.

Yes, that's correct.

-- 
~Randy



^ permalink raw reply	[flat|nested] 203+ messages in thread

* mmotm 2020-07-13-19-49 uploaded
  2020-07-03 22:14 incoming Andrew Morton
                   ` (7 preceding siblings ...)
  2020-07-10  4:00 ` mmotm 2020-07-09-21-00 uploaded Andrew Morton
@ 2020-07-14  2:49 ` Andrew Morton
  2020-07-17  5:53 ` mmotm 2020-07-16-22-52 uploaded Andrew Morton
  2020-07-21  2:07 ` mmotm 2020-07-20-19-06 uploaded Andrew Morton
  10 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-07-14  2:49 UTC (permalink / raw)
  To: broonie, linux-fsdevel, linux-kernel, linux-mm, linux-next,
	mhocko, mm-commits, sfr

The mm-of-the-moment snapshot 2020-07-13-19-49 has been uploaded to

   http://www.ozlabs.org/~akpm/mmotm/

mmotm-readme.txt says

README for mm-of-the-moment:

http://www.ozlabs.org/~akpm/mmotm/

This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
more than once a week.

You will need quilt to apply these patches to the latest Linus release (5.x
or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
http://ozlabs.org/~akpm/mmotm/series

The file broken-out.tar.gz contains two datestamp files: .DATE and
.DATE-yyyy-mm-dd-hh-mm-ss.  Both contain the string yyyy-mm-dd-hh-mm-ss,
followed by the base kernel version against which this patch series is to
be applied.

This tree is partially included in linux-next.  To see which patches are
included in linux-next, consult the `series' file.  Only the patches
within the #NEXT_PATCHES_START/#NEXT_PATCHES_END markers are included in
linux-next.


A full copy of the full kernel tree with the linux-next and mmotm patches
already applied is available through git within an hour of the mmotm
release.  Individual mmotm releases are tagged.  The master branch always
points to the latest release, so it's constantly rebasing.

	https://github.com/hnaz/linux-mm

The directory http://www.ozlabs.org/~akpm/mmots/ (mm-of-the-second)
contains daily snapshots of the -mm tree.  It is updated more frequently
than mmotm, and is untested.

A git copy of this tree is also available at

	https://github.com/hnaz/linux-mm



This mmotm tree contains the following patches against 5.8-rc5:
(patches marked "*" will be included in linux-next)

* mm-shuffle-dont-move-pages-between-zones-and-dont-read-garbage-memmaps.patch
* mm-avoid-access-flag-update-tlb-flush-for-retried-page-fault.patch
* mm-close-race-between-munmap-and-expand_upwards-downwards.patch
* mm-close-race-between-munmap-and-expand_upwards-downwards-fix.patch
* vfs-xattr-mm-shmem-kernfs-release-simple-xattr-entry-in-a-right-way.patch
* mm-initialize-return-of-vm_insert_pages.patch
* mm-memcontrol-fix-oops-inside-mem_cgroup_get_nr_swap_pages.patch
* proc-kpageflags-prevent-an-integer-overflow-in-stable_page_flags.patch
* proc-kpageflags-do-not-use-uninitialized-struct-pages.patch
* mm-memcg-fix-refcount-error-while-moving-and-swapping.patch
* mm-hugetlb-avoid-hardcoding-while-checking-if-cma-is-enabled.patch
* mailmap-add-entry-for-mike-rapoport.patch
* checkpatch-test-git_dir-changes.patch
* kthread-remove-incorrect-comment-in-kthread_create_on_cpu.patch
* scripts-tagssh-collect-compiled-source-precisely.patch
* scripts-tagssh-collect-compiled-source-precisely-v2.patch
* bloat-o-meter-support-comparing-library-archives.patch
* scripts-decode_stacktrace-skip-missing-symbols.patch
* scripts-decode_stacktrace-guess-basepath-if-not-specified.patch
* scripts-decode_stacktrace-guess-path-to-modules.patch
* scripts-decode_stacktrace-guess-path-to-vmlinux-by-release-name.patch
* const_structscheckpatch-add-regulator_ops.patch
* ocfs2-clear-links-count-in-ocfs2_mknod-if-an-error-occurs.patch
* ocfs2-fix-ocfs2-corrupt-when-iputting-an-inode.patch
* ocfs2-change-slot-number-type-s16-to-u16.patch
* ramfs-support-o_tmpfile.patch
* kernel-watchdog-flush-all-printk-nmi-buffers-when-hardlockup-detected.patch
  mm.patch
* mm-treewide-rename-kzfree-to-kfree_sensitive.patch
* mm-ksize-should-silently-accept-a-null-pointer.patch
* mm-expand-config_slab_freelist_hardened-to-include-slab.patch
* slab-add-naive-detection-of-double-free.patch
* slab-add-naive-detection-of-double-free-fix.patch
* mm-slab-check-gfp_slab_bug_mask-before-alloc_pages-in-kmalloc_order.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks-fix.patch
* mm-slub-make-some-slub_debug-related-attributes-read-only.patch
* mm-slub-remove-runtime-allocation-order-changes.patch
* mm-slub-make-remaining-slub_debug-related-attributes-read-only.patch
* mm-slub-make-reclaim_account-attribute-read-only.patch
* mm-slub-introduce-static-key-for-slub_debug.patch
* mm-slub-introduce-kmem_cache_debug_flags.patch
* mm-slub-introduce-kmem_cache_debug_flags-fix.patch
* mm-slub-extend-checks-guarded-by-slub_debug-static-key.patch
* mm-slab-slub-move-and-improve-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj-fix.patch
* slub-drop-lockdep_assert_held-from-put_map.patch
* mm-kcsan-instrument-slab-slub-free-with-assert_exclusive_access.patch
* mm-debug_vm_pgtable-add-tests-validating-arch-helpers-for-core-mm-features.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers-v5.patch
* mm-debug_vm_pgtable-add-debug-prints-for-individual-tests.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers-v5.patch
* mm-handle-page-mapping-better-in-dump_page.patch
* mm-handle-page-mapping-better-in-dump_page-fix.patch
* mm-dump-compound-page-information-on-a-second-line.patch
* mm-print-head-flags-in-dump_page.patch
* mm-switch-dump_page-to-get_kernel_nofault.patch
* mm-print-the-inode-number-in-dump_page.patch
* mm-print-hashed-address-of-struct-page.patch
* mm-filemap-clear-idle-flag-for-writes.patch
* mm-filemap-add-missing-fgp_-flags-in-kerneldoc-comment-for-pagecache_get_page.patch
* mm-swap-simplify-alloc_swap_slot_cache.patch
* mm-swap-simplify-enable_swap_slots_cache.patch
* mm-swap-remove-redundant-check-for-swap_slot_cache_initialized.patch
* tmpfs-per-superblock-i_ino-support.patch
* tmpfs-support-64-bit-inums-per-sb.patch
* mm-kmem-make-memcg_kmem_enabled-irreversible.patch
* mm-memcg-factor-out-memcg-and-lruvec-level-changes-out-of-__mod_lruvec_state.patch
* mm-memcg-prepare-for-byte-sized-vmstat-items.patch
* mm-memcg-convert-vmstat-slab-counters-to-bytes.patch
* mm-slub-implement-slub-version-of-obj_to_index.patch
* mm-memcontrol-decouple-reference-counting-from-page-accounting.patch
* mm-memcg-slab-obj_cgroup-api.patch
* mm-memcg-slab-allocate-obj_cgroups-for-non-root-slab-pages.patch
* mm-memcg-slab-save-obj_cgroup-for-non-root-slab-objects.patch
* mm-memcg-slab-charge-individual-slab-objects-instead-of-pages.patch
* mm-memcg-slab-deprecate-memorykmemslabinfo.patch
* mm-memcg-slab-move-memcg_kmem_bypass-to-memcontrolh.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-accounted-allocations.patch
* mm-memcg-slab-simplify-memcg-cache-creation.patch
* mm-memcg-slab-remove-memcg_kmem_get_cache.patch
* mm-memcg-slab-deprecate-slab_root_caches.patch
* mm-memcg-slab-remove-redundant-check-in-memcg_accumulate_slabinfo.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-allocations.patch
* kselftests-cgroup-add-kernel-memory-accounting-tests.patch
* tools-cgroup-add-memcg_slabinfopy-tool.patch
* percpu-return-number-of-released-bytes-from-pcpu_free_area.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix-fix.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics-v3.patch
* mm-memcg-charge-memcg-percpu-memory-to-the-parent-cgroup.patch
* kselftests-cgroup-add-perpcu-memory-accounting-test.patch
* mm-memcontrol-account-kernel-stack-per-node.patch
* mm-memcg-slab-remove-unused-argument-by-charge_slab_page.patch
* mm-slab-rename-uncharge_slab_page-to-unaccount_slab_page.patch
* mm-kmem-switch-to-static_branch_likely-in-memcg_kmem_enabled.patch
* mm-memcontrol-avoid-workload-stalls-when-lowering-memoryhigh.patch
* mm-memcg-reclaim-more-aggressively-before-high-allocator-throttling.patch
* mm-memcg-unify-reclaim-retry-limits-with-page-allocator.patch
* mm-memcg-avoid-stale-protection-values-when-cgroup-is-above-protection.patch
* mm-memcg-decouple-elowmin-state-mutations-from-protection-checks.patch
* mm-remove-redundant-check-non_swap_entry.patch
* mm-memoryc-make-remap_pfn_range-reject-unaligned-addr.patch
* mm-remove-unneeded-includes-of-asm-pgalloch.patch
* mm-remove-unneeded-includes-of-asm-pgalloch-fix.patch
* opeinrisc-switch-to-generic-version-of-pte-allocation.patch
* xtensa-switch-to-generic-version-of-pte-allocation.patch
* asm-generic-pgalloc-provide-generic-pmd_alloc_one-and-pmd_free_one.patch
* asm-generic-pgalloc-provide-generic-pud_alloc_one-and-pud_free_one.patch
* asm-generic-pgalloc-provide-generic-pgd_free.patch
* mm-move-lib-ioremapc-to-mm.patch
* mm-move-pd_alloc_track-to-separate-header-file.patch
* mm-mmap-fix-the-adjusted-length-error.patch
* mm-mmap-optimize-a-branch-judgment-in-ksys_mmap_pgoff.patch
* proc-meminfo-avoid-open-coded-reading-of-vm_committed_as.patch
* mm-utilc-make-vm_memory_committed-more-accurate.patch
* percpu_counter-add-percpu_counter_sync.patch
* mm-adjust-vm_committed_as_batch-according-to-vm-overcommit-policy.patch
* mm-mremap-it-is-sure-to-have-enough-space-when-extent-meets-requirement.patch
* mm-mremap-calculate-extent-in-one-place.patch
* mm-mremap-start-addresses-are-properly-aligned.patch
* mm-sparse-never-partially-remove-memmap-for-early-section.patch
* mm-sparse-only-sub-section-aligned-range-would-be-populated.patch
* mm-sparse-cleanup-the-code-surrounding-memory_present.patch
* vmalloc-convert-to-xarray.patch
* mm-vmalloc-simplify-merge_or_add_vmap_area-func.patch
* mm-vmalloc-simplify-augment_tree_propagate_check-func.patch
* mm-vmalloc-switch-to-propagate-callback.patch
* mm-vmalloc-update-the-header-about-kva-rework.patch
* mm-vmalloc-remove-redundant-asignmnet-in-unmap_kernel_range_noflush.patch
* mm-vmallocc-remove-bug-from-the-find_va_links.patch
* kasan-improve-and-simplify-kconfigkasan.patch
* kasan-update-required-compiler-versions-in-documentation.patch
* rcu-kasan-record-and-print-call_rcu-call-stack.patch
* rcu-kasan-record-and-print-call_rcu-call-stack-v8.patch
* kasan-record-and-print-the-free-track.patch
* kasan-record-and-print-the-free-track-v8.patch
* kasan-add-tests-for-call_rcu-stack-recording.patch
* kasan-update-documentation-for-generic-kasan.patch
* kasan-remove-kasan_unpoison_stack_above_sp_to.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan-v4.patch
* mm-page_alloc-use-unlikely-in-task_capc.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast-v5.patch
* mm-page_alloc-skip-waternark_boost-for-atomic-order-0-allocations.patch
* mm-page_alloc-skip-watermark_boost-for-atomic-order-0-allocations-fix.patch
* mm-drop-vm_total_pages.patch
* mm-page_alloc-drop-nr_free_pagecache_pages.patch
* mm-memory_hotplug-document-why-shuffle_zone-is-relevant.patch
* mm-shuffle-remove-dynamic-reconfiguration.patch
* powerpc-numa-set-numa_node-for-all-possible-cpus.patch
* powerpc-numa-prefer-node-id-queried-from-vphn.patch
* mm-page_alloc-keep-memoryless-cpuless-node-0-offline.patch
* mm-page_allocc-replace-the-definition-of-nr_migratetype_bits-with-pb_migratetype_bits.patch
* mm-page_allocc-extract-the-common-part-in-pfn_to_bitidx.patch
* mm-page_allocc-simplify-pageblock-bitmap-access.patch
* mm-page_allocc-remove-unnecessary-end_bitidx-for-_pfnblock_flags_mask.patch
* mm-page_alloc-silence-a-kasan-false-positive.patch
* mm-page_alloc-fallbacks-at-most-has-3-elements.patch
* mm-page_alloc-skip-setting-nodemask-when-we-are-in-interrupt.patch
* mm-huge_memoryc-update-tlb-entry-if-pmd-is-changed.patch
* mips-do-not-call-flush_tlb_all-when-setting-pmd-entry.patch
* mm-hugetlb-split-hugetlb_cma-in-nodes-with-memory.patch
* mm-thp-replace-http-links-with-https-ones.patch
* mm-vmscanc-fixed-typo.patch
* mm-vmscan-consistent-update-to-pgrefill.patch
* mm-proactive-compaction.patch
* mm-proactive-compaction-fix.patch
* mm-use-unsigned-types-for-fragmentation-score.patch
* mm-oom-make-the-calculation-of-oom-badness-more-accurate.patch
* mm-oom-make-the-calculation-of-oom-badness-more-accurate-v3.patch
* doc-mm-sync-up-oom_score_adj-documentation.patch
* doc-mm-clarify-proc-pid-oom_score-value-range.patch
* hugetlbfs-prevent-filesystem-stacking-of-hugetlbfs.patch
* mm-migrate-optimize-migrate_vma_setup-for-holes.patch
* mm-migrate-optimize-migrate_vma_setup-for-holes-v2.patch
* mm-migrate-add-migrate-shared-test-for-migrate_vma_.patch
* mm-thp-remove-debug_cow-switch.patch
* mm-store-compound_nr-as-well-as-compound_order.patch
* mm-move-page-flags-include-to-top-of-file.patch
* mm-add-thp_order.patch
* mm-add-thp_size.patch
* mm-replace-hpage_nr_pages-with-thp_nr_pages.patch
* mm-add-thp_head.patch
* mm-introduce-offset_in_thp.patch
* mm-vmstat-add-events-for-thp-migration-without-split.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix-2.patch
* mm-cma-fix-null-pointer-dereference-when-cma-could-not-be-activated.patch
* mm-cma-fix-the-name-of-cma-areas.patch
* mm-cma-fix-the-name-of-cma-areas-fix.patch
* mm-hugetlb-fix-the-name-of-hugetlb-cma.patch
* mmhwpoison-cleanup-unused-pagehuge-check.patch
* mm-hwpoison-remove-recalculating-hpage.patch
* mmmadvise-call-soft_offline_page-without-mf_count_increased.patch
* mmmadvise-refactor-madvise_inject_error.patch
* mmhwpoison-inject-dont-pin-for-hwpoison_filter.patch
* mmhwpoison-un-export-get_hwpoison_page-and-make-it-static.patch
* mmhwpoison-kill-put_hwpoison_page.patch
* mmhwpoison-remove-mf_count_increased.patch
* mmhwpoison-remove-flag-argument-from-soft-offline-functions.patch
* mmhwpoison-unify-thp-handling-for-hard-and-soft-offline.patch
* mmhwpoison-rework-soft-offline-for-free-pages.patch
* mmhwpoison-rework-soft-offline-for-free-pages-fix.patch
* mmhwpoison-rework-soft-offline-for-in-use-pages.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page-fix.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page-fix-fix.patch
* mmhwpoison-return-0-if-the-page-is-already-poisoned-in-soft-offline.patch
* mmhwpoison-introduce-mf_msg_unsplit_thp.patch
* sched-mm-optimize-current_gfp_context.patch
* x86-mm-use-max-memory-block-size-on-bare-metal.patch
* mm-memory_hotplug-introduce-default-dummy-memory_add_physaddr_to_nid.patch
* mm-memory_hotplug-fix-unpaired-mem_hotplug_begin-done.patch
* syscalls-use-uaccess_kernel-in-addr_limit_user_check.patch
* nds32-use-uaccess_kernel-in-show_regs.patch
* riscv-include-asm-pgtableh-in-asm-uaccessh.patch
* uaccess-remove-segment_eq.patch
* uaccess-add-force_uaccess_beginend-helpers.patch
* exec-use-force_uaccess_begin-during-exec-and-exit.patch
* info-task-hung-in-generic_file_write_iter.patch
* info-task-hung-in-generic_file_write-fix.patch
* kernel-hung_taskc-monitor-killed-tasks.patch
* fix-annotation-of-ioreadwrite1632be.patch
* proc-sysctl-make-protected_-world-readable.patch
* sparse-group-the-defines-by-functionality.patch
* bitmap-fix-bitmap_cut-for-partial-overlapping-case.patch
* bitmap-add-test-for-bitmap_cut.patch
* lib-generic-radix-treec-remove-unneeded-__rcu.patch
* lib-test_bitops-do-the-full-test-during-module-init.patch
* lib-optimize-cpumask_local_spread.patch
* lib-test_lockupc-make-symbol-test_works-static.patch
* iomap-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* rtl818x-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* ntb-intel-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* virtio-pci-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* bits-add-tests-of-genmask.patch
* bits-add-tests-of-genmask-fix.patch
* bits-add-tests-of-genmask-fix-2.patch
* checkpatch-add-test-for-possible-misuse-of-is_enabled-without-config_.patch
* checkpatch-support-deprecated-terms-checking.patch
* scripts-deprecated_terms-recommend-denylist-allowlist-instead-of-blacklist-whitelist.patch
* checkpatch-add-fix-option-for-assign_in_if.patch
* checkpatch-fix-const_struct-when-const_structscheckpatch-is-missing.patch
* fs-minix-check-return-value-of-sb_getblk.patch
* fs-minix-dont-allow-getting-deleted-inodes.patch
* fs-minix-reject-too-large-maximum-file-size.patch
* fs-minix-set-s_maxbytes-correctly.patch
* fs-minix-fix-block-limit-check-for-v1-filesystems.patch
* fs-minix-remove-expected-error-message-in-block_to_path.patch
* fatfs-switch-write_lock-to-read_lock-in-fat_ioctl_get_attributes.patch
* vfat-fat-msdos-filesystem-replace-http-links-with-https-ones.patch
* fat-fix-fat_ra_init-for-data-clusters-==-0.patch
* fs-signalfdc-fix-inconsistent-return-codes-for-signalfd4.patch
* selftests-kmod-use-variable-name-in-kmod_test_0001.patch
* kmod-remove-redundant-be-an-in-the-comment.patch
* test_kmod-avoid-potential-double-free-in-trigger_config_run_type.patch
* coredump-add-%f-for-executable-filename.patch
* exec-change-uselib2-is_sreg-failure-to-eacces.patch
* exec-move-s_isreg-check-earlier.patch
* exec-move-path_noexec-check-earlier.patch
* kdump-append-kernel-build-id-string-to-vmcoreinfo.patch
* rapidio-rio_mport_cdev-use-struct_size-helper.patch
* rapidio-use-struct_size-helper.patch
* rapidio-rio_mport_cdev-use-array_size-helper-in-copy_fromto_user.patch
* kernel-panicc-make-oops_may_print-return-bool.patch
* lib-kconfigdebug-fix-typo-in-the-help-text-of-config_panic_timeout.patch
* aio-simplify-read_events.patch
* kcov-unconditionally-add-fno-stack-protector-to-compiler-options.patch
* kcov-make-some-symbols-static.patch
* ipc-uninline-functions.patch
  linux-next.patch
  linux-next-rejects.patch
* mm-page_isolation-prefer-the-node-of-the-source-page.patch
* mm-migrate-move-migration-helper-from-h-to-c.patch
* mm-hugetlb-unify-migration-callbacks.patch
* mm-migrate-clear-__gfp_reclaim-to-make-the-migration-callback-consistent-with-regular-thp-allocations.patch
* mm-migrate-clear-__gfp_reclaim-to-make-the-migration-callback-consistent-with-regular-thp-allocations-fix.patch
* mm-migrate-make-a-standard-migration-target-allocation-function.patch
* mm-mempolicy-use-a-standard-migration-target-allocation-callback.patch
* mm-page_alloc-remove-a-wrapper-for-alloc_migration_target.patch
* mm-memory-failure-remove-a-wrapper-for-alloc_migration_target.patch
* mm-memory_hotplug-remove-a-wrapper-for-alloc_migration_target.patch
* scripts-deprecated_terms-sync-with-inclusive-terms.patch
* mm-do-page-fault-accounting-in-handle_mm_fault.patch
* mm-alpha-use-general-page-fault-accounting.patch
* mm-arc-use-general-page-fault-accounting.patch
* mm-arm-use-general-page-fault-accounting.patch
* mm-arm64-use-general-page-fault-accounting.patch
* mm-csky-use-general-page-fault-accounting.patch
* mm-hexagon-use-general-page-fault-accounting.patch
* mm-ia64-use-general-page-fault-accounting.patch
* mm-m68k-use-general-page-fault-accounting.patch
* mm-microblaze-use-general-page-fault-accounting.patch
* mm-mips-use-general-page-fault-accounting.patch
* mm-nds32-use-general-page-fault-accounting.patch
* mm-nios2-use-general-page-fault-accounting.patch
* mm-openrisc-use-general-page-fault-accounting.patch
* mm-parisc-use-general-page-fault-accounting.patch
* mm-powerpc-use-general-page-fault-accounting.patch
* mm-riscv-use-general-page-fault-accounting.patch
* mm-s390-use-general-page-fault-accounting.patch
* mm-sh-use-general-page-fault-accounting.patch
* mm-sparc32-use-general-page-fault-accounting.patch
* mm-sparc64-use-general-page-fault-accounting.patch
* mm-x86-use-general-page-fault-accounting.patch
* mm-xtensa-use-general-page-fault-accounting.patch
* mm-clean-up-the-last-pieces-of-page-fault-accountings.patch
* mm-gup-remove-task_struct-pointer-for-all-gup-code.patch
* mm-gup-remove-task_struct-pointer-for-all-gup-code-fix.patch
* mm-madvise-pass-task-and-mm-to-do_madvise.patch
* pid-move-pidfd_get_pid-to-pidc.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix-2.patch
* mm-madvise-check-fatal-signal-pending-of-target-process.patch
* all-arch-remove-system-call-sys_sysctl.patch
* all-arch-remove-system-call-sys_sysctl-fix.patch
* mm-kmemleak-silence-kcsan-splats-in-checksum.patch
* mm-frontswap-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races-v2.patch
* mm-swap_state-mark-various-intentional-data-races.patch
* mm-filemap-fix-a-data-race-in-filemap_fault.patch
* mm-swapfile-fix-and-annotate-various-data-races.patch
* mm-swapfile-fix-and-annotate-various-data-races-v2.patch
* mm-page_counter-fix-various-data-races-at-memsw.patch
* mm-memcontrol-fix-a-data-race-in-scan-count.patch
* mm-list_lru-fix-a-data-race-in-list_lru_count_one.patch
* mm-mempool-fix-a-data-race-in-mempool_free.patch
* mm-rmap-annotate-a-data-race-at-tlb_flush_batched.patch
* mm-swap-annotate-data-races-for-lru_rotate_pvecs.patch
* mm-annotate-a-data-race-in-page_zonenum.patch
* include-asm-generic-vmlinuxldsh-align-ro_after_init.patch
* sh-clkfwk-remove-r8-r16-r32.patch
* sh-use-generic-strncpy.patch
* sh-add-missing-export_symbol-for-__delay.patch
  make-sure-nobodys-leaking-resources.patch
  releasing-resources-with-children.patch
  mutex-subsystem-synchro-test-module.patch
  kernel-forkc-export-kernel_thread-to-modules.patch
  workaround-for-a-pci-restoring-bug.patch


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-09-21-00 uploaded (drivers/net/ethernet/mellanox/mlx5/core/en_main.c)
  2020-07-13  4:17       ` Randy Dunlap
@ 2020-07-14 23:58         ` Saeed Mahameed
  0 siblings, 0 replies; 203+ messages in thread
From: Saeed Mahameed @ 2020-07-14 23:58 UTC (permalink / raw)
  To: sfr, rdunlap
  Cc: mhocko, mm-commits, Leon Romanovsky, linux-next, linux-mm,
	broonie, akpm, linux-kernel, Tariq Toukan, netdev, linux-fsdevel,
	linux-rdma

On Sun, 2020-07-12 at 21:17 -0700, Randy Dunlap wrote:
> On 7/12/20 9:02 PM, Stephen Rothwell wrote:
> > Hi Randy,
> > 
> > On Fri, 10 Jul 2020 10:40:29 -0700 Randy Dunlap <
> > rdunlap@infradead.org> wrote:
> > > on i386:
> > > 
> > > In file included from
> > > ../drivers/net/ethernet/mellanox/mlx5/core/en_main.c:49:0:
> > > ../drivers/net/ethernet/mellanox/mlx5/core/en_accel/en_accel.h:
> > > In function ‘mlx5e_accel_sk_get_rxq’:
> > > ../drivers/net/ethernet/mellanox/mlx5/core/en_accel/en_accel.h:15
> > > 3:12: error: implicit declaration of function ‘sk_rx_queue_get’;
> > > did you mean ‘sk_rx_queue_set’? [-Werror=implicit-function-
> > > declaration]
> > >   int rxq = sk_rx_queue_get(sk);
> > >             ^~~~~~~~~~~~~~~
> > >             sk_rx_queue_set
> > 
> > Caused by commit
> > 
> >   1182f3659357 ("net/mlx5e: kTLS, Add kTLS RX HW offload support")
> > 
> > from the net-next tree.  Presumably CONFIG_XPS is not set.
> 
> Yes, that's correct.
> 

Thanks for the report, we will handle and submit a patch to net-next.

^ permalink raw reply	[flat|nested] 203+ messages in thread

* mmotm 2020-07-16-22-52 uploaded
  2020-07-03 22:14 incoming Andrew Morton
                   ` (8 preceding siblings ...)
  2020-07-14  2:49 ` mmotm 2020-07-13-19-49 uploaded Andrew Morton
@ 2020-07-17  5:53 ` Andrew Morton
  2020-07-17 15:30   ` mmotm 2020-07-16-22-52 uploaded (net: IPVS) Randy Dunlap
  2020-07-17 15:35   ` mmotm 2020-07-16-22-52 uploaded (mm/hugetlb.c) Randy Dunlap
  2020-07-21  2:07 ` mmotm 2020-07-20-19-06 uploaded Andrew Morton
  10 siblings, 2 replies; 203+ messages in thread
From: Andrew Morton @ 2020-07-17  5:53 UTC (permalink / raw)
  To: broonie, linux-fsdevel, linux-kernel, linux-mm, linux-next,
	mhocko, mm-commits, sfr

The mm-of-the-moment snapshot 2020-07-16-22-52 has been uploaded to

   http://www.ozlabs.org/~akpm/mmotm/

mmotm-readme.txt says

README for mm-of-the-moment:

http://www.ozlabs.org/~akpm/mmotm/

This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
more than once a week.

You will need quilt to apply these patches to the latest Linus release (5.x
or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
http://ozlabs.org/~akpm/mmotm/series

The file broken-out.tar.gz contains two datestamp files: .DATE and
.DATE-yyyy-mm-dd-hh-mm-ss.  Both contain the string yyyy-mm-dd-hh-mm-ss,
followed by the base kernel version against which this patch series is to
be applied.

This tree is partially included in linux-next.  To see which patches are
included in linux-next, consult the `series' file.  Only the patches
within the #NEXT_PATCHES_START/#NEXT_PATCHES_END markers are included in
linux-next.


A full copy of the full kernel tree with the linux-next and mmotm patches
already applied is available through git within an hour of the mmotm
release.  Individual mmotm releases are tagged.  The master branch always
points to the latest release, so it's constantly rebasing.

	https://github.com/hnaz/linux-mm

The directory http://www.ozlabs.org/~akpm/mmots/ (mm-of-the-second)
contains daily snapshots of the -mm tree.  It is updated more frequently
than mmotm, and is untested.

A git copy of this tree is also available at

	https://github.com/hnaz/linux-mm



This mmotm tree contains the following patches against 5.8-rc5:
(patches marked "*" will be included in linux-next)

  origin.patch
* mm-shuffle-dont-move-pages-between-zones-and-dont-read-garbage-memmaps.patch
* mm-avoid-access-flag-update-tlb-flush-for-retried-page-fault.patch
* mm-avoid-access-flag-update-tlb-flush-for-retried-page-fault-v2.patch
* mm-close-race-between-munmap-and-expand_upwards-downwards.patch
* mm-close-race-between-munmap-and-expand_upwards-downwards-fix.patch
* vfs-xattr-mm-shmem-kernfs-release-simple-xattr-entry-in-a-right-way.patch
* mm-initialize-return-of-vm_insert_pages.patch
* mm-memcontrol-fix-oops-inside-mem_cgroup_get_nr_swap_pages.patch
* proc-kpageflags-prevent-an-integer-overflow-in-stable_page_flags.patch
* proc-kpageflags-do-not-use-uninitialized-struct-pages.patch
* mm-memcg-fix-refcount-error-while-moving-and-swapping.patch
* mm-memcg-slab-fix-memory-leak-at-non-root-kmem_cache-destroy.patch
* mm-hugetlb-avoid-hardcoding-while-checking-if-cma-is-enabled.patch
* mailmap-add-entry-for-mike-rapoport.patch
* revert-squashfs-migrate-from-ll_rw_block-usage-to-bio.patch
* revert-squashfs-migrate-from-ll_rw_block-usage-to-bio-fix.patch
* checkpatch-test-git_dir-changes.patch
* kthread-remove-incorrect-comment-in-kthread_create_on_cpu.patch
* scripts-tagssh-collect-compiled-source-precisely.patch
* scripts-tagssh-collect-compiled-source-precisely-v2.patch
* bloat-o-meter-support-comparing-library-archives.patch
* scripts-decode_stacktrace-skip-missing-symbols.patch
* scripts-decode_stacktrace-guess-basepath-if-not-specified.patch
* scripts-decode_stacktrace-guess-path-to-modules.patch
* scripts-decode_stacktrace-guess-path-to-vmlinux-by-release-name.patch
* const_structscheckpatch-add-regulator_ops.patch
* scripts-spellingtxt-add-more-spellings-to-spellingtxt.patch
* ocfs2-clear-links-count-in-ocfs2_mknod-if-an-error-occurs.patch
* ocfs2-fix-ocfs2-corrupt-when-iputting-an-inode.patch
* ocfs2-change-slot-number-type-s16-to-u16.patch
* ramfs-support-o_tmpfile.patch
* kernel-watchdog-flush-all-printk-nmi-buffers-when-hardlockup-detected.patch
  mm.patch
* mm-treewide-rename-kzfree-to-kfree_sensitive.patch
* mm-ksize-should-silently-accept-a-null-pointer.patch
* mm-expand-config_slab_freelist_hardened-to-include-slab.patch
* slab-add-naive-detection-of-double-free.patch
* slab-add-naive-detection-of-double-free-fix.patch
* mm-slab-check-gfp_slab_bug_mask-before-alloc_pages-in-kmalloc_order.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks-fix.patch
* mm-slub-make-some-slub_debug-related-attributes-read-only.patch
* mm-slub-remove-runtime-allocation-order-changes.patch
* mm-slub-make-remaining-slub_debug-related-attributes-read-only.patch
* mm-slub-make-reclaim_account-attribute-read-only.patch
* mm-slub-introduce-static-key-for-slub_debug.patch
* mm-slub-introduce-kmem_cache_debug_flags.patch
* mm-slub-introduce-kmem_cache_debug_flags-fix.patch
* mm-slub-extend-checks-guarded-by-slub_debug-static-key.patch
* mm-slab-slub-move-and-improve-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj-fix.patch
* slub-drop-lockdep_assert_held-from-put_map.patch
* mm-kcsan-instrument-slab-slub-free-with-assert_exclusive_access.patch
* mm-debug_vm_pgtable-add-tests-validating-arch-helpers-for-core-mm-features.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers-v5.patch
* mm-debug_vm_pgtable-add-debug-prints-for-individual-tests.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers-v5.patch
* mm-handle-page-mapping-better-in-dump_page.patch
* mm-handle-page-mapping-better-in-dump_page-fix.patch
* mm-dump-compound-page-information-on-a-second-line.patch
* mm-print-head-flags-in-dump_page.patch
* mm-switch-dump_page-to-get_kernel_nofault.patch
* mm-print-the-inode-number-in-dump_page.patch
* mm-print-hashed-address-of-struct-page.patch
* mm-filemap-clear-idle-flag-for-writes.patch
* mm-filemap-add-missing-fgp_-flags-in-kerneldoc-comment-for-pagecache_get_page.patch
* mm-swap-simplify-alloc_swap_slot_cache.patch
* mm-swap-simplify-enable_swap_slots_cache.patch
* mm-swap-remove-redundant-check-for-swap_slot_cache_initialized.patch
* tmpfs-per-superblock-i_ino-support.patch
* tmpfs-support-64-bit-inums-per-sb.patch
* mm-kmem-make-memcg_kmem_enabled-irreversible.patch
* mm-memcg-factor-out-memcg-and-lruvec-level-changes-out-of-__mod_lruvec_state.patch
* mm-memcg-prepare-for-byte-sized-vmstat-items.patch
* mm-memcg-convert-vmstat-slab-counters-to-bytes.patch
* mm-slub-implement-slub-version-of-obj_to_index.patch
* mm-memcontrol-decouple-reference-counting-from-page-accounting.patch
* mm-memcg-slab-obj_cgroup-api.patch
* mm-memcg-slab-allocate-obj_cgroups-for-non-root-slab-pages.patch
* mm-memcg-slab-save-obj_cgroup-for-non-root-slab-objects.patch
* mm-memcg-slab-charge-individual-slab-objects-instead-of-pages.patch
* mm-memcg-slab-deprecate-memorykmemslabinfo.patch
* mm-memcg-slab-move-memcg_kmem_bypass-to-memcontrolh.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-accounted-allocations.patch
* mm-memcg-slab-simplify-memcg-cache-creation.patch
* mm-memcg-slab-remove-memcg_kmem_get_cache.patch
* mm-memcg-slab-deprecate-slab_root_caches.patch
* mm-memcg-slab-remove-redundant-check-in-memcg_accumulate_slabinfo.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-allocations.patch
* kselftests-cgroup-add-kernel-memory-accounting-tests.patch
* tools-cgroup-add-memcg_slabinfopy-tool.patch
* percpu-return-number-of-released-bytes-from-pcpu_free_area.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix-fix.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix-2.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics-v3.patch
* mm-memcg-charge-memcg-percpu-memory-to-the-parent-cgroup.patch
* kselftests-cgroup-add-perpcu-memory-accounting-test.patch
* mm-memcontrol-account-kernel-stack-per-node.patch
* mm-memcg-slab-remove-unused-argument-by-charge_slab_page.patch
* mm-slab-rename-uncharge_slab_page-to-unaccount_slab_page.patch
* mm-kmem-switch-to-static_branch_likely-in-memcg_kmem_enabled.patch
* mm-memcontrol-avoid-workload-stalls-when-lowering-memoryhigh.patch
* mm-memcg-reclaim-more-aggressively-before-high-allocator-throttling.patch
* mm-memcg-unify-reclaim-retry-limits-with-page-allocator.patch
* mm-memcg-avoid-stale-protection-values-when-cgroup-is-above-protection.patch
* mm-memcg-decouple-elowmin-state-mutations-from-protection-checks.patch
* memcg-oom-check-memcg-margin-for-parallel-oom.patch
* mm-remove-redundant-check-non_swap_entry.patch
* mm-memoryc-make-remap_pfn_range-reject-unaligned-addr.patch
* mm-remove-unneeded-includes-of-asm-pgalloch.patch
* mm-remove-unneeded-includes-of-asm-pgalloch-fix.patch
* opeinrisc-switch-to-generic-version-of-pte-allocation.patch
* xtensa-switch-to-generic-version-of-pte-allocation.patch
* asm-generic-pgalloc-provide-generic-pmd_alloc_one-and-pmd_free_one.patch
* asm-generic-pgalloc-provide-generic-pud_alloc_one-and-pud_free_one.patch
* asm-generic-pgalloc-provide-generic-pgd_free.patch
* mm-move-lib-ioremapc-to-mm.patch
* mm-move-pd_alloc_track-to-separate-header-file.patch
* mm-mmap-fix-the-adjusted-length-error.patch
* mm-mmap-optimize-a-branch-judgment-in-ksys_mmap_pgoff.patch
* proc-meminfo-avoid-open-coded-reading-of-vm_committed_as.patch
* mm-utilc-make-vm_memory_committed-more-accurate.patch
* percpu_counter-add-percpu_counter_sync.patch
* mm-adjust-vm_committed_as_batch-according-to-vm-overcommit-policy.patch
* mm-mremap-it-is-sure-to-have-enough-space-when-extent-meets-requirement.patch
* mm-mremap-calculate-extent-in-one-place.patch
* mm-mremap-start-addresses-are-properly-aligned.patch
* mm-sparse-never-partially-remove-memmap-for-early-section.patch
* mm-sparse-only-sub-section-aligned-range-would-be-populated.patch
* mm-sparse-cleanup-the-code-surrounding-memory_present.patch
* vmalloc-convert-to-xarray.patch
* mm-vmalloc-simplify-merge_or_add_vmap_area-func.patch
* mm-vmalloc-simplify-augment_tree_propagate_check-func.patch
* mm-vmalloc-switch-to-propagate-callback.patch
* mm-vmalloc-update-the-header-about-kva-rework.patch
* mm-vmalloc-remove-redundant-asignmnet-in-unmap_kernel_range_noflush.patch
* mm-vmallocc-remove-bug-from-the-find_va_links.patch
* kasan-improve-and-simplify-kconfigkasan.patch
* kasan-update-required-compiler-versions-in-documentation.patch
* rcu-kasan-record-and-print-call_rcu-call-stack.patch
* rcu-kasan-record-and-print-call_rcu-call-stack-v8.patch
* kasan-record-and-print-the-free-track.patch
* kasan-record-and-print-the-free-track-v8.patch
* kasan-add-tests-for-call_rcu-stack-recording.patch
* kasan-update-documentation-for-generic-kasan.patch
* kasan-remove-kasan_unpoison_stack_above_sp_to.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan-v4.patch
* mm-page_alloc-use-unlikely-in-task_capc.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast-v5.patch
* mm-page_alloc-skip-waternark_boost-for-atomic-order-0-allocations.patch
* mm-page_alloc-skip-watermark_boost-for-atomic-order-0-allocations-fix.patch
* mm-drop-vm_total_pages.patch
* mm-page_alloc-drop-nr_free_pagecache_pages.patch
* mm-memory_hotplug-document-why-shuffle_zone-is-relevant.patch
* mm-shuffle-remove-dynamic-reconfiguration.patch
* powerpc-numa-set-numa_node-for-all-possible-cpus.patch
* powerpc-numa-prefer-node-id-queried-from-vphn.patch
* mm-page_alloc-keep-memoryless-cpuless-node-0-offline.patch
* mm-page_allocc-replace-the-definition-of-nr_migratetype_bits-with-pb_migratetype_bits.patch
* mm-page_allocc-extract-the-common-part-in-pfn_to_bitidx.patch
* mm-page_allocc-simplify-pageblock-bitmap-access.patch
* mm-page_allocc-remove-unnecessary-end_bitidx-for-_pfnblock_flags_mask.patch
* mm-page_alloc-silence-a-kasan-false-positive.patch
* mm-page_alloc-fallbacks-at-most-has-3-elements.patch
* mm-page_alloc-skip-setting-nodemask-when-we-are-in-interrupt.patch
* mm-huge_memoryc-update-tlb-entry-if-pmd-is-changed.patch
* mips-do-not-call-flush_tlb_all-when-setting-pmd-entry.patch
* mm-hugetlb-split-hugetlb_cma-in-nodes-with-memory.patch
* mm-thp-replace-http-links-with-https-ones.patch
* mm-thp-replace-http-links-with-https-ones-fix.patch
* mm-vmscanc-fixed-typo.patch
* mm-vmscan-consistent-update-to-pgrefill.patch
* mm-proactive-compaction.patch
* mm-proactive-compaction-fix.patch
* mm-use-unsigned-types-for-fragmentation-score.patch
* mm-oom-make-the-calculation-of-oom-badness-more-accurate.patch
* mm-oom-make-the-calculation-of-oom-badness-more-accurate-v3.patch
* doc-mm-sync-up-oom_score_adj-documentation.patch
* doc-mm-clarify-proc-pid-oom_score-value-range.patch
* hugetlbfs-prevent-filesystem-stacking-of-hugetlbfs.patch
* mm-migrate-optimize-migrate_vma_setup-for-holes.patch
* mm-migrate-optimize-migrate_vma_setup-for-holes-v2.patch
* mm-migrate-add-migrate-shared-test-for-migrate_vma_.patch
* mm-thp-remove-debug_cow-switch.patch
* mm-store-compound_nr-as-well-as-compound_order.patch
* mm-move-page-flags-include-to-top-of-file.patch
* mm-add-thp_order.patch
* mm-add-thp_size.patch
* mm-replace-hpage_nr_pages-with-thp_nr_pages.patch
* mm-add-thp_head.patch
* mm-introduce-offset_in_thp.patch
* mm-vmstat-add-events-for-thp-migration-without-split.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix-2.patch
* mm-cma-fix-null-pointer-dereference-when-cma-could-not-be-activated.patch
* mm-cma-fix-the-name-of-cma-areas.patch
* mm-cma-fix-the-name-of-cma-areas-fix.patch
* mm-hugetlb-fix-the-name-of-hugetlb-cma.patch
* mmhwpoison-cleanup-unused-pagehuge-check.patch
* mm-hwpoison-remove-recalculating-hpage.patch
* mmmadvise-call-soft_offline_page-without-mf_count_increased.patch
* mmmadvise-refactor-madvise_inject_error.patch
* mmhwpoison-inject-dont-pin-for-hwpoison_filter.patch
* mmhwpoison-un-export-get_hwpoison_page-and-make-it-static.patch
* mmhwpoison-kill-put_hwpoison_page.patch
* mmhwpoison-remove-mf_count_increased.patch
* mmhwpoison-remove-flag-argument-from-soft-offline-functions.patch
* mmhwpoison-unify-thp-handling-for-hard-and-soft-offline.patch
* mmhwpoison-rework-soft-offline-for-free-pages.patch
* mmhwpoison-rework-soft-offline-for-in-use-pages.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page.patch
* mmhwpoison-return-0-if-the-page-is-already-poisoned-in-soft-offline.patch
* mmhwpoison-introduce-mf_msg_unsplit_thp.patch
* mm-vmstat-fix-proc-sys-vm-stat_refresh-generating-false-warnings.patch
* sched-mm-optimize-current_gfp_context.patch
* x86-mm-use-max-memory-block-size-on-bare-metal.patch
* x86-mm-use-max-memory-block-size-on-bare-metal-v3.patch
* mm-memory_hotplug-introduce-default-dummy-memory_add_physaddr_to_nid.patch
* mm-memory_hotplug-fix-unpaired-mem_hotplug_begin-done.patch
* linux-sched-mmh-drop-duplicated-words-in-comments.patch
* mm-drop-duplicated-words-in-linux-pgtableh.patch
* mm-drop-duplicated-words-in-linux-mmh.patch
* syscalls-use-uaccess_kernel-in-addr_limit_user_check.patch
* nds32-use-uaccess_kernel-in-show_regs.patch
* riscv-include-asm-pgtableh-in-asm-uaccessh.patch
* uaccess-remove-segment_eq.patch
* uaccess-add-force_uaccess_beginend-helpers.patch
* exec-use-force_uaccess_begin-during-exec-and-exit.patch
* info-task-hung-in-generic_file_write_iter.patch
* info-task-hung-in-generic_file_write-fix.patch
* kernel-hung_taskc-monitor-killed-tasks.patch
* fix-annotation-of-ioreadwrite1632be.patch
* proc-sysctl-make-protected_-world-readable.patch
* sparse-group-the-defines-by-functionality.patch
* bitmap-fix-bitmap_cut-for-partial-overlapping-case.patch
* bitmap-add-test-for-bitmap_cut.patch
* lib-generic-radix-treec-remove-unneeded-__rcu.patch
* lib-test_bitops-do-the-full-test-during-module-init.patch
* lib-optimize-cpumask_local_spread.patch
* lib-test_lockupc-make-symbol-test_works-static.patch
* iomap-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* rtl818x-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* ntb-intel-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* virtio-pci-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* bits-add-tests-of-genmask.patch
* bits-add-tests-of-genmask-fix.patch
* bits-add-tests-of-genmask-fix-2.patch
* checkpatch-add-test-for-possible-misuse-of-is_enabled-without-config_.patch
* checkpatch-support-deprecated-terms-checking.patch
* scripts-deprecated_terms-recommend-denylist-allowlist-instead-of-blacklist-whitelist.patch
* checkpatch-add-fix-option-for-assign_in_if.patch
* checkpatch-fix-const_struct-when-const_structscheckpatch-is-missing.patch
* autofs-fix-doubled-word.patch
* fs-minix-check-return-value-of-sb_getblk.patch
* fs-minix-dont-allow-getting-deleted-inodes.patch
* fs-minix-reject-too-large-maximum-file-size.patch
* fs-minix-set-s_maxbytes-correctly.patch
* fs-minix-fix-block-limit-check-for-v1-filesystems.patch
* fs-minix-remove-expected-error-message-in-block_to_path.patch
* fs-ufs-avoid-potential-u32-multiplication-overflow.patch
* fatfs-switch-write_lock-to-read_lock-in-fat_ioctl_get_attributes.patch
* vfat-fat-msdos-filesystem-replace-http-links-with-https-ones.patch
* fat-fix-fat_ra_init-for-data-clusters-==-0.patch
* fs-signalfdc-fix-inconsistent-return-codes-for-signalfd4.patch
* selftests-kmod-use-variable-name-in-kmod_test_0001.patch
* kmod-remove-redundant-be-an-in-the-comment.patch
* test_kmod-avoid-potential-double-free-in-trigger_config_run_type.patch
* coredump-add-%f-for-executable-filename.patch
* exec-change-uselib2-is_sreg-failure-to-eacces.patch
* exec-move-s_isreg-check-earlier.patch
* exec-move-path_noexec-check-earlier.patch
* kdump-append-kernel-build-id-string-to-vmcoreinfo.patch
* rapidio-rio_mport_cdev-use-struct_size-helper.patch
* rapidio-use-struct_size-helper.patch
* rapidio-rio_mport_cdev-use-array_size-helper-in-copy_fromto_user.patch
* kernel-panicc-make-oops_may_print-return-bool.patch
* lib-kconfigdebug-fix-typo-in-the-help-text-of-config_panic_timeout.patch
* aio-simplify-read_events.patch
* kcov-unconditionally-add-fno-stack-protector-to-compiler-options.patch
* kcov-make-some-symbols-static.patch
* ipc-uninline-functions.patch
* ipc-shmc-remove-the-superfluous-break.patch
  linux-next.patch
  linux-next-rejects.patch
  linux-next-git-rejects.patch
* mm-page_isolation-prefer-the-node-of-the-source-page.patch
* mm-migrate-move-migration-helper-from-h-to-c.patch
* mm-hugetlb-unify-migration-callbacks.patch
* mm-migrate-clear-__gfp_reclaim-to-make-the-migration-callback-consistent-with-regular-thp-allocations.patch
* mm-migrate-clear-__gfp_reclaim-to-make-the-migration-callback-consistent-with-regular-thp-allocations-fix.patch
* mm-migrate-make-a-standard-migration-target-allocation-function.patch
* mm-mempolicy-use-a-standard-migration-target-allocation-callback.patch
* mm-page_alloc-remove-a-wrapper-for-alloc_migration_target.patch
* mm-memory-failure-remove-a-wrapper-for-alloc_migration_target.patch
* mm-memory_hotplug-remove-a-wrapper-for-alloc_migration_target.patch
* scripts-deprecated_terms-sync-with-inclusive-terms.patch
* mm-do-page-fault-accounting-in-handle_mm_fault.patch
* mm-alpha-use-general-page-fault-accounting.patch
* mm-arc-use-general-page-fault-accounting.patch
* mm-arm-use-general-page-fault-accounting.patch
* mm-arm64-use-general-page-fault-accounting.patch
* mm-csky-use-general-page-fault-accounting.patch
* mm-hexagon-use-general-page-fault-accounting.patch
* mm-ia64-use-general-page-fault-accounting.patch
* mm-m68k-use-general-page-fault-accounting.patch
* mm-microblaze-use-general-page-fault-accounting.patch
* mm-mips-use-general-page-fault-accounting.patch
* mm-nds32-use-general-page-fault-accounting.patch
* mm-nios2-use-general-page-fault-accounting.patch
* mm-openrisc-use-general-page-fault-accounting.patch
* mm-parisc-use-general-page-fault-accounting.patch
* mm-powerpc-use-general-page-fault-accounting.patch
* mm-riscv-use-general-page-fault-accounting.patch
* mm-s390-use-general-page-fault-accounting.patch
* mm-sh-use-general-page-fault-accounting.patch
* mm-sparc32-use-general-page-fault-accounting.patch
* mm-sparc64-use-general-page-fault-accounting.patch
* mm-x86-use-general-page-fault-accounting.patch
* mm-xtensa-use-general-page-fault-accounting.patch
* mm-clean-up-the-last-pieces-of-page-fault-accountings.patch
* mm-gup-remove-task_struct-pointer-for-all-gup-code.patch
* mm-gup-remove-task_struct-pointer-for-all-gup-code-fix.patch
* mm-madvise-pass-task-and-mm-to-do_madvise.patch
* pid-move-pidfd_get_pid-to-pidc.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix-2.patch
* mm-madvise-check-fatal-signal-pending-of-target-process.patch
* all-arch-remove-system-call-sys_sysctl.patch
* all-arch-remove-system-call-sys_sysctl-fix.patch
* mm-kmemleak-silence-kcsan-splats-in-checksum.patch
* mm-frontswap-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races-v2.patch
* mm-swap_state-mark-various-intentional-data-races.patch
* mm-filemap-fix-a-data-race-in-filemap_fault.patch
* mm-swapfile-fix-and-annotate-various-data-races.patch
* mm-swapfile-fix-and-annotate-various-data-races-v2.patch
* mm-page_counter-fix-various-data-races-at-memsw.patch
* mm-memcontrol-fix-a-data-race-in-scan-count.patch
* mm-list_lru-fix-a-data-race-in-list_lru_count_one.patch
* mm-mempool-fix-a-data-race-in-mempool_free.patch
* mm-rmap-annotate-a-data-race-at-tlb_flush_batched.patch
* mm-swap-annotate-data-races-for-lru_rotate_pvecs.patch
* mm-annotate-a-data-race-in-page_zonenum.patch
* include-asm-generic-vmlinuxldsh-align-ro_after_init.patch
* sh-clkfwk-remove-r8-r16-r32.patch
* sh-use-generic-strncpy.patch
* sh-add-missing-export_symbol-for-__delay.patch
  make-sure-nobodys-leaking-resources.patch
  releasing-resources-with-children.patch
  mutex-subsystem-synchro-test-module.patch
  kernel-forkc-export-kernel_thread-to-modules.patch
  workaround-for-a-pci-restoring-bug.patch


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-16-22-52 uploaded (net: IPVS)
  2020-07-17  5:53 ` mmotm 2020-07-16-22-52 uploaded Andrew Morton
@ 2020-07-17 15:30   ` Randy Dunlap
  2020-07-18  1:27     ` Stephen Rothwell
  2020-07-17 15:35   ` mmotm 2020-07-16-22-52 uploaded (mm/hugetlb.c) Randy Dunlap
  1 sibling, 1 reply; 203+ messages in thread
From: Randy Dunlap @ 2020-07-17 15:30 UTC (permalink / raw)
  To: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, sfr, netdev, Wensong Zhang,
	Simon Horman, Julian Anastasov, lvs-devel

On 7/16/20 10:53 PM, Andrew Morton wrote:
> The mm-of-the-moment snapshot 2020-07-16-22-52 has been uploaded to
> 
>    http://www.ozlabs.org/~akpm/mmotm/
> 
> mmotm-readme.txt says
> 
> README for mm-of-the-moment:
> 
> http://www.ozlabs.org/~akpm/mmotm/
> 
> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
> more than once a week.
> 

(also in linux-next)

Many of these errors:

In file included from ../net/netfilter/ipvs/ip_vs_conn.c:37:0:
../include/net/ip_vs.h: In function ‘ip_vs_enqueue_expire_nodest_conns’:
../include/net/ip_vs.h:1536:61: error: parameter name omitted
 static inline void ip_vs_enqueue_expire_nodest_conns(struct netns_ipvs) {}
                                                             ^~~~~~~~~~


-- 
~Randy
Reported-by: Randy Dunlap <rdunlap@infradead.org>


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-16-22-52 uploaded (mm/hugetlb.c)
  2020-07-17  5:53 ` mmotm 2020-07-16-22-52 uploaded Andrew Morton
  2020-07-17 15:30   ` mmotm 2020-07-16-22-52 uploaded (net: IPVS) Randy Dunlap
@ 2020-07-17 15:35   ` Randy Dunlap
  2020-07-18  1:32     ` Stephen Rothwell
  1 sibling, 1 reply; 203+ messages in thread
From: Randy Dunlap @ 2020-07-17 15:35 UTC (permalink / raw)
  To: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, sfr

[-- Attachment #1: Type: text/plain, Size: 1256 bytes --]

On 7/16/20 10:53 PM, Andrew Morton wrote:
> The mm-of-the-moment snapshot 2020-07-16-22-52 has been uploaded to
> 
>    http://www.ozlabs.org/~akpm/mmotm/
> 
> mmotm-readme.txt says
> 
> README for mm-of-the-moment:
> 
> http://www.ozlabs.org/~akpm/mmotm/
> 
> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
> more than once a week.
> 

on i386:
6 of 10 builds failed with:

../mm/hugetlb.c:1302:20: error: redefinition of ‘destroy_compound_gigantic_page’
 static inline void destroy_compound_gigantic_page(struct hstate *h,
                    ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../mm/hugetlb.c:1223:13: note: previous definition of ‘destroy_compound_gigantic_page’ was here
 static void destroy_compound_gigantic_page(struct hstate *h, struct page *page,
             ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~


../mm/hugetlb.c:1223:13: warning: ‘destroy_compound_gigantic_page’ defined but not used [-Wunused-function]
../mm/hugetlb.c:50:20: warning: ‘hugetlb_cma’ defined but not used [-Wunused-variable]
 static struct cma *hugetlb_cma[MAX_NUMNODES];
                    ^~~~~~~~~~~


One failing randconfig file is attached.

-- 
~Randy
Reported-by: Randy Dunlap <rdunlap@infradead.org>

[-- Attachment #2: config-r4013 --]
[-- Type: text/plain, Size: 110445 bytes --]

#
# Automatically generated file; DO NOT EDIT.
# Linux/i386 5.8.0-rc5-mm1 Kernel Configuration
#
CONFIG_CC_VERSION_TEXT="gcc (SUSE Linux) 7.5.0"
CONFIG_CC_IS_GCC=y
CONFIG_GCC_VERSION=70500
CONFIG_LD_VERSION=232000000
CONFIG_CLANG_VERSION=0
CONFIG_CC_HAS_ASM_GOTO=y
CONFIG_CC_HAS_ASM_INLINE=y
CONFIG_IRQ_WORK=y
CONFIG_BUILDTIME_TABLE_SORT=y
CONFIG_THREAD_INFO_IN_TASK=y

#
# General setup
#
CONFIG_BROKEN_ON_SMP=y
CONFIG_INIT_ENV_ARG_LIMIT=32
# CONFIG_COMPILE_TEST is not set
CONFIG_LOCALVERSION=""
# CONFIG_LOCALVERSION_AUTO is not set
CONFIG_BUILD_SALT=""
CONFIG_HAVE_KERNEL_GZIP=y
CONFIG_HAVE_KERNEL_BZIP2=y
CONFIG_HAVE_KERNEL_LZMA=y
CONFIG_HAVE_KERNEL_XZ=y
CONFIG_HAVE_KERNEL_LZO=y
CONFIG_HAVE_KERNEL_LZ4=y
# CONFIG_KERNEL_GZIP is not set
# CONFIG_KERNEL_BZIP2 is not set
# CONFIG_KERNEL_LZMA is not set
# CONFIG_KERNEL_XZ is not set
CONFIG_KERNEL_LZO=y
# CONFIG_KERNEL_LZ4 is not set
CONFIG_DEFAULT_INIT=""
CONFIG_DEFAULT_HOSTNAME="(none)"
# CONFIG_SWAP is not set
CONFIG_SYSVIPC=y
CONFIG_SYSVIPC_SYSCTL=y
CONFIG_WATCH_QUEUE=y
CONFIG_CROSS_MEMORY_ATTACH=y
CONFIG_USELIB=y
CONFIG_HAVE_ARCH_AUDITSYSCALL=y

#
# IRQ subsystem
#
CONFIG_GENERIC_IRQ_PROBE=y
CONFIG_GENERIC_IRQ_SHOW=y
CONFIG_HARDIRQS_SW_RESEND=y
CONFIG_GENERIC_IRQ_CHIP=y
CONFIG_IRQ_DOMAIN=y
CONFIG_IRQ_DOMAIN_HIERARCHY=y
CONFIG_GENERIC_IRQ_MATRIX_ALLOCATOR=y
CONFIG_GENERIC_IRQ_RESERVATION_MODE=y
CONFIG_IRQ_FORCED_THREADING=y
CONFIG_SPARSE_IRQ=y
# CONFIG_GENERIC_IRQ_DEBUGFS is not set
# end of IRQ subsystem

CONFIG_CLOCKSOURCE_WATCHDOG=y
CONFIG_ARCH_CLOCKSOURCE_INIT=y
CONFIG_CLOCKSOURCE_VALIDATE_LAST_CYCLE=y
CONFIG_GENERIC_TIME_VSYSCALL=y
CONFIG_GENERIC_CLOCKEVENTS=y
CONFIG_GENERIC_CLOCKEVENTS_BROADCAST=y
CONFIG_GENERIC_CLOCKEVENTS_MIN_ADJUST=y
CONFIG_GENERIC_CMOS_UPDATE=y

#
# Timers subsystem
#
CONFIG_TICK_ONESHOT=y
CONFIG_HZ_PERIODIC=y
# CONFIG_NO_HZ_IDLE is not set
# CONFIG_NO_HZ is not set
CONFIG_HIGH_RES_TIMERS=y
# end of Timers subsystem

# CONFIG_PREEMPT_NONE is not set
# CONFIG_PREEMPT_VOLUNTARY is not set
CONFIG_PREEMPT=y
CONFIG_PREEMPT_COUNT=y
CONFIG_PREEMPTION=y

#
# CPU/Task time and stats accounting
#
CONFIG_TICK_CPU_ACCOUNTING=y
CONFIG_IRQ_TIME_ACCOUNTING=y
CONFIG_BSD_PROCESS_ACCT=y
# CONFIG_BSD_PROCESS_ACCT_V3 is not set
# CONFIG_PSI is not set
# end of CPU/Task time and stats accounting

#
# RCU Subsystem
#
CONFIG_TREE_RCU=y
CONFIG_PREEMPT_RCU=y
CONFIG_RCU_EXPERT=y
CONFIG_SRCU=y
CONFIG_TREE_SRCU=y
CONFIG_TASKS_RCU_GENERIC=y
CONFIG_TASKS_RCU=y
CONFIG_RCU_STALL_COMMON=y
CONFIG_RCU_NEED_SEGCBLIST=y
CONFIG_RCU_FANOUT=32
CONFIG_RCU_FANOUT_LEAF=16
CONFIG_RCU_BOOST=y
CONFIG_RCU_BOOST_DELAY=500
CONFIG_RCU_NOCB_CPU=y
CONFIG_TASKS_TRACE_RCU_READ_MB=y
# end of RCU Subsystem

CONFIG_IKCONFIG=y
CONFIG_IKCONFIG_PROC=y
# CONFIG_IKHEADERS is not set
CONFIG_LOG_BUF_SHIFT=17
CONFIG_PRINTK_SAFE_LOG_BUF_SHIFT=13
CONFIG_HAVE_UNSTABLE_SCHED_CLOCK=y

#
# Scheduler features
#
# end of Scheduler features

CONFIG_ARCH_WANT_BATCHED_UNMAP_TLB_FLUSH=y
# CONFIG_CGROUPS is not set
CONFIG_NAMESPACES=y
CONFIG_UTS_NS=y
CONFIG_TIME_NS=y
# CONFIG_IPC_NS is not set
# CONFIG_USER_NS is not set
# CONFIG_PID_NS is not set
# CONFIG_CHECKPOINT_RESTORE is not set
# CONFIG_SCHED_AUTOGROUP is not set
# CONFIG_SYSFS_DEPRECATED is not set
CONFIG_RELAY=y
CONFIG_BLK_DEV_INITRD=y
CONFIG_INITRAMFS_SOURCE=""
# CONFIG_RD_GZIP is not set
CONFIG_RD_BZIP2=y
# CONFIG_RD_LZMA is not set
CONFIG_RD_XZ=y
# CONFIG_RD_LZO is not set
# CONFIG_RD_LZ4 is not set
# CONFIG_BOOT_CONFIG is not set
# CONFIG_CC_OPTIMIZE_FOR_PERFORMANCE is not set
CONFIG_CC_OPTIMIZE_FOR_SIZE=y
CONFIG_SYSCTL=y
CONFIG_HAVE_UID16=y
CONFIG_SYSCTL_EXCEPTION_TRACE=y
CONFIG_HAVE_PCSPKR_PLATFORM=y
# CONFIG_EXPERT is not set
CONFIG_UID16=y
CONFIG_MULTIUSER=y
CONFIG_SGETMASK_SYSCALL=y
CONFIG_SYSFS_SYSCALL=y
CONFIG_FHANDLE=y
CONFIG_POSIX_TIMERS=y
CONFIG_PRINTK=y
CONFIG_PRINTK_NMI=y
CONFIG_BUG=y
CONFIG_ELF_CORE=y
CONFIG_PCSPKR_PLATFORM=y
CONFIG_BASE_FULL=y
CONFIG_FUTEX=y
CONFIG_FUTEX_PI=y
CONFIG_EPOLL=y
CONFIG_SIGNALFD=y
CONFIG_TIMERFD=y
CONFIG_EVENTFD=y
CONFIG_SHMEM=y
CONFIG_AIO=y
CONFIG_IO_URING=y
CONFIG_ADVISE_SYSCALLS=y
CONFIG_MEMBARRIER=y
CONFIG_KALLSYMS=y
CONFIG_KALLSYMS_BASE_RELATIVE=y
# CONFIG_BPF_SYSCALL is not set
CONFIG_USERFAULTFD=y
CONFIG_ARCH_HAS_MEMBARRIER_SYNC_CORE=y
CONFIG_RSEQ=y
# CONFIG_EMBEDDED is not set
CONFIG_HAVE_PERF_EVENTS=y

#
# Kernel Performance Events And Counters
#
CONFIG_PERF_EVENTS=y
# end of Kernel Performance Events And Counters

CONFIG_VM_EVENT_COUNTERS=y
CONFIG_SLUB_DEBUG=y
CONFIG_COMPAT_BRK=y
# CONFIG_SLAB is not set
CONFIG_SLUB=y
CONFIG_SLAB_MERGE_DEFAULT=y
CONFIG_SLAB_FREELIST_RANDOM=y
CONFIG_SLAB_FREELIST_HARDENED=y
CONFIG_SHUFFLE_PAGE_ALLOCATOR=y
# CONFIG_PROFILING is not set
# end of General setup

CONFIG_X86_32=y
CONFIG_X86=y
CONFIG_INSTRUCTION_DECODER=y
CONFIG_OUTPUT_FORMAT="elf32-i386"
CONFIG_LOCKDEP_SUPPORT=y
CONFIG_STACKTRACE_SUPPORT=y
CONFIG_MMU=y
CONFIG_ARCH_MMAP_RND_BITS_MIN=8
CONFIG_ARCH_MMAP_RND_BITS_MAX=16
CONFIG_ARCH_MMAP_RND_COMPAT_BITS_MIN=8
CONFIG_ARCH_MMAP_RND_COMPAT_BITS_MAX=16
CONFIG_GENERIC_ISA_DMA=y
CONFIG_GENERIC_BUG=y
CONFIG_ARCH_MAY_HAVE_PC_FDC=y
CONFIG_GENERIC_CALIBRATE_DELAY=y
CONFIG_ARCH_HAS_CPU_RELAX=y
CONFIG_ARCH_HAS_CACHE_LINE_SIZE=y
CONFIG_ARCH_HAS_FILTER_PGPROT=y
CONFIG_HAVE_SETUP_PER_CPU_AREA=y
CONFIG_NEED_PER_CPU_EMBED_FIRST_CHUNK=y
CONFIG_NEED_PER_CPU_PAGE_FIRST_CHUNK=y
CONFIG_ARCH_HIBERNATION_POSSIBLE=y
CONFIG_ARCH_SUSPEND_POSSIBLE=y
CONFIG_ARCH_WANT_GENERAL_HUGETLB=y
CONFIG_ARCH_SUPPORTS_DEBUG_PAGEALLOC=y
CONFIG_ARCH_SUPPORTS_UPROBES=y
CONFIG_FIX_EARLYCON_MEM=y
CONFIG_PGTABLE_LEVELS=3
CONFIG_CC_HAS_SANE_STACKPROTECTOR=y

#
# Processor type and features
#
CONFIG_ZONE_DMA=y
# CONFIG_SMP is not set
CONFIG_X86_FEATURE_NAMES=y
CONFIG_X86_MPPARSE=y
CONFIG_GOLDFISH=y
CONFIG_RETPOLINE=y
CONFIG_X86_CPU_RESCTRL=y
# CONFIG_X86_EXTENDED_PLATFORM is not set
# CONFIG_X86_32_IRIS is not set
# CONFIG_SCHED_OMIT_FRAME_POINTER is not set
CONFIG_HYPERVISOR_GUEST=y
CONFIG_PARAVIRT=y
CONFIG_X86_HV_CALLBACK_VECTOR=y
CONFIG_KVM_GUEST=y
CONFIG_ARCH_CPUIDLE_HALTPOLL=y
# CONFIG_PVH is not set
CONFIG_PARAVIRT_TIME_ACCOUNTING=y
CONFIG_PARAVIRT_CLOCK=y
# CONFIG_M486SX is not set
CONFIG_M486=y
# CONFIG_M586 is not set
# CONFIG_M586TSC is not set
# CONFIG_M586MMX is not set
# CONFIG_M686 is not set
# CONFIG_MPENTIUMII is not set
# CONFIG_MPENTIUMIII is not set
# CONFIG_MPENTIUMM is not set
# CONFIG_MPENTIUM4 is not set
# CONFIG_MK6 is not set
# CONFIG_MK7 is not set
# CONFIG_MK8 is not set
# CONFIG_MCRUSOE is not set
# CONFIG_MEFFICEON is not set
# CONFIG_MWINCHIPC6 is not set
# CONFIG_MWINCHIP3D is not set
# CONFIG_MELAN is not set
# CONFIG_MGEODEGX1 is not set
# CONFIG_MGEODE_LX is not set
# CONFIG_MCYRIXIII is not set
# CONFIG_MVIAC3_2 is not set
# CONFIG_MVIAC7 is not set
# CONFIG_MCORE2 is not set
# CONFIG_MATOM is not set
CONFIG_X86_GENERIC=y
CONFIG_X86_INTERNODE_CACHE_SHIFT=6
CONFIG_X86_L1_CACHE_SHIFT=6
CONFIG_X86_F00F_BUG=y
CONFIG_X86_INVD_BUG=y
CONFIG_X86_ALIGNMENT_16=y
CONFIG_X86_INTEL_USERCOPY=y
CONFIG_X86_CMPXCHG64=y
CONFIG_X86_MINIMUM_CPU_FAMILY=5
CONFIG_IA32_FEAT_CTL=y
CONFIG_X86_VMX_FEATURE_NAMES=y
CONFIG_CPU_SUP_INTEL=y
CONFIG_CPU_SUP_CYRIX_32=y
CONFIG_CPU_SUP_AMD=y
CONFIG_CPU_SUP_HYGON=y
CONFIG_CPU_SUP_CENTAUR=y
CONFIG_CPU_SUP_TRANSMETA_32=y
CONFIG_CPU_SUP_UMC_32=y
CONFIG_CPU_SUP_ZHAOXIN=y
CONFIG_HPET_TIMER=y
CONFIG_DMI=y
CONFIG_NR_CPUS_RANGE_BEGIN=1
CONFIG_NR_CPUS_RANGE_END=1
CONFIG_NR_CPUS_DEFAULT=1
CONFIG_NR_CPUS=1
CONFIG_UP_LATE_INIT=y
CONFIG_X86_UP_APIC=y
CONFIG_X86_UP_IOAPIC=y
CONFIG_X86_LOCAL_APIC=y
CONFIG_X86_IO_APIC=y
CONFIG_X86_REROUTE_FOR_BROKEN_BOOT_IRQS=y
# CONFIG_X86_MCE is not set

#
# Performance monitoring
#
CONFIG_PERF_EVENTS_AMD_POWER=m
# end of Performance monitoring

CONFIG_X86_LEGACY_VM86=y
CONFIG_VM86=y
CONFIG_X86_16BIT=y
CONFIG_X86_ESPFIX32=y
# CONFIG_X86_IOPL_IOPERM is not set
CONFIG_TOSHIBA=m
CONFIG_I8K=y
# CONFIG_X86_REBOOTFIXUPS is not set
# CONFIG_MICROCODE is not set
CONFIG_X86_MSR=m
CONFIG_X86_CPUID=m
CONFIG_NOHIGHMEM=y
# CONFIG_HIGHMEM4G is not set
CONFIG_PAGE_OFFSET=0xC0000000
CONFIG_X86_PAE=y
# CONFIG_X86_CPA_STATISTICS is not set
CONFIG_ARCH_FLATMEM_ENABLE=y
CONFIG_ARCH_SPARSEMEM_ENABLE=y
CONFIG_ARCH_SELECT_MEMORY_MODEL=y
CONFIG_ILLEGAL_POINTER_VALUE=0
# CONFIG_X86_CHECK_BIOS_CORRUPTION is not set
CONFIG_X86_RESERVE_LOW=64
CONFIG_MTRR=y
# CONFIG_MTRR_SANITIZER is not set
CONFIG_X86_PAT=y
CONFIG_ARCH_USES_PG_UNCACHED=y
CONFIG_ARCH_RANDOM=y
CONFIG_X86_SMAP=y
CONFIG_X86_UMIP=y
# CONFIG_X86_INTEL_TSX_MODE_OFF is not set
CONFIG_X86_INTEL_TSX_MODE_ON=y
# CONFIG_X86_INTEL_TSX_MODE_AUTO is not set
# CONFIG_SECCOMP is not set
# CONFIG_HZ_100 is not set
# CONFIG_HZ_250 is not set
CONFIG_HZ_300=y
# CONFIG_HZ_1000 is not set
CONFIG_HZ=300
CONFIG_SCHED_HRTICK=y
CONFIG_KEXEC=y
CONFIG_PHYSICAL_START=0x1000000
# CONFIG_RELOCATABLE is not set
CONFIG_PHYSICAL_ALIGN=0x200000
# CONFIG_COMPAT_VDSO is not set
# CONFIG_CMDLINE_BOOL is not set
CONFIG_MODIFY_LDT_SYSCALL=y
# end of Processor type and features

CONFIG_ARCH_ENABLE_SPLIT_PMD_PTLOCK=y

#
# Power management and ACPI options
#
CONFIG_SUSPEND=y
CONFIG_SUSPEND_FREEZER=y
CONFIG_PM_SLEEP=y
# CONFIG_PM_AUTOSLEEP is not set
CONFIG_PM_WAKELOCKS=y
CONFIG_PM_WAKELOCKS_LIMIT=100
CONFIG_PM_WAKELOCKS_GC=y
CONFIG_PM=y
# CONFIG_PM_DEBUG is not set
CONFIG_PM_CLK=y
CONFIG_WQ_POWER_EFFICIENT_DEFAULT=y
CONFIG_ARCH_SUPPORTS_ACPI=y
# CONFIG_ACPI is not set
# CONFIG_SFI is not set
CONFIG_X86_APM_BOOT=y
CONFIG_APM=m
# CONFIG_APM_IGNORE_USER_SUSPEND is not set
CONFIG_APM_DO_ENABLE=y
CONFIG_APM_CPU_IDLE=y
# CONFIG_APM_DISPLAY_BLANK is not set
CONFIG_APM_ALLOW_INTS=y

#
# CPU Frequency scaling
#
CONFIG_CPU_FREQ=y
CONFIG_CPU_FREQ_GOV_ATTR_SET=y
CONFIG_CPU_FREQ_GOV_COMMON=y
CONFIG_CPU_FREQ_STAT=y
CONFIG_CPU_FREQ_DEFAULT_GOV_PERFORMANCE=y
# CONFIG_CPU_FREQ_DEFAULT_GOV_POWERSAVE is not set
# CONFIG_CPU_FREQ_DEFAULT_GOV_USERSPACE is not set
# CONFIG_CPU_FREQ_DEFAULT_GOV_ONDEMAND is not set
# CONFIG_CPU_FREQ_DEFAULT_GOV_CONSERVATIVE is not set
CONFIG_CPU_FREQ_GOV_PERFORMANCE=y
# CONFIG_CPU_FREQ_GOV_POWERSAVE is not set
CONFIG_CPU_FREQ_GOV_USERSPACE=y
CONFIG_CPU_FREQ_GOV_ONDEMAND=y
# CONFIG_CPU_FREQ_GOV_CONSERVATIVE is not set

#
# CPU frequency scaling drivers
#
CONFIG_CPUFREQ_DT=m
CONFIG_CPUFREQ_DT_PLATDEV=y
CONFIG_X86_INTEL_PSTATE=y
CONFIG_X86_POWERNOW_K6=y
CONFIG_X86_POWERNOW_K7=y
# CONFIG_X86_SPEEDSTEP_CENTRINO is not set
CONFIG_X86_SPEEDSTEP_ICH=y
# CONFIG_X86_SPEEDSTEP_SMI is not set
CONFIG_X86_P4_CLOCKMOD=y
CONFIG_X86_CPUFREQ_NFORCE2=y
# CONFIG_X86_LONGRUN is not set

#
# shared options
#
CONFIG_X86_SPEEDSTEP_LIB=y
# CONFIG_X86_SPEEDSTEP_RELAXED_CAP_CHECK is not set
# end of CPU Frequency scaling

#
# CPU Idle
#
CONFIG_CPU_IDLE=y
CONFIG_CPU_IDLE_GOV_LADDER=y
# CONFIG_CPU_IDLE_GOV_MENU is not set
# CONFIG_CPU_IDLE_GOV_TEO is not set
# CONFIG_CPU_IDLE_GOV_HALTPOLL is not set
# CONFIG_HALTPOLL_CPUIDLE is not set
# end of CPU Idle

CONFIG_INTEL_IDLE=y
# end of Power management and ACPI options

#
# Bus options (PCI etc.)
#
CONFIG_ISA_DMA_API=y
# CONFIG_ISA is not set
# CONFIG_SCx200 is not set
CONFIG_ALIX=y
CONFIG_NET5501=y
# CONFIG_GEOS is not set
# CONFIG_X86_SYSFB is not set
# end of Bus options (PCI etc.)

#
# Binary Emulations
#
CONFIG_COMPAT_32=y
# end of Binary Emulations

CONFIG_HAVE_ATOMIC_IOMAP=y

#
# Firmware Drivers
#
CONFIG_EDD=y
CONFIG_EDD_OFF=y
CONFIG_FIRMWARE_MEMMAP=y
# CONFIG_DMIID is not set
# CONFIG_DMI_SYSFS is not set
CONFIG_DMI_SCAN_MACHINE_NON_EFI_FALLBACK=y
CONFIG_FW_CFG_SYSFS=m
# CONFIG_FW_CFG_SYSFS_CMDLINE is not set
# CONFIG_GOOGLE_FIRMWARE is not set
CONFIG_EFI_EARLYCON=y

#
# Tegra firmware driver
#
# end of Tegra firmware driver
# end of Firmware Drivers

CONFIG_HAVE_KVM=y
# CONFIG_VIRTUALIZATION is not set
CONFIG_AS_AVX512=y
CONFIG_AS_SHA1_NI=y
CONFIG_AS_SHA256_NI=y
CONFIG_AS_TPAUSE=y

#
# General architecture-dependent options
#
CONFIG_CRASH_CORE=y
CONFIG_KEXEC_CORE=y
CONFIG_HAVE_OPROFILE=y
CONFIG_OPROFILE_NMI_TIMER=y
CONFIG_KPROBES=y
# CONFIG_JUMP_LABEL is not set
CONFIG_OPTPROBES=y
CONFIG_HAVE_EFFICIENT_UNALIGNED_ACCESS=y
CONFIG_ARCH_USE_BUILTIN_BSWAP=y
CONFIG_KRETPROBES=y
CONFIG_HAVE_IOREMAP_PROT=y
CONFIG_HAVE_KPROBES=y
CONFIG_HAVE_KRETPROBES=y
CONFIG_HAVE_OPTPROBES=y
CONFIG_HAVE_KPROBES_ON_FTRACE=y
CONFIG_HAVE_FUNCTION_ERROR_INJECTION=y
CONFIG_HAVE_NMI=y
CONFIG_HAVE_ARCH_TRACEHOOK=y
CONFIG_HAVE_DMA_CONTIGUOUS=y
CONFIG_GENERIC_SMP_IDLE_THREAD=y
CONFIG_ARCH_HAS_FORTIFY_SOURCE=y
CONFIG_ARCH_HAS_SET_MEMORY=y
CONFIG_ARCH_HAS_SET_DIRECT_MAP=y
CONFIG_HAVE_ARCH_THREAD_STRUCT_WHITELIST=y
CONFIG_ARCH_WANTS_DYNAMIC_TASK_STRUCT=y
CONFIG_ARCH_32BIT_OFF_T=y
CONFIG_HAVE_ASM_MODVERSIONS=y
CONFIG_HAVE_REGS_AND_STACK_ACCESS_API=y
CONFIG_HAVE_RSEQ=y
CONFIG_HAVE_FUNCTION_ARG_ACCESS_API=y
CONFIG_HAVE_HW_BREAKPOINT=y
CONFIG_HAVE_MIXED_BREAKPOINTS_REGS=y
CONFIG_HAVE_USER_RETURN_NOTIFIER=y
CONFIG_HAVE_PERF_EVENTS_NMI=y
CONFIG_HAVE_HARDLOCKUP_DETECTOR_PERF=y
CONFIG_HAVE_PERF_REGS=y
CONFIG_HAVE_PERF_USER_STACK_DUMP=y
CONFIG_HAVE_ARCH_JUMP_LABEL=y
CONFIG_HAVE_ARCH_JUMP_LABEL_RELATIVE=y
CONFIG_MMU_GATHER_TABLE_FREE=y
CONFIG_MMU_GATHER_RCU_TABLE_FREE=y
CONFIG_ARCH_HAVE_NMI_SAFE_CMPXCHG=y
CONFIG_HAVE_ALIGNED_STRUCT_PAGE=y
CONFIG_HAVE_CMPXCHG_LOCAL=y
CONFIG_HAVE_CMPXCHG_DOUBLE=y
CONFIG_ARCH_WANT_IPC_PARSE_VERSION=y
CONFIG_HAVE_ARCH_SECCOMP_FILTER=y
CONFIG_HAVE_ARCH_STACKLEAK=y
CONFIG_HAVE_STACKPROTECTOR=y
CONFIG_STACKPROTECTOR=y
# CONFIG_STACKPROTECTOR_STRONG is not set
CONFIG_HAVE_ARCH_WITHIN_STACK_FRAMES=y
CONFIG_HAVE_IRQ_TIME_ACCOUNTING=y
CONFIG_HAVE_MOVE_PMD=y
CONFIG_HAVE_ARCH_TRANSPARENT_HUGEPAGE=y
CONFIG_HAVE_ARCH_HUGE_VMAP=y
CONFIG_ARCH_WANT_HUGE_PMD_SHARE=y
CONFIG_HAVE_MOD_ARCH_SPECIFIC=y
CONFIG_MODULES_USE_ELF_REL=y
CONFIG_ARCH_HAS_ELF_RANDOMIZE=y
CONFIG_HAVE_ARCH_MMAP_RND_BITS=y
CONFIG_HAVE_EXIT_THREAD=y
CONFIG_ARCH_MMAP_RND_BITS=8
CONFIG_ISA_BUS_API=y
CONFIG_CLONE_BACKWARDS=y
CONFIG_OLD_SIGSUSPEND3=y
CONFIG_OLD_SIGACTION=y
# CONFIG_COMPAT_32BIT_TIME is not set
CONFIG_ARCH_HAS_STRICT_KERNEL_RWX=y
CONFIG_STRICT_KERNEL_RWX=y
CONFIG_ARCH_HAS_STRICT_MODULE_RWX=y
CONFIG_STRICT_MODULE_RWX=y
CONFIG_HAVE_ARCH_PREL32_RELOCATIONS=y
CONFIG_ARCH_USE_MEMREMAP_PROT=y
# CONFIG_LOCK_EVENT_COUNTS is not set
CONFIG_ARCH_HAS_MEM_ENCRYPT=y

#
# GCOV-based kernel profiling
#
# CONFIG_GCOV_KERNEL is not set
CONFIG_ARCH_HAS_GCOV_PROFILE_ALL=y
# end of GCOV-based kernel profiling

CONFIG_HAVE_GCC_PLUGINS=y
# end of General architecture-dependent options

CONFIG_RT_MUTEXES=y
CONFIG_BASE_SMALL=0
CONFIG_MODULES=y
# CONFIG_MODULE_FORCE_LOAD is not set
# CONFIG_MODULE_UNLOAD is not set
# CONFIG_MODVERSIONS is not set
# CONFIG_MODULE_SRCVERSION_ALL is not set
# CONFIG_MODULE_SIG is not set
# CONFIG_MODULE_COMPRESS is not set
CONFIG_MODULE_ALLOW_MISSING_NAMESPACE_IMPORTS=y
# CONFIG_UNUSED_SYMBOLS is not set
CONFIG_TRIM_UNUSED_KSYMS=y
CONFIG_UNUSED_KSYMS_WHITELIST=""
CONFIG_MODULES_TREE_LOOKUP=y
CONFIG_BLOCK=y
CONFIG_BLK_SCSI_REQUEST=y
CONFIG_BLK_DEV_BSG=y
CONFIG_BLK_DEV_BSGLIB=y
# CONFIG_BLK_DEV_INTEGRITY is not set
CONFIG_BLK_DEV_ZONED=y
CONFIG_BLK_CMDLINE_PARSER=y
CONFIG_BLK_WBT=y
CONFIG_BLK_WBT_MQ=y
CONFIG_BLK_DEBUG_FS=y
CONFIG_BLK_DEBUG_FS_ZONED=y
CONFIG_BLK_SED_OPAL=y
CONFIG_BLK_INLINE_ENCRYPTION=y
CONFIG_BLK_INLINE_ENCRYPTION_FALLBACK=y

#
# Partition Types
#
CONFIG_PARTITION_ADVANCED=y
CONFIG_ACORN_PARTITION=y
# CONFIG_ACORN_PARTITION_CUMANA is not set
CONFIG_ACORN_PARTITION_EESOX=y
# CONFIG_ACORN_PARTITION_ICS is not set
CONFIG_ACORN_PARTITION_ADFS=y
CONFIG_ACORN_PARTITION_POWERTEC=y
CONFIG_ACORN_PARTITION_RISCIX=y
CONFIG_AIX_PARTITION=y
CONFIG_OSF_PARTITION=y
# CONFIG_AMIGA_PARTITION is not set
# CONFIG_ATARI_PARTITION is not set
# CONFIG_MAC_PARTITION is not set
# CONFIG_MSDOS_PARTITION is not set
# CONFIG_LDM_PARTITION is not set
CONFIG_SGI_PARTITION=y
# CONFIG_ULTRIX_PARTITION is not set
CONFIG_SUN_PARTITION=y
CONFIG_KARMA_PARTITION=y
CONFIG_EFI_PARTITION=y
CONFIG_SYSV68_PARTITION=y
# CONFIG_CMDLINE_PARTITION is not set
# end of Partition Types

CONFIG_BLK_MQ_VIRTIO=y
CONFIG_BLK_PM=y

#
# IO Schedulers
#
CONFIG_MQ_IOSCHED_DEADLINE=y
CONFIG_MQ_IOSCHED_KYBER=m
CONFIG_IOSCHED_BFQ=m
# end of IO Schedulers

CONFIG_ASN1=y
CONFIG_UNINLINE_SPIN_UNLOCK=y
CONFIG_ARCH_SUPPORTS_ATOMIC_RMW=y
CONFIG_ARCH_USE_QUEUED_SPINLOCKS=y
CONFIG_ARCH_USE_QUEUED_RWLOCKS=y
CONFIG_ARCH_HAS_NON_OVERLAPPING_ADDRESS_SPACE=y
CONFIG_ARCH_HAS_SYNC_CORE_BEFORE_USERMODE=y
CONFIG_ARCH_HAS_SYSCALL_WRAPPER=y
CONFIG_FREEZER=y

#
# Executable file formats
#
# CONFIG_BINFMT_ELF is not set
CONFIG_BINFMT_SCRIPT=m
# CONFIG_BINFMT_MISC is not set
CONFIG_COREDUMP=y
# end of Executable file formats

#
# Memory Management options
#
CONFIG_SELECT_MEMORY_MODEL=y
# CONFIG_FLATMEM_MANUAL is not set
CONFIG_SPARSEMEM_MANUAL=y
CONFIG_SPARSEMEM=y
CONFIG_SPARSEMEM_STATIC=y
CONFIG_HAVE_FAST_GUP=y
CONFIG_SPLIT_PTLOCK_CPUS=4
CONFIG_COMPACTION=y
CONFIG_PAGE_REPORTING=y
CONFIG_MIGRATION=y
CONFIG_PHYS_ADDR_T_64BIT=y
CONFIG_BOUNCE=y
CONFIG_VIRT_TO_BUS=y
CONFIG_KSM=y
CONFIG_DEFAULT_MMAP_MIN_ADDR=4096
CONFIG_TRANSPARENT_HUGEPAGE=y
CONFIG_TRANSPARENT_HUGEPAGE_ALWAYS=y
# CONFIG_TRANSPARENT_HUGEPAGE_MADVISE is not set
CONFIG_NEED_PER_CPU_KM=y
CONFIG_CLEANCACHE=y
# CONFIG_CMA is not set
# CONFIG_ZPOOL is not set
CONFIG_ZBUD=y
# CONFIG_ZSMALLOC is not set
CONFIG_GENERIC_EARLY_IOREMAP=y
CONFIG_IDLE_PAGE_TRACKING=y
CONFIG_FRAME_VECTOR=y
CONFIG_PERCPU_STATS=y
# CONFIG_GUP_BENCHMARK is not set
CONFIG_GUP_GET_PTE_LOW_HIGH=y
CONFIG_READ_ONLY_THP_FOR_FS=y
CONFIG_ARCH_HAS_PTE_SPECIAL=y
# end of Memory Management options

# CONFIG_NET is not set
CONFIG_HAVE_EBPF_JIT=y

#
# Device Drivers
#
CONFIG_HAVE_EISA=y
# CONFIG_EISA is not set
CONFIG_HAVE_PCI=y
# CONFIG_PCI is not set
CONFIG_PCCARD=m
CONFIG_PCMCIA=m
# CONFIG_PCMCIA_LOAD_CIS is not set

#
# PC-card bridges
#

#
# Generic Driver Options
#
# CONFIG_UEVENT_HELPER is not set
CONFIG_DEVTMPFS=y
CONFIG_DEVTMPFS_MOUNT=y
CONFIG_STANDALONE=y
CONFIG_PREVENT_FIRMWARE_BUILD=y

#
# Firmware loader
#
CONFIG_FW_LOADER=y
CONFIG_FW_LOADER_PAGED_BUF=y
CONFIG_EXTRA_FIRMWARE=""
CONFIG_FW_LOADER_USER_HELPER=y
# CONFIG_FW_LOADER_USER_HELPER_FALLBACK is not set
# CONFIG_FW_LOADER_COMPRESS is not set
# CONFIG_FW_CACHE is not set
# end of Firmware loader

CONFIG_ALLOW_DEV_COREDUMP=y
CONFIG_PM_QOS_KUNIT_TEST=y
CONFIG_TEST_ASYNC_DRIVER_PROBE=m
CONFIG_KUNIT_DRIVER_PE_TEST=y
CONFIG_GENERIC_CPU_AUTOPROBE=y
CONFIG_GENERIC_CPU_VULNERABILITIES=y
CONFIG_REGMAP=y
CONFIG_REGMAP_I2C=y
CONFIG_REGMAP_W1=y
CONFIG_REGMAP_MMIO=y
CONFIG_REGMAP_IRQ=y
CONFIG_REGMAP_I3C=m
CONFIG_DMA_SHARED_BUFFER=y
# CONFIG_DMA_FENCE_TRACE is not set
# end of Generic Driver Options

#
# Bus devices
#
CONFIG_SIMPLE_PM_BUS=y
# CONFIG_MHI_BUS is not set
# end of Bus devices

# CONFIG_GNSS is not set
CONFIG_MTD=y
CONFIG_MTD_TESTS=m

#
# Partition parsers
#
CONFIG_MTD_AR7_PARTS=y
CONFIG_MTD_CMDLINE_PARTS=y
CONFIG_MTD_OF_PARTS=y
CONFIG_MTD_REDBOOT_PARTS=y
CONFIG_MTD_REDBOOT_DIRECTORY_BLOCK=-1
# CONFIG_MTD_REDBOOT_PARTS_UNALLOCATED is not set
CONFIG_MTD_REDBOOT_PARTS_READONLY=y
# end of Partition parsers

#
# User Modules And Translation Layers
#
CONFIG_MTD_BLKDEVS=y
CONFIG_MTD_BLOCK=y
CONFIG_FTL=y
CONFIG_NFTL=y
CONFIG_NFTL_RW=y
CONFIG_INFTL=m
# CONFIG_RFD_FTL is not set
CONFIG_SSFDC=m
CONFIG_SM_FTL=m
# CONFIG_MTD_OOPS is not set
CONFIG_MTD_PARTITIONED_MASTER=y

#
# RAM/ROM/Flash chip drivers
#
CONFIG_MTD_CFI=y
# CONFIG_MTD_JEDECPROBE is not set
CONFIG_MTD_GEN_PROBE=y
# CONFIG_MTD_CFI_ADV_OPTIONS is not set
CONFIG_MTD_MAP_BANK_WIDTH_1=y
CONFIG_MTD_MAP_BANK_WIDTH_2=y
CONFIG_MTD_MAP_BANK_WIDTH_4=y
CONFIG_MTD_CFI_I1=y
CONFIG_MTD_CFI_I2=y
CONFIG_MTD_CFI_INTELEXT=m
CONFIG_MTD_CFI_AMDSTD=y
CONFIG_MTD_CFI_STAA=m
CONFIG_MTD_CFI_UTIL=y
CONFIG_MTD_RAM=y
# CONFIG_MTD_ROM is not set
CONFIG_MTD_ABSENT=m
# end of RAM/ROM/Flash chip drivers

#
# Mapping drivers for chip access
#
CONFIG_MTD_COMPLEX_MAPPINGS=y
# CONFIG_MTD_PHYSMAP is not set
CONFIG_MTD_SBC_GXX=m
# CONFIG_MTD_PCMCIA is not set
CONFIG_MTD_PLATRAM=m
# end of Mapping drivers for chip access

#
# Self-contained MTD device drivers
#
# CONFIG_MTD_SLRAM is not set
CONFIG_MTD_PHRAM=m
CONFIG_MTD_MTDRAM=y
CONFIG_MTDRAM_TOTAL_SIZE=4096
CONFIG_MTDRAM_ERASE_SIZE=128
CONFIG_MTD_BLOCK2MTD=y

#
# Disk-On-Chip Device Drivers
#
CONFIG_MTD_DOCG3=y
CONFIG_BCH_CONST_M=14
CONFIG_BCH_CONST_T=4
# end of Self-contained MTD device drivers

#
# NAND
#
# CONFIG_MTD_ONENAND is not set
CONFIG_MTD_NAND_ECC_SW_HAMMING=m
# CONFIG_MTD_NAND_ECC_SW_HAMMING_SMC is not set
# CONFIG_MTD_RAW_NAND is not set
# end of NAND

#
# LPDDR & LPDDR2 PCM memory drivers
#
CONFIG_MTD_LPDDR=m
CONFIG_MTD_QINFO_PROBE=m
# end of LPDDR & LPDDR2 PCM memory drivers

CONFIG_MTD_UBI=y
CONFIG_MTD_UBI_WL_THRESHOLD=4096
CONFIG_MTD_UBI_BEB_LIMIT=20
CONFIG_MTD_UBI_FASTMAP=y
# CONFIG_MTD_UBI_GLUEBI is not set
# CONFIG_MTD_UBI_BLOCK is not set
CONFIG_MTD_HYPERBUS=y
CONFIG_DTC=y
CONFIG_OF=y
CONFIG_OF_UNITTEST=y
CONFIG_OF_FLATTREE=y
CONFIG_OF_EARLY_FLATTREE=y
CONFIG_OF_KOBJ=y
CONFIG_OF_DYNAMIC=y
CONFIG_OF_ADDRESS=y
CONFIG_OF_IRQ=y
CONFIG_OF_RESERVED_MEM=y
CONFIG_OF_RESOLVE=y
CONFIG_OF_OVERLAY=y
CONFIG_ARCH_MIGHT_HAVE_PC_PARPORT=y
CONFIG_PARPORT=m
# CONFIG_PARPORT_PC is not set
CONFIG_PARPORT_AX88796=m
CONFIG_PARPORT_1284=y
CONFIG_PARPORT_NOT_PC=y
# CONFIG_BLK_DEV is not set

#
# NVME Support
#
CONFIG_NVME_CORE=m
# CONFIG_NVME_MULTIPATH is not set
CONFIG_NVME_HWMON=y
CONFIG_NVME_FABRICS=m
# CONFIG_NVME_FC is not set
CONFIG_NVME_TARGET=m
CONFIG_NVME_TARGET_LOOP=m
CONFIG_NVME_TARGET_FC=m
# end of NVME Support

#
# Misc devices
#
CONFIG_SENSORS_LIS3LV02D=y
CONFIG_AD525X_DPOT=m
# CONFIG_AD525X_DPOT_I2C is not set
CONFIG_DUMMY_IRQ=y
CONFIG_ICS932S401=y
# CONFIG_ENCLOSURE_SERVICES is not set
CONFIG_APDS9802ALS=m
CONFIG_ISL29003=y
CONFIG_ISL29020=m
CONFIG_SENSORS_TSL2550=m
CONFIG_SENSORS_BH1770=m
# CONFIG_SENSORS_APDS990X is not set
CONFIG_HMC6352=m
# CONFIG_DS1682 is not set
CONFIG_SRAM=y
CONFIG_XILINX_SDFEC=y
CONFIG_MISC_RTSX=y
CONFIG_PVPANIC=m
# CONFIG_C2PORT is not set

#
# EEPROM support
#
# CONFIG_EEPROM_AT24 is not set
# CONFIG_EEPROM_LEGACY is not set
CONFIG_EEPROM_MAX6875=y
# CONFIG_EEPROM_93CX6 is not set
CONFIG_EEPROM_IDT_89HPESX=m
# CONFIG_EEPROM_EE1004 is not set
# end of EEPROM support

#
# Texas Instruments shared transport line discipline
#
# end of Texas Instruments shared transport line discipline

CONFIG_SENSORS_LIS3_I2C=y
# CONFIG_ALTERA_STAPL is not set

#
# Intel MIC & related support
#
# CONFIG_VOP_BUS is not set
# end of Intel MIC & related support

# CONFIG_ECHO is not set
CONFIG_MISC_RTSX_USB=y
# end of Misc devices

CONFIG_HAVE_IDE=y
# CONFIG_IDE is not set

#
# SCSI device support
#
CONFIG_SCSI_MOD=y
# CONFIG_RAID_ATTRS is not set
CONFIG_SCSI=y
CONFIG_SCSI_DMA=y
# CONFIG_SCSI_PROC_FS is not set

#
# SCSI support type (disk, tape, CD-ROM)
#
# CONFIG_BLK_DEV_SD is not set
CONFIG_CHR_DEV_ST=m
CONFIG_CHR_DEV_SG=y
CONFIG_CHR_DEV_SCH=m
# CONFIG_SCSI_CONSTANTS is not set
# CONFIG_SCSI_LOGGING is not set
CONFIG_SCSI_SCAN_ASYNC=y

#
# SCSI Transports
#
CONFIG_SCSI_SPI_ATTRS=y
CONFIG_SCSI_SAS_ATTRS=y
CONFIG_SCSI_SAS_LIBSAS=y
CONFIG_SCSI_SAS_ATA=y
CONFIG_SCSI_SAS_HOST_SMP=y
# CONFIG_SCSI_SRP_ATTRS is not set
# end of SCSI Transports

# CONFIG_SCSI_LOWLEVEL is not set
# CONFIG_SCSI_DH is not set
# end of SCSI device support

CONFIG_ATA=y
CONFIG_SATA_HOST=y
# CONFIG_ATA_VERBOSE_ERROR is not set
CONFIG_ATA_FORCE=y
# CONFIG_SATA_PMP is not set

#
# Controllers with non-SFF native interface
#
CONFIG_SATA_AHCI_PLATFORM=y
CONFIG_AHCI_CEVA=m
CONFIG_AHCI_QORIQ=m
CONFIG_ATA_SFF=y

#
# SFF controllers with custom DMA interface
#
# CONFIG_ATA_BMDMA is not set

#
# PIO-only SFF controllers
#
# CONFIG_PATA_PCMCIA is not set

#
# Generic fallback / legacy drivers
#
CONFIG_MD=y
CONFIG_BLK_DEV_MD=m
CONFIG_MD_LINEAR=m
CONFIG_MD_RAID0=m
# CONFIG_MD_RAID1 is not set
CONFIG_MD_RAID10=m
# CONFIG_MD_RAID456 is not set
CONFIG_MD_MULTIPATH=m
CONFIG_MD_FAULTY=m
CONFIG_BCACHE=m
CONFIG_BCACHE_DEBUG=y
# CONFIG_BCACHE_CLOSURES_DEBUG is not set
CONFIG_BCACHE_ASYNC_REGISTRAION=y
# CONFIG_BLK_DEV_DM is not set
CONFIG_TARGET_CORE=y
# CONFIG_TCM_IBLOCK is not set
CONFIG_TCM_FILEIO=y
CONFIG_TCM_PSCSI=y
CONFIG_LOOPBACK_TARGET=m
# CONFIG_MACINTOSH_DRIVERS is not set
# CONFIG_NVM is not set

#
# Input device support
#
CONFIG_INPUT=y
# CONFIG_INPUT_LEDS is not set
CONFIG_INPUT_FF_MEMLESS=y
# CONFIG_INPUT_POLLDEV is not set
CONFIG_INPUT_SPARSEKMAP=y
CONFIG_INPUT_MATRIXKMAP=m

#
# Userland interfaces
#
CONFIG_INPUT_MOUSEDEV=y
CONFIG_INPUT_MOUSEDEV_PSAUX=y
CONFIG_INPUT_MOUSEDEV_SCREEN_X=1024
CONFIG_INPUT_MOUSEDEV_SCREEN_Y=768
CONFIG_INPUT_JOYDEV=m
CONFIG_INPUT_EVDEV=m
CONFIG_INPUT_EVBUG=m

#
# Input Device Drivers
#
CONFIG_INPUT_KEYBOARD=y
CONFIG_KEYBOARD_ADC=m
CONFIG_KEYBOARD_ADP5520=y
CONFIG_KEYBOARD_ADP5588=y
CONFIG_KEYBOARD_ADP5589=y
CONFIG_KEYBOARD_ATKBD=y
CONFIG_KEYBOARD_QT1050=y
# CONFIG_KEYBOARD_QT1070 is not set
# CONFIG_KEYBOARD_QT2160 is not set
# CONFIG_KEYBOARD_DLINK_DIR685 is not set
CONFIG_KEYBOARD_LKKBD=m
# CONFIG_KEYBOARD_GPIO is not set
# CONFIG_KEYBOARD_GPIO_POLLED is not set
CONFIG_KEYBOARD_TCA6416=m
CONFIG_KEYBOARD_TCA8418=m
# CONFIG_KEYBOARD_MATRIX is not set
# CONFIG_KEYBOARD_LM8323 is not set
CONFIG_KEYBOARD_LM8333=m
CONFIG_KEYBOARD_MAX7359=m
# CONFIG_KEYBOARD_MCS is not set
# CONFIG_KEYBOARD_MPR121 is not set
CONFIG_KEYBOARD_NEWTON=y
CONFIG_KEYBOARD_OPENCORES=m
CONFIG_KEYBOARD_SAMSUNG=m
# CONFIG_KEYBOARD_GOLDFISH_EVENTS is not set
CONFIG_KEYBOARD_STOWAWAY=y
CONFIG_KEYBOARD_SUNKBD=y
# CONFIG_KEYBOARD_STMPE is not set
CONFIG_KEYBOARD_OMAP4=m
CONFIG_KEYBOARD_TM2_TOUCHKEY=m
CONFIG_KEYBOARD_XTKBD=m
CONFIG_KEYBOARD_CAP11XX=y
# CONFIG_KEYBOARD_BCM is not set
# CONFIG_KEYBOARD_MTK_PMIC is not set
CONFIG_INPUT_MOUSE=y
CONFIG_MOUSE_PS2=m
CONFIG_MOUSE_PS2_ALPS=y
CONFIG_MOUSE_PS2_BYD=y
CONFIG_MOUSE_PS2_LOGIPS2PP=y
CONFIG_MOUSE_PS2_SYNAPTICS=y
CONFIG_MOUSE_PS2_SYNAPTICS_SMBUS=y
CONFIG_MOUSE_PS2_CYPRESS=y
CONFIG_MOUSE_PS2_LIFEBOOK=y
CONFIG_MOUSE_PS2_TRACKPOINT=y
CONFIG_MOUSE_PS2_ELANTECH=y
CONFIG_MOUSE_PS2_ELANTECH_SMBUS=y
# CONFIG_MOUSE_PS2_SENTELIC is not set
CONFIG_MOUSE_PS2_TOUCHKIT=y
CONFIG_MOUSE_PS2_FOCALTECH=y
# CONFIG_MOUSE_PS2_VMMOUSE is not set
CONFIG_MOUSE_PS2_SMBUS=y
CONFIG_MOUSE_SERIAL=y
CONFIG_MOUSE_APPLETOUCH=m
CONFIG_MOUSE_BCM5974=m
CONFIG_MOUSE_CYAPA=m
# CONFIG_MOUSE_ELAN_I2C is not set
# CONFIG_MOUSE_VSXXXAA is not set
# CONFIG_MOUSE_GPIO is not set
CONFIG_MOUSE_SYNAPTICS_I2C=m
CONFIG_MOUSE_SYNAPTICS_USB=y
# CONFIG_INPUT_JOYSTICK is not set
CONFIG_INPUT_TABLET=y
CONFIG_TABLET_USB_ACECAD=y
CONFIG_TABLET_USB_AIPTEK=m
CONFIG_TABLET_USB_GTCO=m
# CONFIG_TABLET_USB_HANWANG is not set
CONFIG_TABLET_USB_KBTAB=m
# CONFIG_TABLET_USB_PEGASUS is not set
CONFIG_TABLET_SERIAL_WACOM4=m
CONFIG_INPUT_TOUCHSCREEN=y
CONFIG_TOUCHSCREEN_PROPERTIES=y
CONFIG_TOUCHSCREEN_AD7879=m
CONFIG_TOUCHSCREEN_AD7879_I2C=m
CONFIG_TOUCHSCREEN_ADC=m
# CONFIG_TOUCHSCREEN_AR1021_I2C is not set
# CONFIG_TOUCHSCREEN_ATMEL_MXT is not set
CONFIG_TOUCHSCREEN_AUO_PIXCIR=y
CONFIG_TOUCHSCREEN_BU21013=y
CONFIG_TOUCHSCREEN_BU21029=y
CONFIG_TOUCHSCREEN_CHIPONE_ICN8318=m
# CONFIG_TOUCHSCREEN_CY8CTMA140 is not set
CONFIG_TOUCHSCREEN_CY8CTMG110=y
CONFIG_TOUCHSCREEN_CYTTSP_CORE=y
CONFIG_TOUCHSCREEN_CYTTSP_I2C=y
CONFIG_TOUCHSCREEN_CYTTSP4_CORE=m
CONFIG_TOUCHSCREEN_CYTTSP4_I2C=m
CONFIG_TOUCHSCREEN_DA9052=y
# CONFIG_TOUCHSCREEN_DYNAPRO is not set
CONFIG_TOUCHSCREEN_HAMPSHIRE=y
CONFIG_TOUCHSCREEN_EETI=m
# CONFIG_TOUCHSCREEN_EGALAX is not set
# CONFIG_TOUCHSCREEN_EGALAX_SERIAL is not set
# CONFIG_TOUCHSCREEN_EXC3000 is not set
CONFIG_TOUCHSCREEN_FUJITSU=y
CONFIG_TOUCHSCREEN_GOODIX=y
CONFIG_TOUCHSCREEN_HIDEEP=m
CONFIG_TOUCHSCREEN_ILI210X=y
CONFIG_TOUCHSCREEN_S6SY761=m
CONFIG_TOUCHSCREEN_GUNZE=y
CONFIG_TOUCHSCREEN_EKTF2127=y
CONFIG_TOUCHSCREEN_ELAN=y
# CONFIG_TOUCHSCREEN_ELO is not set
CONFIG_TOUCHSCREEN_WACOM_W8001=m
CONFIG_TOUCHSCREEN_WACOM_I2C=y
# CONFIG_TOUCHSCREEN_MAX11801 is not set
# CONFIG_TOUCHSCREEN_MCS5000 is not set
CONFIG_TOUCHSCREEN_MMS114=y
# CONFIG_TOUCHSCREEN_MELFAS_MIP4 is not set
# CONFIG_TOUCHSCREEN_MTOUCH is not set
CONFIG_TOUCHSCREEN_IMX6UL_TSC=y
CONFIG_TOUCHSCREEN_INEXIO=m
CONFIG_TOUCHSCREEN_MK712=y
# CONFIG_TOUCHSCREEN_PENMOUNT is not set
CONFIG_TOUCHSCREEN_EDT_FT5X06=m
CONFIG_TOUCHSCREEN_TOUCHRIGHT=y
CONFIG_TOUCHSCREEN_TOUCHWIN=m
CONFIG_TOUCHSCREEN_TI_AM335X_TSC=m
# CONFIG_TOUCHSCREEN_PIXCIR is not set
CONFIG_TOUCHSCREEN_WDT87XX_I2C=y
CONFIG_TOUCHSCREEN_USB_COMPOSITE=m
CONFIG_TOUCHSCREEN_MC13783=m
CONFIG_TOUCHSCREEN_USB_EGALAX=y
CONFIG_TOUCHSCREEN_USB_PANJIT=y
CONFIG_TOUCHSCREEN_USB_3M=y
CONFIG_TOUCHSCREEN_USB_ITM=y
CONFIG_TOUCHSCREEN_USB_ETURBO=y
CONFIG_TOUCHSCREEN_USB_GUNZE=y
CONFIG_TOUCHSCREEN_USB_DMC_TSC10=y
CONFIG_TOUCHSCREEN_USB_IRTOUCH=y
CONFIG_TOUCHSCREEN_USB_IDEALTEK=y
CONFIG_TOUCHSCREEN_USB_GENERAL_TOUCH=y
CONFIG_TOUCHSCREEN_USB_GOTOP=y
CONFIG_TOUCHSCREEN_USB_JASTEC=y
CONFIG_TOUCHSCREEN_USB_ELO=y
CONFIG_TOUCHSCREEN_USB_E2I=y
CONFIG_TOUCHSCREEN_USB_ZYTRONIC=y
CONFIG_TOUCHSCREEN_USB_ETT_TC45USB=y
CONFIG_TOUCHSCREEN_USB_NEXIO=y
CONFIG_TOUCHSCREEN_USB_EASYTOUCH=y
CONFIG_TOUCHSCREEN_TOUCHIT213=m
CONFIG_TOUCHSCREEN_TSC_SERIO=y
# CONFIG_TOUCHSCREEN_TSC2004 is not set
CONFIG_TOUCHSCREEN_TSC2007=y
CONFIG_TOUCHSCREEN_RM_TS=m
# CONFIG_TOUCHSCREEN_SILEAD is not set
CONFIG_TOUCHSCREEN_SIS_I2C=m
# CONFIG_TOUCHSCREEN_ST1232 is not set
CONFIG_TOUCHSCREEN_STMFTS=m
# CONFIG_TOUCHSCREEN_STMPE is not set
CONFIG_TOUCHSCREEN_SUR40=m
CONFIG_TOUCHSCREEN_SX8654=y
# CONFIG_TOUCHSCREEN_TPS6507X is not set
CONFIG_TOUCHSCREEN_ZET6223=m
CONFIG_TOUCHSCREEN_ZFORCE=y
# CONFIG_TOUCHSCREEN_ROHM_BU21023 is not set
CONFIG_TOUCHSCREEN_IQS5XX=m
# CONFIG_INPUT_MISC is not set
CONFIG_RMI4_CORE=m
CONFIG_RMI4_I2C=m
CONFIG_RMI4_SMB=m
CONFIG_RMI4_F03=y
CONFIG_RMI4_F03_SERIO=m
CONFIG_RMI4_2D_SENSOR=y
CONFIG_RMI4_F11=y
CONFIG_RMI4_F12=y
CONFIG_RMI4_F30=y
CONFIG_RMI4_F34=y
CONFIG_RMI4_F54=y
CONFIG_RMI4_F55=y

#
# Hardware I/O ports
#
CONFIG_SERIO=y
CONFIG_ARCH_MIGHT_HAVE_PC_SERIO=y
CONFIG_SERIO_I8042=y
CONFIG_SERIO_SERPORT=y
CONFIG_SERIO_CT82C710=y
# CONFIG_SERIO_PARKBD is not set
CONFIG_SERIO_LIBPS2=y
# CONFIG_SERIO_RAW is not set
CONFIG_SERIO_ALTERA_PS2=m
CONFIG_SERIO_PS2MULT=m
CONFIG_SERIO_ARC_PS2=m
CONFIG_SERIO_APBPS2=y
# CONFIG_SERIO_GPIO_PS2 is not set
CONFIG_USERIO=y
# CONFIG_GAMEPORT is not set
# end of Hardware I/O ports
# end of Input device support

#
# Character devices
#
CONFIG_TTY=y
CONFIG_VT=y
CONFIG_CONSOLE_TRANSLATIONS=y
CONFIG_VT_CONSOLE=y
CONFIG_VT_CONSOLE_SLEEP=y
CONFIG_HW_CONSOLE=y
CONFIG_VT_HW_CONSOLE_BINDING=y
CONFIG_UNIX98_PTYS=y
# CONFIG_LEGACY_PTYS is not set
CONFIG_LDISC_AUTOLOAD=y

#
# Serial drivers
#
CONFIG_SERIAL_EARLYCON=y
# CONFIG_SERIAL_8250 is not set

#
# Non-8250 serial port support
#
# CONFIG_SERIAL_UARTLITE is not set
CONFIG_SERIAL_CORE=y
CONFIG_SERIAL_CORE_CONSOLE=y
CONFIG_SERIAL_SIFIVE=m
# CONFIG_SERIAL_LANTIQ is not set
# CONFIG_SERIAL_SCCNXP is not set
CONFIG_SERIAL_SC16IS7XX=m
# CONFIG_SERIAL_SC16IS7XX_I2C is not set
# CONFIG_SERIAL_TIMBERDALE is not set
CONFIG_SERIAL_ALTERA_JTAGUART=y
CONFIG_SERIAL_ALTERA_JTAGUART_CONSOLE=y
# CONFIG_SERIAL_ALTERA_JTAGUART_CONSOLE_BYPASS is not set
CONFIG_SERIAL_ALTERA_UART=y
CONFIG_SERIAL_ALTERA_UART_MAXPORTS=4
CONFIG_SERIAL_ALTERA_UART_BAUDRATE=115200
# CONFIG_SERIAL_ALTERA_UART_CONSOLE is not set
CONFIG_SERIAL_XILINX_PS_UART=m
# CONFIG_SERIAL_ARC is not set
CONFIG_SERIAL_FSL_LPUART=m
CONFIG_SERIAL_FSL_LINFLEXUART=m
CONFIG_SERIAL_CONEXANT_DIGICOLOR=m
# CONFIG_SERIAL_MEN_Z135 is not set
CONFIG_SERIAL_SPRD=m
# end of Serial drivers

CONFIG_SERIAL_NONSTANDARD=y
# CONFIG_N_HDLC is not set
CONFIG_GOLDFISH_TTY=y
CONFIG_GOLDFISH_TTY_EARLY_CONSOLE=y
# CONFIG_NULL_TTY is not set
# CONFIG_TRACE_ROUTER is not set
CONFIG_TRACE_SINK=m
CONFIG_HVC_DRIVER=y
CONFIG_SERIAL_DEV_BUS=y
# CONFIG_SERIAL_DEV_CTRL_TTYPORT is not set
CONFIG_PRINTER=m
# CONFIG_LP_CONSOLE is not set
CONFIG_PPDEV=m
CONFIG_VIRTIO_CONSOLE=y
# CONFIG_IPMI_HANDLER is not set
CONFIG_IPMB_DEVICE_INTERFACE=y
CONFIG_HW_RANDOM=y
CONFIG_HW_RANDOM_TIMERIOMEM=m
CONFIG_HW_RANDOM_BA431=y
CONFIG_HW_RANDOM_VIA=m
# CONFIG_HW_RANDOM_VIRTIO is not set
CONFIG_HW_RANDOM_CCTRNG=y

#
# PCMCIA character devices
#
# CONFIG_SYNCLINK_CS is not set
CONFIG_CARDMAN_4000=m
CONFIG_CARDMAN_4040=m
CONFIG_SCR24X=m
# end of PCMCIA character devices

# CONFIG_MWAVE is not set
# CONFIG_PC8736x_GPIO is not set
# CONFIG_NSC_GPIO is not set
# CONFIG_DEVMEM is not set
CONFIG_DEVKMEM=y
CONFIG_NVRAM=m
CONFIG_RAW_DRIVER=m
CONFIG_MAX_RAW_DEVS=256
CONFIG_HANGCHECK_TIMER=y
CONFIG_TCG_TPM=y
# CONFIG_HW_RANDOM_TPM is not set
# CONFIG_TCG_TIS is not set
CONFIG_TCG_TIS_I2C_ATMEL=y
CONFIG_TCG_TIS_I2C_INFINEON=y
CONFIG_TCG_TIS_I2C_NUVOTON=m
CONFIG_TCG_NSC=y
CONFIG_TCG_ATMEL=m
CONFIG_TCG_VTPM_PROXY=m
# CONFIG_TCG_TIS_ST33ZP24_I2C is not set
CONFIG_TELCLOCK=m
CONFIG_XILLYBUS=y
CONFIG_XILLYBUS_OF=y
# end of Character devices

# CONFIG_RANDOM_TRUST_CPU is not set
CONFIG_RANDOM_TRUST_BOOTLOADER=y

#
# I2C support
#
CONFIG_I2C=y
CONFIG_I2C_BOARDINFO=y
CONFIG_I2C_COMPAT=y
CONFIG_I2C_CHARDEV=y
CONFIG_I2C_MUX=m

#
# Multiplexer I2C Chip support
#
CONFIG_I2C_ARB_GPIO_CHALLENGE=m
CONFIG_I2C_MUX_GPIO=m
# CONFIG_I2C_MUX_GPMUX is not set
CONFIG_I2C_MUX_LTC4306=m
CONFIG_I2C_MUX_PCA9541=m
CONFIG_I2C_MUX_PCA954x=m
# CONFIG_I2C_MUX_PINCTRL is not set
CONFIG_I2C_MUX_REG=m
CONFIG_I2C_DEMUX_PINCTRL=m
# CONFIG_I2C_MUX_MLXCPLD is not set
# end of Multiplexer I2C Chip support

CONFIG_I2C_HELPER_AUTO=y
CONFIG_I2C_SMBUS=m
CONFIG_I2C_ALGOBIT=y
CONFIG_I2C_ALGOPCA=y

#
# I2C Hardware Bus support
#

#
# I2C system bus drivers (mostly embedded / system-on-chip)
#
CONFIG_I2C_CBUS_GPIO=m
# CONFIG_I2C_DESIGNWARE_PLATFORM is not set
CONFIG_I2C_EMEV2=y
CONFIG_I2C_GPIO=y
CONFIG_I2C_GPIO_FAULT_INJECTOR=y
# CONFIG_I2C_OCORES is not set
CONFIG_I2C_PCA_PLATFORM=y
CONFIG_I2C_RK3X=m
# CONFIG_I2C_SIMTEC is not set
CONFIG_I2C_XILINX=y

#
# External I2C/SMBus adapter drivers
#
# CONFIG_I2C_DIOLAN_U2C is not set
CONFIG_I2C_DLN2=m
CONFIG_I2C_PARPORT=m
# CONFIG_I2C_ROBOTFUZZ_OSIF is not set
CONFIG_I2C_TAOS_EVM=m
# CONFIG_I2C_TINY_USB is not set
# CONFIG_I2C_VIPERBOARD is not set

#
# Other I2C/SMBus bus drivers
#
# CONFIG_I2C_FSI is not set
# end of I2C Hardware Bus support

# CONFIG_I2C_STUB is not set
CONFIG_I2C_SLAVE=y
CONFIG_I2C_SLAVE_EEPROM=y
CONFIG_I2C_DEBUG_CORE=y
CONFIG_I2C_DEBUG_ALGO=y
# CONFIG_I2C_DEBUG_BUS is not set
# end of I2C support

CONFIG_I3C=y
CONFIG_CDNS_I3C_MASTER=y
# CONFIG_DW_I3C_MASTER is not set
# CONFIG_SPI is not set
# CONFIG_SPMI is not set
CONFIG_HSI=y
CONFIG_HSI_BOARDINFO=y

#
# HSI controllers
#

#
# HSI clients
#
CONFIG_HSI_CHAR=y
CONFIG_PPS=m
CONFIG_PPS_DEBUG=y
CONFIG_NTP_PPS=y

#
# PPS clients support
#
CONFIG_PPS_CLIENT_KTIMER=m
CONFIG_PPS_CLIENT_LDISC=m
CONFIG_PPS_CLIENT_PARPORT=m
CONFIG_PPS_CLIENT_GPIO=m

#
# PPS generators support
#

#
# PTP clock support
#

#
# Enable PHYLIB and NETWORK_PHY_TIMESTAMPING to see the additional clocks.
#
# end of PTP clock support

CONFIG_PINCTRL=y
CONFIG_GENERIC_PINCTRL_GROUPS=y
CONFIG_PINMUX=y
CONFIG_GENERIC_PINMUX_FUNCTIONS=y
CONFIG_PINCONF=y
CONFIG_GENERIC_PINCONF=y
CONFIG_PINCTRL_AS3722=m
CONFIG_PINCTRL_DA9062=m
CONFIG_PINCTRL_MCP23S08_I2C=y
CONFIG_PINCTRL_MCP23S08=y
CONFIG_PINCTRL_SINGLE=m
CONFIG_PINCTRL_SX150X=y
# CONFIG_PINCTRL_STMFX is not set
CONFIG_PINCTRL_MAX77620=y
# CONFIG_PINCTRL_RK805 is not set
# CONFIG_PINCTRL_OCELOT is not set
CONFIG_PINCTRL_LOCHNAGAR=m
CONFIG_PINCTRL_MADERA=m
CONFIG_PINCTRL_CS47L85=y
CONFIG_PINCTRL_CS47L90=y
CONFIG_PINCTRL_EQUILIBRIUM=y
CONFIG_GPIOLIB=y
CONFIG_GPIOLIB_FASTPATH_LIMIT=512
CONFIG_OF_GPIO=y
CONFIG_GPIOLIB_IRQCHIP=y
# CONFIG_GPIO_SYSFS is not set
CONFIG_GPIO_GENERIC=y

#
# Memory mapped GPIO drivers
#
CONFIG_GPIO_74XX_MMIO=m
CONFIG_GPIO_ALTERA=y
# CONFIG_GPIO_CADENCE is not set
CONFIG_GPIO_DWAPB=y
CONFIG_GPIO_FTGPIO010=y
# CONFIG_GPIO_GENERIC_PLATFORM is not set
CONFIG_GPIO_GRGPIO=y
CONFIG_GPIO_HLWD=y
CONFIG_GPIO_LOGICVC=m
# CONFIG_GPIO_MB86S7X is not set
CONFIG_GPIO_MENZ127=m
CONFIG_GPIO_SAMA5D2_PIOBU=m
CONFIG_GPIO_SIFIVE=y
CONFIG_GPIO_SIOX=m
CONFIG_GPIO_SYSCON=y
CONFIG_GPIO_XILINX=y
# CONFIG_GPIO_AMD_FCH is not set
# end of Memory mapped GPIO drivers

#
# Port-mapped I/O GPIO drivers
#
# CONFIG_GPIO_F7188X is not set
# CONFIG_GPIO_IT87 is not set
# CONFIG_GPIO_SCH311X is not set
CONFIG_GPIO_WINBOND=y
CONFIG_GPIO_WS16C48=m
# end of Port-mapped I/O GPIO drivers

#
# I2C GPIO expanders
#
# CONFIG_GPIO_ADP5588 is not set
CONFIG_GPIO_ADNP=y
CONFIG_GPIO_GW_PLD=m
# CONFIG_GPIO_MAX7300 is not set
CONFIG_GPIO_MAX732X=y
CONFIG_GPIO_MAX732X_IRQ=y
# CONFIG_GPIO_PCA953X is not set
CONFIG_GPIO_PCF857X=m
CONFIG_GPIO_TPIC2810=m
# end of I2C GPIO expanders

#
# MFD GPIO expanders
#
CONFIG_GPIO_ADP5520=m
# CONFIG_GPIO_BD9571MWV is not set
# CONFIG_GPIO_DA9052 is not set
# CONFIG_GPIO_DA9055 is not set
CONFIG_GPIO_DLN2=y
# CONFIG_GPIO_LP3943 is not set
CONFIG_GPIO_LP87565=m
CONFIG_GPIO_MADERA=m
# CONFIG_GPIO_MAX77620 is not set
CONFIG_GPIO_MAX77650=m
# CONFIG_GPIO_RC5T583 is not set
CONFIG_GPIO_STMPE=y
# CONFIG_GPIO_TPS65086 is not set
CONFIG_GPIO_TPS65218=m
CONFIG_GPIO_TPS65910=y
CONFIG_GPIO_TPS65912=y
CONFIG_GPIO_TQMX86=y
# CONFIG_GPIO_WM8350 is not set
# end of MFD GPIO expanders

#
# USB GPIO expanders
#
CONFIG_GPIO_VIPERBOARD=y
# end of USB GPIO expanders

CONFIG_GPIO_AGGREGATOR=m
# CONFIG_GPIO_MOCKUP is not set
CONFIG_W1=y

#
# 1-wire Bus Masters
#
CONFIG_W1_MASTER_DS2490=y
CONFIG_W1_MASTER_DS2482=y
# CONFIG_W1_MASTER_DS1WM is not set
# CONFIG_W1_MASTER_GPIO is not set
CONFIG_W1_MASTER_SGI=m
# end of 1-wire Bus Masters

#
# 1-wire Slaves
#
CONFIG_W1_SLAVE_THERM=m
# CONFIG_W1_SLAVE_SMEM is not set
# CONFIG_W1_SLAVE_DS2405 is not set
CONFIG_W1_SLAVE_DS2408=m
CONFIG_W1_SLAVE_DS2408_READBACK=y
CONFIG_W1_SLAVE_DS2413=m
# CONFIG_W1_SLAVE_DS2406 is not set
CONFIG_W1_SLAVE_DS2423=y
# CONFIG_W1_SLAVE_DS2805 is not set
CONFIG_W1_SLAVE_DS2430=m
CONFIG_W1_SLAVE_DS2431=m
CONFIG_W1_SLAVE_DS2433=m
CONFIG_W1_SLAVE_DS2433_CRC=y
# CONFIG_W1_SLAVE_DS2438 is not set
# CONFIG_W1_SLAVE_DS250X is not set
CONFIG_W1_SLAVE_DS2780=y
CONFIG_W1_SLAVE_DS2781=y
CONFIG_W1_SLAVE_DS28E04=m
CONFIG_W1_SLAVE_DS28E17=m
# end of 1-wire Slaves

# CONFIG_POWER_AVS is not set
# CONFIG_POWER_RESET is not set
CONFIG_POWER_SUPPLY=y
CONFIG_POWER_SUPPLY_DEBUG=y
# CONFIG_POWER_SUPPLY_HWMON is not set
CONFIG_PDA_POWER=m
# CONFIG_GENERIC_ADC_BATTERY is not set
CONFIG_MAX8925_POWER=y
CONFIG_WM8350_POWER=y
# CONFIG_TEST_POWER is not set
CONFIG_CHARGER_ADP5061=y
CONFIG_BATTERY_CW2015=m
CONFIG_BATTERY_DS2760=y
CONFIG_BATTERY_DS2780=y
CONFIG_BATTERY_DS2781=y
CONFIG_BATTERY_DS2782=m
# CONFIG_BATTERY_LEGO_EV3 is not set
# CONFIG_BATTERY_SBS is not set
CONFIG_CHARGER_SBS=y
CONFIG_MANAGER_SBS=m
# CONFIG_BATTERY_BQ27XXX is not set
CONFIG_BATTERY_DA9052=m
CONFIG_CHARGER_DA9150=m
CONFIG_BATTERY_DA9150=m
CONFIG_BATTERY_MAX17040=y
CONFIG_BATTERY_MAX17042=y
CONFIG_BATTERY_MAX1721X=y
CONFIG_CHARGER_PCF50633=m
CONFIG_CHARGER_ISP1704=m
CONFIG_CHARGER_MAX8903=m
CONFIG_CHARGER_LP8727=y
CONFIG_CHARGER_GPIO=m
# CONFIG_CHARGER_MANAGER is not set
# CONFIG_CHARGER_LT3651 is not set
CONFIG_CHARGER_MAX14577=m
CONFIG_CHARGER_DETECTOR_MAX14656=y
# CONFIG_CHARGER_MAX77650 is not set
CONFIG_CHARGER_BQ2415X=m
CONFIG_CHARGER_BQ24190=y
CONFIG_CHARGER_BQ24257=y
# CONFIG_CHARGER_BQ24735 is not set
CONFIG_CHARGER_BQ25890=m
CONFIG_CHARGER_SMB347=y
CONFIG_CHARGER_TPS65217=m
CONFIG_BATTERY_GAUGE_LTC2941=y
CONFIG_BATTERY_GOLDFISH=m
# CONFIG_BATTERY_RT5033 is not set
CONFIG_CHARGER_RT9455=m
CONFIG_CHARGER_UCS1002=y
# CONFIG_CHARGER_BD99954 is not set
CONFIG_HWMON=y
CONFIG_HWMON_VID=y
# CONFIG_HWMON_DEBUG_CHIP is not set

#
# Native drivers
#
CONFIG_SENSORS_ABITUGURU=m
CONFIG_SENSORS_ABITUGURU3=y
CONFIG_SENSORS_AD7414=m
CONFIG_SENSORS_AD7418=m
# CONFIG_SENSORS_ADM1021 is not set
CONFIG_SENSORS_ADM1025=y
# CONFIG_SENSORS_ADM1026 is not set
CONFIG_SENSORS_ADM1029=y
CONFIG_SENSORS_ADM1031=m
# CONFIG_SENSORS_ADM1177 is not set
CONFIG_SENSORS_ADM9240=m
CONFIG_SENSORS_ADT7X10=m
CONFIG_SENSORS_ADT7410=m
CONFIG_SENSORS_ADT7411=m
# CONFIG_SENSORS_ADT7462 is not set
CONFIG_SENSORS_ADT7470=y
CONFIG_SENSORS_ADT7475=m
CONFIG_SENSORS_AS370=m
# CONFIG_SENSORS_ASC7621 is not set
CONFIG_SENSORS_AXI_FAN_CONTROL=m
CONFIG_SENSORS_AMD_ENERGY=y
# CONFIG_SENSORS_APPLESMC is not set
# CONFIG_SENSORS_ASB100 is not set
CONFIG_SENSORS_ASPEED=y
CONFIG_SENSORS_ATXP1=y
CONFIG_SENSORS_CORSAIR_CPRO=m
CONFIG_SENSORS_DRIVETEMP=m
CONFIG_SENSORS_DS620=m
CONFIG_SENSORS_DS1621=y
CONFIG_SENSORS_DELL_SMM=y
CONFIG_SENSORS_DA9052_ADC=y
CONFIG_SENSORS_DA9055=y
CONFIG_SENSORS_F71805F=y
CONFIG_SENSORS_F71882FG=m
CONFIG_SENSORS_F75375S=y
CONFIG_SENSORS_MC13783_ADC=m
CONFIG_SENSORS_FSCHMD=y
# CONFIG_SENSORS_GL518SM is not set
CONFIG_SENSORS_GL520SM=y
CONFIG_SENSORS_G760A=m
CONFIG_SENSORS_G762=y
# CONFIG_SENSORS_GPIO_FAN is not set
CONFIG_SENSORS_HIH6130=m
CONFIG_SENSORS_IIO_HWMON=m
# CONFIG_SENSORS_CORETEMP is not set
CONFIG_SENSORS_IT87=y
# CONFIG_SENSORS_JC42 is not set
CONFIG_SENSORS_POWR1220=y
# CONFIG_SENSORS_LINEAGE is not set
CONFIG_SENSORS_LOCHNAGAR=y
CONFIG_SENSORS_LTC2945=m
CONFIG_SENSORS_LTC2947=m
CONFIG_SENSORS_LTC2947_I2C=m
# CONFIG_SENSORS_LTC2990 is not set
# CONFIG_SENSORS_LTC4151 is not set
CONFIG_SENSORS_LTC4215=m
CONFIG_SENSORS_LTC4222=y
CONFIG_SENSORS_LTC4245=y
CONFIG_SENSORS_LTC4260=y
CONFIG_SENSORS_LTC4261=y
# CONFIG_SENSORS_MAX16065 is not set
CONFIG_SENSORS_MAX1619=m
# CONFIG_SENSORS_MAX1668 is not set
CONFIG_SENSORS_MAX197=m
CONFIG_SENSORS_MAX31730=m
CONFIG_SENSORS_MAX6621=y
CONFIG_SENSORS_MAX6639=m
CONFIG_SENSORS_MAX6642=y
# CONFIG_SENSORS_MAX6650 is not set
CONFIG_SENSORS_MAX6697=m
CONFIG_SENSORS_MAX31790=y
# CONFIG_SENSORS_MCP3021 is not set
CONFIG_SENSORS_MLXREG_FAN=m
# CONFIG_SENSORS_TC654 is not set
CONFIG_SENSORS_MENF21BMC_HWMON=y
# CONFIG_SENSORS_LM63 is not set
CONFIG_SENSORS_LM73=m
CONFIG_SENSORS_LM75=y
CONFIG_SENSORS_LM77=y
CONFIG_SENSORS_LM78=y
# CONFIG_SENSORS_LM80 is not set
CONFIG_SENSORS_LM83=m
# CONFIG_SENSORS_LM85 is not set
# CONFIG_SENSORS_LM87 is not set
CONFIG_SENSORS_LM90=y
CONFIG_SENSORS_LM92=m
# CONFIG_SENSORS_LM93 is not set
CONFIG_SENSORS_LM95234=y
CONFIG_SENSORS_LM95241=y
CONFIG_SENSORS_LM95245=m
# CONFIG_SENSORS_PC87360 is not set
CONFIG_SENSORS_PC87427=y
# CONFIG_SENSORS_NTC_THERMISTOR is not set
CONFIG_SENSORS_NCT6683=m
CONFIG_SENSORS_NCT6775=y
# CONFIG_SENSORS_NCT7802 is not set
CONFIG_SENSORS_NPCM7XX=m
CONFIG_SENSORS_PCF8591=y
# CONFIG_PMBUS is not set
# CONFIG_SENSORS_SHT15 is not set
CONFIG_SENSORS_SHT21=m
# CONFIG_SENSORS_SHT3x is not set
# CONFIG_SENSORS_SHTC1 is not set
# CONFIG_SENSORS_DME1737 is not set
CONFIG_SENSORS_EMC1403=m
CONFIG_SENSORS_EMC2103=y
# CONFIG_SENSORS_EMC6W201 is not set
# CONFIG_SENSORS_SMSC47M1 is not set
# CONFIG_SENSORS_SMSC47M192 is not set
CONFIG_SENSORS_SMSC47B397=m
# CONFIG_SENSORS_STTS751 is not set
# CONFIG_SENSORS_SMM665 is not set
CONFIG_SENSORS_ADC128D818=m
CONFIG_SENSORS_ADS7828=m
# CONFIG_SENSORS_AMC6821 is not set
CONFIG_SENSORS_INA209=m
CONFIG_SENSORS_INA2XX=y
# CONFIG_SENSORS_INA3221 is not set
CONFIG_SENSORS_TC74=m
CONFIG_SENSORS_THMC50=m
CONFIG_SENSORS_TMP102=y
# CONFIG_SENSORS_TMP103 is not set
CONFIG_SENSORS_TMP108=m
CONFIG_SENSORS_TMP401=y
CONFIG_SENSORS_TMP421=m
# CONFIG_SENSORS_TMP513 is not set
CONFIG_SENSORS_VIA_CPUTEMP=m
CONFIG_SENSORS_VT1211=m
CONFIG_SENSORS_W83773G=y
# CONFIG_SENSORS_W83781D is not set
CONFIG_SENSORS_W83791D=y
CONFIG_SENSORS_W83792D=m
CONFIG_SENSORS_W83793=m
CONFIG_SENSORS_W83795=m
# CONFIG_SENSORS_W83795_FANCTRL is not set
# CONFIG_SENSORS_W83L785TS is not set
CONFIG_SENSORS_W83L786NG=m
CONFIG_SENSORS_W83627HF=y
# CONFIG_SENSORS_W83627EHF is not set
CONFIG_SENSORS_WM8350=y
# CONFIG_THERMAL is not set
# CONFIG_WATCHDOG is not set
CONFIG_SSB_POSSIBLE=y
CONFIG_SSB=m
CONFIG_SSB_PCMCIAHOST_POSSIBLE=y
# CONFIG_SSB_PCMCIAHOST is not set
# CONFIG_SSB_DRIVER_GPIO is not set
CONFIG_BCMA_POSSIBLE=y
# CONFIG_BCMA is not set

#
# Multifunction device drivers
#
CONFIG_MFD_CORE=y
# CONFIG_MFD_ACT8945A is not set
CONFIG_MFD_AS3711=y
CONFIG_MFD_AS3722=y
CONFIG_PMIC_ADP5520=y
CONFIG_MFD_AAT2870_CORE=y
CONFIG_MFD_ATMEL_FLEXCOM=m
CONFIG_MFD_ATMEL_HLCDC=m
CONFIG_MFD_BCM590XX=m
CONFIG_MFD_BD9571MWV=m
# CONFIG_MFD_AXP20X_I2C is not set
CONFIG_MFD_MADERA=m
CONFIG_MFD_MADERA_I2C=m
# CONFIG_MFD_CS47L15 is not set
# CONFIG_MFD_CS47L35 is not set
CONFIG_MFD_CS47L85=y
CONFIG_MFD_CS47L90=y
# CONFIG_MFD_CS47L92 is not set
# CONFIG_PMIC_DA903X is not set
CONFIG_PMIC_DA9052=y
CONFIG_MFD_DA9052_I2C=y
CONFIG_MFD_DA9055=y
CONFIG_MFD_DA9062=y
CONFIG_MFD_DA9063=y
CONFIG_MFD_DA9150=m
CONFIG_MFD_DLN2=y
# CONFIG_MFD_GATEWORKS_GSC is not set
CONFIG_MFD_MC13XXX=m
CONFIG_MFD_MC13XXX_I2C=m
# CONFIG_MFD_MP2629 is not set
CONFIG_MFD_HI6421_PMIC=y
# CONFIG_HTC_PASIC3 is not set
CONFIG_HTC_I2CPLD=y
# CONFIG_MFD_IQS62X is not set
# CONFIG_MFD_KEMPLD is not set
CONFIG_MFD_88PM800=y
CONFIG_MFD_88PM805=m
# CONFIG_MFD_88PM860X is not set
CONFIG_MFD_MAX14577=m
CONFIG_MFD_MAX77620=y
CONFIG_MFD_MAX77650=y
CONFIG_MFD_MAX77686=m
# CONFIG_MFD_MAX77693 is not set
CONFIG_MFD_MAX77843=y
# CONFIG_MFD_MAX8907 is not set
CONFIG_MFD_MAX8925=y
CONFIG_MFD_MAX8997=y
# CONFIG_MFD_MAX8998 is not set
CONFIG_MFD_MT6360=m
CONFIG_MFD_MT6397=m
CONFIG_MFD_MENF21BMC=y
CONFIG_MFD_VIPERBOARD=y
CONFIG_MFD_RETU=m
CONFIG_MFD_PCF50633=y
CONFIG_PCF50633_ADC=y
CONFIG_PCF50633_GPIO=y
CONFIG_MFD_RT5033=m
CONFIG_MFD_RC5T583=y
CONFIG_MFD_RK808=y
# CONFIG_MFD_RN5T618 is not set
CONFIG_MFD_SEC_CORE=y
CONFIG_MFD_SI476X_CORE=m
CONFIG_MFD_SM501=m
# CONFIG_MFD_SM501_GPIO is not set
# CONFIG_MFD_SKY81452 is not set
# CONFIG_MFD_SMSC is not set
# CONFIG_ABX500_CORE is not set
CONFIG_MFD_STMPE=y

#
# STMicroelectronics STMPE Interface Drivers
#
# CONFIG_STMPE_I2C is not set
# end of STMicroelectronics STMPE Interface Drivers

CONFIG_MFD_SYSCON=y
CONFIG_MFD_TI_AM335X_TSCADC=m
CONFIG_MFD_LP3943=y
# CONFIG_MFD_LP8788 is not set
CONFIG_MFD_TI_LMU=m
# CONFIG_MFD_PALMAS is not set
# CONFIG_TPS6105X is not set
# CONFIG_TPS65010 is not set
CONFIG_TPS6507X=m
CONFIG_MFD_TPS65086=m
# CONFIG_MFD_TPS65090 is not set
CONFIG_MFD_TPS65217=m
# CONFIG_MFD_TI_LP873X is not set
CONFIG_MFD_TI_LP87565=m
CONFIG_MFD_TPS65218=m
# CONFIG_MFD_TPS6586X is not set
CONFIG_MFD_TPS65910=y
CONFIG_MFD_TPS65912=y
CONFIG_MFD_TPS65912_I2C=y
CONFIG_MFD_TPS80031=y
# CONFIG_TWL4030_CORE is not set
# CONFIG_TWL6040_CORE is not set
CONFIG_MFD_WL1273_CORE=y
CONFIG_MFD_LM3533=m
# CONFIG_MFD_TC3589X is not set
CONFIG_MFD_TQMX86=y
CONFIG_MFD_LOCHNAGAR=y
# CONFIG_MFD_ARIZONA_I2C is not set
# CONFIG_MFD_WM8400 is not set
# CONFIG_MFD_WM831X_I2C is not set
CONFIG_MFD_WM8350=y
CONFIG_MFD_WM8350_I2C=y
# CONFIG_MFD_WM8994 is not set
CONFIG_MFD_ROHM_BD718XX=m
# CONFIG_MFD_ROHM_BD70528 is not set
# CONFIG_MFD_ROHM_BD71828 is not set
CONFIG_MFD_STPMIC1=m
CONFIG_MFD_STMFX=y
CONFIG_RAVE_SP_CORE=m
# end of Multifunction device drivers

CONFIG_REGULATOR=y
CONFIG_REGULATOR_DEBUG=y
# CONFIG_REGULATOR_FIXED_VOLTAGE is not set
CONFIG_REGULATOR_VIRTUAL_CONSUMER=m
CONFIG_REGULATOR_USERSPACE_CONSUMER=y
CONFIG_REGULATOR_88PG86X=y
CONFIG_REGULATOR_88PM800=y
# CONFIG_REGULATOR_ACT8865 is not set
CONFIG_REGULATOR_AD5398=m
# CONFIG_REGULATOR_AAT2870 is not set
CONFIG_REGULATOR_AS3711=m
# CONFIG_REGULATOR_AS3722 is not set
# CONFIG_REGULATOR_BCM590XX is not set
CONFIG_REGULATOR_BD718XX=m
CONFIG_REGULATOR_BD9571MWV=m
# CONFIG_REGULATOR_DA9052 is not set
CONFIG_REGULATOR_DA9055=m
CONFIG_REGULATOR_DA9062=m
CONFIG_REGULATOR_DA9063=y
# CONFIG_REGULATOR_DA9210 is not set
CONFIG_REGULATOR_DA9211=y
# CONFIG_REGULATOR_FAN53555 is not set
# CONFIG_REGULATOR_FAN53880 is not set
CONFIG_REGULATOR_GPIO=y
CONFIG_REGULATOR_HI6421=y
# CONFIG_REGULATOR_HI6421V530 is not set
# CONFIG_REGULATOR_ISL9305 is not set
# CONFIG_REGULATOR_ISL6271A is not set
CONFIG_REGULATOR_LM363X=m
CONFIG_REGULATOR_LOCHNAGAR=y
# CONFIG_REGULATOR_LP3971 is not set
CONFIG_REGULATOR_LP3972=y
CONFIG_REGULATOR_LP872X=m
# CONFIG_REGULATOR_LP8755 is not set
CONFIG_REGULATOR_LP87565=m
CONFIG_REGULATOR_LTC3589=m
CONFIG_REGULATOR_LTC3676=y
# CONFIG_REGULATOR_MAX14577 is not set
CONFIG_REGULATOR_MAX1586=y
# CONFIG_REGULATOR_MAX77620 is not set
# CONFIG_REGULATOR_MAX77650 is not set
CONFIG_REGULATOR_MAX8649=y
# CONFIG_REGULATOR_MAX8660 is not set
CONFIG_REGULATOR_MAX8925=y
CONFIG_REGULATOR_MAX8952=m
# CONFIG_REGULATOR_MAX8997 is not set
# CONFIG_REGULATOR_MAX77686 is not set
# CONFIG_REGULATOR_MAX77693 is not set
# CONFIG_REGULATOR_MAX77802 is not set
CONFIG_REGULATOR_MAX77826=m
# CONFIG_REGULATOR_MC13783 is not set
# CONFIG_REGULATOR_MC13892 is not set
# CONFIG_REGULATOR_MCP16502 is not set
CONFIG_REGULATOR_MP5416=y
# CONFIG_REGULATOR_MP8859 is not set
CONFIG_REGULATOR_MP886X=y
# CONFIG_REGULATOR_MPQ7920 is not set
# CONFIG_REGULATOR_MT6311 is not set
CONFIG_REGULATOR_MT6323=m
CONFIG_REGULATOR_MT6358=m
CONFIG_REGULATOR_MT6397=m
CONFIG_REGULATOR_PCA9450=m
# CONFIG_REGULATOR_PCF50633 is not set
CONFIG_REGULATOR_PFUZE100=y
CONFIG_REGULATOR_PV88060=y
CONFIG_REGULATOR_PV88080=m
CONFIG_REGULATOR_PV88090=y
CONFIG_REGULATOR_RC5T583=m
# CONFIG_REGULATOR_RK808 is not set
CONFIG_REGULATOR_ROHM=m
CONFIG_REGULATOR_RT5033=m
CONFIG_REGULATOR_S2MPA01=y
# CONFIG_REGULATOR_S2MPS11 is not set
CONFIG_REGULATOR_S5M8767=m
# CONFIG_REGULATOR_SLG51000 is not set
CONFIG_REGULATOR_STPMIC1=m
CONFIG_REGULATOR_SY8106A=m
CONFIG_REGULATOR_SY8824X=y
# CONFIG_REGULATOR_SY8827N is not set
CONFIG_REGULATOR_TPS51632=m
# CONFIG_REGULATOR_TPS62360 is not set
# CONFIG_REGULATOR_TPS65023 is not set
CONFIG_REGULATOR_TPS6507X=m
CONFIG_REGULATOR_TPS65086=m
# CONFIG_REGULATOR_TPS65132 is not set
CONFIG_REGULATOR_TPS65217=m
# CONFIG_REGULATOR_TPS65218 is not set
# CONFIG_REGULATOR_TPS65910 is not set
# CONFIG_REGULATOR_TPS65912 is not set
# CONFIG_REGULATOR_TPS80031 is not set
# CONFIG_REGULATOR_VCTRL is not set
# CONFIG_REGULATOR_WM8350 is not set
CONFIG_RC_CORE=y
# CONFIG_RC_MAP is not set
# CONFIG_LIRC is not set
# CONFIG_RC_DECODERS is not set
# CONFIG_RC_DEVICES is not set
CONFIG_CEC_CORE=y
CONFIG_CEC_NOTIFIER=y
CONFIG_CEC_PIN=y
CONFIG_MEDIA_CEC_RC=y
# CONFIG_CEC_PIN_ERROR_INJ is not set
CONFIG_MEDIA_CEC_SUPPORT=y
CONFIG_CEC_CH7322=y
CONFIG_CEC_GPIO=y
# CONFIG_USB_PULSE8_CEC is not set
CONFIG_USB_RAINSHADOW_CEC=y
CONFIG_MEDIA_SUPPORT=m
# CONFIG_MEDIA_SUPPORT_FILTER is not set
# CONFIG_MEDIA_SUBDRV_AUTOSELECT is not set

#
# Media device types
#
CONFIG_MEDIA_CAMERA_SUPPORT=y
CONFIG_MEDIA_ANALOG_TV_SUPPORT=y
CONFIG_MEDIA_DIGITAL_TV_SUPPORT=y
CONFIG_MEDIA_RADIO_SUPPORT=y
CONFIG_MEDIA_SDR_SUPPORT=y
CONFIG_MEDIA_PLATFORM_SUPPORT=y
CONFIG_MEDIA_TEST_SUPPORT=y
# end of Media device types

#
# Media core support
#
CONFIG_VIDEO_DEV=m
CONFIG_MEDIA_CONTROLLER=y
CONFIG_DVB_CORE=m
# end of Media core support

#
# Video4Linux options
#
CONFIG_VIDEO_V4L2=m
CONFIG_VIDEO_V4L2_I2C=y
CONFIG_VIDEO_V4L2_SUBDEV_API=y
CONFIG_VIDEO_ADV_DEBUG=y
CONFIG_VIDEO_FIXED_MINOR_RANGES=y
CONFIG_VIDEO_TUNER=m
CONFIG_V4L2_FWNODE=m
CONFIG_VIDEOBUF_GEN=m
CONFIG_VIDEOBUF_VMALLOC=m
# end of Video4Linux options

#
# Media controller options
#
CONFIG_MEDIA_CONTROLLER_DVB=y
# end of Media controller options

#
# Digital TV options
#
# CONFIG_DVB_MMAP is not set
CONFIG_DVB_MAX_ADAPTERS=16
# CONFIG_DVB_DYNAMIC_MINORS is not set
# CONFIG_DVB_DEMUX_SECTION_LOSS_LOG is not set
CONFIG_DVB_ULE_DEBUG=y
# end of Digital TV options

#
# Media drivers
#
CONFIG_TTPCI_EEPROM=m
CONFIG_MEDIA_USB_SUPPORT=y

#
# Webcam devices
#
# CONFIG_USB_VIDEO_CLASS is not set
CONFIG_USB_GSPCA=m
CONFIG_USB_M5602=m
# CONFIG_USB_STV06XX is not set
CONFIG_USB_GL860=m
CONFIG_USB_GSPCA_BENQ=m
# CONFIG_USB_GSPCA_CONEX is not set
CONFIG_USB_GSPCA_CPIA1=m
CONFIG_USB_GSPCA_DTCS033=m
# CONFIG_USB_GSPCA_ETOMS is not set
CONFIG_USB_GSPCA_FINEPIX=m
# CONFIG_USB_GSPCA_JEILINJ is not set
# CONFIG_USB_GSPCA_JL2005BCD is not set
CONFIG_USB_GSPCA_KINECT=m
# CONFIG_USB_GSPCA_KONICA is not set
# CONFIG_USB_GSPCA_MARS is not set
# CONFIG_USB_GSPCA_MR97310A is not set
CONFIG_USB_GSPCA_NW80X=m
# CONFIG_USB_GSPCA_OV519 is not set
CONFIG_USB_GSPCA_OV534=m
CONFIG_USB_GSPCA_OV534_9=m
# CONFIG_USB_GSPCA_PAC207 is not set
CONFIG_USB_GSPCA_PAC7302=m
CONFIG_USB_GSPCA_PAC7311=m
# CONFIG_USB_GSPCA_SE401 is not set
CONFIG_USB_GSPCA_SN9C2028=m
CONFIG_USB_GSPCA_SN9C20X=m
# CONFIG_USB_GSPCA_SONIXB is not set
CONFIG_USB_GSPCA_SONIXJ=m
# CONFIG_USB_GSPCA_SPCA500 is not set
# CONFIG_USB_GSPCA_SPCA501 is not set
CONFIG_USB_GSPCA_SPCA505=m
# CONFIG_USB_GSPCA_SPCA506 is not set
# CONFIG_USB_GSPCA_SPCA508 is not set
CONFIG_USB_GSPCA_SPCA561=m
CONFIG_USB_GSPCA_SPCA1528=m
CONFIG_USB_GSPCA_SQ905=m
CONFIG_USB_GSPCA_SQ905C=m
CONFIG_USB_GSPCA_SQ930X=m
CONFIG_USB_GSPCA_STK014=m
# CONFIG_USB_GSPCA_STK1135 is not set
# CONFIG_USB_GSPCA_STV0680 is not set
CONFIG_USB_GSPCA_SUNPLUS=m
CONFIG_USB_GSPCA_T613=m
# CONFIG_USB_GSPCA_TOPRO is not set
CONFIG_USB_GSPCA_TOUPTEK=m
CONFIG_USB_GSPCA_TV8532=m
CONFIG_USB_GSPCA_VC032X=m
CONFIG_USB_GSPCA_VICAM=m
# CONFIG_USB_GSPCA_XIRLINK_CIT is not set
# CONFIG_USB_GSPCA_ZC3XX is not set
CONFIG_USB_PWC=m
# CONFIG_USB_PWC_DEBUG is not set
CONFIG_USB_PWC_INPUT_EVDEV=y
CONFIG_VIDEO_CPIA2=m
CONFIG_USB_ZR364XX=m
# CONFIG_USB_STKWEBCAM is not set
# CONFIG_USB_S2255 is not set

#
# Analog TV USB devices
#
CONFIG_VIDEO_PVRUSB2=m
CONFIG_VIDEO_PVRUSB2_SYSFS=y
# CONFIG_VIDEO_PVRUSB2_DVB is not set
# CONFIG_VIDEO_PVRUSB2_DEBUGIFC is not set
CONFIG_VIDEO_HDPVR=m
CONFIG_VIDEO_STK1160_COMMON=m
CONFIG_VIDEO_STK1160=m

#
# Analog/digital TV USB devices
#
CONFIG_VIDEO_AU0828=m
# CONFIG_VIDEO_AU0828_V4L2 is not set
CONFIG_VIDEO_AU0828_RC=y
CONFIG_VIDEO_CX231XX=m
CONFIG_VIDEO_CX231XX_RC=y
# CONFIG_VIDEO_CX231XX_DVB is not set
CONFIG_VIDEO_TM6000=m
CONFIG_VIDEO_TM6000_DVB=m

#
# Digital TV USB devices
#
CONFIG_DVB_USB=m
CONFIG_DVB_USB_DEBUG=y
CONFIG_DVB_USB_DIB3000MC=m
CONFIG_DVB_USB_A800=m
# CONFIG_DVB_USB_DIBUSB_MB is not set
CONFIG_DVB_USB_DIBUSB_MC=m
CONFIG_DVB_USB_DIB0700=m
CONFIG_DVB_USB_UMT_010=m
CONFIG_DVB_USB_CXUSB=m
CONFIG_DVB_USB_CXUSB_ANALOG=y
# CONFIG_DVB_USB_M920X is not set
# CONFIG_DVB_USB_DIGITV is not set
CONFIG_DVB_USB_VP7045=m
CONFIG_DVB_USB_VP702X=m
# CONFIG_DVB_USB_GP8PSK is not set
CONFIG_DVB_USB_NOVA_T_USB2=m
CONFIG_DVB_USB_TTUSB2=m
CONFIG_DVB_USB_DTT200U=m
# CONFIG_DVB_USB_OPERA1 is not set
CONFIG_DVB_USB_AF9005=m
CONFIG_DVB_USB_AF9005_REMOTE=m
CONFIG_DVB_USB_PCTV452E=m
CONFIG_DVB_USB_DW2102=m
CONFIG_DVB_USB_CINERGY_T2=m
# CONFIG_DVB_USB_DTV5100 is not set
CONFIG_DVB_USB_AZ6027=m
CONFIG_DVB_USB_TECHNISAT_USB2=m
CONFIG_DVB_USB_V2=m
CONFIG_DVB_USB_AF9015=m
# CONFIG_DVB_USB_AF9035 is not set
CONFIG_DVB_USB_ANYSEE=m
CONFIG_DVB_USB_AU6610=m
# CONFIG_DVB_USB_AZ6007 is not set
CONFIG_DVB_USB_CE6230=m
CONFIG_DVB_USB_EC168=m
CONFIG_DVB_USB_GL861=m
# CONFIG_DVB_USB_LME2510 is not set
CONFIG_DVB_USB_MXL111SF=m
CONFIG_DVB_USB_RTL28XXU=m
CONFIG_DVB_USB_DVBSKY=m
# CONFIG_DVB_USB_ZD1301 is not set
CONFIG_SMS_USB_DRV=m
CONFIG_DVB_B2C2_FLEXCOP_USB=m
CONFIG_DVB_B2C2_FLEXCOP_USB_DEBUG=y
CONFIG_DVB_AS102=m

#
# Webcam, TV (analog/digital) USB devices
#
# CONFIG_VIDEO_EM28XX is not set

#
# Software defined radio USB devices
#
CONFIG_USB_AIRSPY=m
CONFIG_USB_HACKRF=m
# CONFIG_RADIO_ADAPTERS is not set
CONFIG_MEDIA_COMMON_OPTIONS=y

#
# common driver options
#
CONFIG_VIDEO_CX2341X=m
CONFIG_VIDEO_TVEEPROM=m
CONFIG_CYPRESS_FIRMWARE=m
CONFIG_VIDEOBUF2_CORE=m
CONFIG_VIDEOBUF2_V4L2=m
CONFIG_VIDEOBUF2_MEMOPS=m
CONFIG_VIDEOBUF2_DMA_CONTIG=m
CONFIG_VIDEOBUF2_VMALLOC=m
CONFIG_VIDEOBUF2_DMA_SG=m
CONFIG_DVB_B2C2_FLEXCOP=m
CONFIG_DVB_B2C2_FLEXCOP_DEBUG=y
CONFIG_SMS_SIANO_MDTV=m
# CONFIG_SMS_SIANO_RC is not set
CONFIG_V4L_PLATFORM_DRIVERS=y
# CONFIG_VIDEO_CADENCE is not set
CONFIG_VIDEO_ASPEED=m
CONFIG_VIDEO_MUX=m
CONFIG_VIDEO_XILINX=m
CONFIG_VIDEO_XILINX_CSI2RXSS=m
CONFIG_VIDEO_XILINX_TPG=m
CONFIG_VIDEO_XILINX_VTC=m
# CONFIG_V4L_MEM2MEM_DRIVERS is not set
CONFIG_DVB_PLATFORM_DRIVERS=y
# CONFIG_SDR_PLATFORM_DRIVERS is not set
CONFIG_V4L_TEST_DRIVERS=y
# CONFIG_VIDEO_VIMC is not set
# CONFIG_VIDEO_VIM2M is not set
# CONFIG_VIDEO_VICODEC is not set
# end of Media drivers

#
# Media ancillary drivers
#
CONFIG_MEDIA_ATTACH=y
CONFIG_VIDEO_IR_I2C=m

#
# Audio decoders, processors and mixers
#
CONFIG_VIDEO_TVAUDIO=m
# CONFIG_VIDEO_TDA7432 is not set
# CONFIG_VIDEO_TDA9840 is not set
CONFIG_VIDEO_TEA6415C=m
# CONFIG_VIDEO_TEA6420 is not set
CONFIG_VIDEO_MSP3400=m
CONFIG_VIDEO_CS3308=m
# CONFIG_VIDEO_CS5345 is not set
CONFIG_VIDEO_CS53L32A=m
# CONFIG_VIDEO_TLV320AIC23B is not set
CONFIG_VIDEO_UDA1342=m
CONFIG_VIDEO_WM8775=m
CONFIG_VIDEO_WM8739=m
# CONFIG_VIDEO_VP27SMPX is not set
CONFIG_VIDEO_SONY_BTF_MPX=m
# end of Audio decoders, processors and mixers

#
# RDS decoders
#
# CONFIG_VIDEO_SAA6588 is not set
# end of RDS decoders

#
# Video decoders
#
# CONFIG_VIDEO_ADV7180 is not set
# CONFIG_VIDEO_ADV7183 is not set
# CONFIG_VIDEO_ADV748X is not set
# CONFIG_VIDEO_ADV7604 is not set
# CONFIG_VIDEO_ADV7842 is not set
CONFIG_VIDEO_BT819=m
CONFIG_VIDEO_BT856=m
CONFIG_VIDEO_BT866=m
CONFIG_VIDEO_KS0127=m
CONFIG_VIDEO_ML86V7667=m
CONFIG_VIDEO_SAA7110=m
CONFIG_VIDEO_SAA711X=m
CONFIG_VIDEO_TC358743=m
# CONFIG_VIDEO_TC358743_CEC is not set
# CONFIG_VIDEO_TVP514X is not set
# CONFIG_VIDEO_TVP5150 is not set
CONFIG_VIDEO_TVP7002=m
CONFIG_VIDEO_TW2804=m
CONFIG_VIDEO_TW9903=m
CONFIG_VIDEO_TW9906=m
# CONFIG_VIDEO_TW9910 is not set
CONFIG_VIDEO_VPX3220=m

#
# Video and audio decoders
#
CONFIG_VIDEO_SAA717X=m
CONFIG_VIDEO_CX25840=m
# end of Video decoders

#
# Video encoders
#
# CONFIG_VIDEO_SAA7127 is not set
# CONFIG_VIDEO_SAA7185 is not set
CONFIG_VIDEO_ADV7170=m
CONFIG_VIDEO_ADV7175=m
# CONFIG_VIDEO_ADV7343 is not set
CONFIG_VIDEO_ADV7393=m
CONFIG_VIDEO_ADV7511=m
# CONFIG_VIDEO_ADV7511_CEC is not set
# CONFIG_VIDEO_AD9389B is not set
CONFIG_VIDEO_AK881X=m
# CONFIG_VIDEO_THS8200 is not set
# end of Video encoders

#
# Video improvement chips
#
CONFIG_VIDEO_UPD64031A=m
CONFIG_VIDEO_UPD64083=m
# end of Video improvement chips

#
# Audio/Video compression chips
#
CONFIG_VIDEO_SAA6752HS=m
# end of Audio/Video compression chips

#
# SDR tuner chips
#
CONFIG_SDR_MAX2175=m
# end of SDR tuner chips

#
# Miscellaneous helper chips
#
CONFIG_VIDEO_THS7303=m
CONFIG_VIDEO_M52790=m
CONFIG_VIDEO_I2C=m
CONFIG_VIDEO_ST_MIPID02=m
# end of Miscellaneous helper chips

#
# Camera sensor devices
#
CONFIG_VIDEO_APTINA_PLL=m
CONFIG_VIDEO_HI556=m
# CONFIG_VIDEO_IMX214 is not set
CONFIG_VIDEO_IMX219=m
CONFIG_VIDEO_IMX258=m
CONFIG_VIDEO_IMX274=m
CONFIG_VIDEO_IMX290=m
CONFIG_VIDEO_IMX319=m
# CONFIG_VIDEO_IMX355 is not set
CONFIG_VIDEO_OV2640=m
# CONFIG_VIDEO_OV2659 is not set
# CONFIG_VIDEO_OV2680 is not set
CONFIG_VIDEO_OV2685=m
CONFIG_VIDEO_OV5640=m
CONFIG_VIDEO_OV5645=m
# CONFIG_VIDEO_OV5647 is not set
# CONFIG_VIDEO_OV6650 is not set
# CONFIG_VIDEO_OV5670 is not set
CONFIG_VIDEO_OV5675=m
CONFIG_VIDEO_OV5695=m
# CONFIG_VIDEO_OV7251 is not set
# CONFIG_VIDEO_OV772X is not set
# CONFIG_VIDEO_OV7640 is not set
CONFIG_VIDEO_OV7670=m
CONFIG_VIDEO_OV7740=m
# CONFIG_VIDEO_OV8856 is not set
CONFIG_VIDEO_OV9640=m
# CONFIG_VIDEO_OV9650 is not set
# CONFIG_VIDEO_OV13858 is not set
# CONFIG_VIDEO_VS6624 is not set
CONFIG_VIDEO_MT9M001=m
# CONFIG_VIDEO_MT9M032 is not set
CONFIG_VIDEO_MT9M111=m
CONFIG_VIDEO_MT9P031=m
# CONFIG_VIDEO_MT9T001 is not set
CONFIG_VIDEO_MT9T112=m
CONFIG_VIDEO_MT9V011=m
# CONFIG_VIDEO_MT9V032 is not set
CONFIG_VIDEO_MT9V111=m
# CONFIG_VIDEO_SR030PC30 is not set
# CONFIG_VIDEO_NOON010PC30 is not set
CONFIG_VIDEO_M5MOLS=m
CONFIG_VIDEO_RJ54N1=m
CONFIG_VIDEO_S5K6AA=m
CONFIG_VIDEO_S5K6A3=m
CONFIG_VIDEO_S5K4ECGX=m
CONFIG_VIDEO_S5K5BAF=m
# CONFIG_VIDEO_SMIAPP is not set
CONFIG_VIDEO_ET8EK8=m
# end of Camera sensor devices

#
# Lens drivers
#
CONFIG_VIDEO_AD5820=m
CONFIG_VIDEO_AK7375=m
CONFIG_VIDEO_DW9714=m
# CONFIG_VIDEO_DW9807_VCM is not set
# end of Lens drivers

#
# Flash devices
#
# CONFIG_VIDEO_ADP1653 is not set
# CONFIG_VIDEO_LM3560 is not set
CONFIG_VIDEO_LM3646=m
# end of Flash devices

#
# SPI helper chips
#
# end of SPI helper chips

CONFIG_MEDIA_TUNER=m

#
# Customize TV tuners
#
# CONFIG_MEDIA_TUNER_SIMPLE is not set
CONFIG_MEDIA_TUNER_TDA18250=m
# CONFIG_MEDIA_TUNER_TDA8290 is not set
# CONFIG_MEDIA_TUNER_TDA827X is not set
CONFIG_MEDIA_TUNER_TDA18271=m
CONFIG_MEDIA_TUNER_TDA9887=m
# CONFIG_MEDIA_TUNER_TEA5761 is not set
CONFIG_MEDIA_TUNER_TEA5767=m
# CONFIG_MEDIA_TUNER_MT20XX is not set
CONFIG_MEDIA_TUNER_MT2060=m
# CONFIG_MEDIA_TUNER_MT2063 is not set
CONFIG_MEDIA_TUNER_MT2266=m
CONFIG_MEDIA_TUNER_MT2131=m
# CONFIG_MEDIA_TUNER_QT1010 is not set
CONFIG_MEDIA_TUNER_XC2028=m
CONFIG_MEDIA_TUNER_XC5000=m
# CONFIG_MEDIA_TUNER_XC4000 is not set
CONFIG_MEDIA_TUNER_MXL5005S=m
# CONFIG_MEDIA_TUNER_MXL5007T is not set
CONFIG_MEDIA_TUNER_MC44S803=m
CONFIG_MEDIA_TUNER_MAX2165=m
# CONFIG_MEDIA_TUNER_TDA18218 is not set
CONFIG_MEDIA_TUNER_FC0011=m
CONFIG_MEDIA_TUNER_FC0012=m
CONFIG_MEDIA_TUNER_FC0013=m
# CONFIG_MEDIA_TUNER_TDA18212 is not set
CONFIG_MEDIA_TUNER_E4000=m
CONFIG_MEDIA_TUNER_FC2580=m
# CONFIG_MEDIA_TUNER_M88RS6000T is not set
CONFIG_MEDIA_TUNER_TUA9001=m
CONFIG_MEDIA_TUNER_SI2157=m
CONFIG_MEDIA_TUNER_IT913X=m
# CONFIG_MEDIA_TUNER_R820T is not set
CONFIG_MEDIA_TUNER_MXL301RF=m
# CONFIG_MEDIA_TUNER_QM1D1C0042 is not set
CONFIG_MEDIA_TUNER_QM1D1B0004=m
# end of Customize TV tuners

#
# Customise DVB Frontends
#

#
# Multistandard (satellite) frontends
#
CONFIG_DVB_STB0899=m
# CONFIG_DVB_STB6100 is not set
CONFIG_DVB_STV090x=m
CONFIG_DVB_STV0910=m
# CONFIG_DVB_STV6110x is not set
CONFIG_DVB_STV6111=m
# CONFIG_DVB_MXL5XX is not set
# CONFIG_DVB_M88DS3103 is not set

#
# Multistandard (cable + terrestrial) frontends
#
CONFIG_DVB_DRXK=m
CONFIG_DVB_TDA18271C2DD=m
CONFIG_DVB_SI2165=m
# CONFIG_DVB_MN88472 is not set
CONFIG_DVB_MN88473=m

#
# DVB-S (satellite) frontends
#
# CONFIG_DVB_CX24110 is not set
CONFIG_DVB_CX24123=m
CONFIG_DVB_MT312=m
# CONFIG_DVB_ZL10036 is not set
# CONFIG_DVB_ZL10039 is not set
# CONFIG_DVB_S5H1420 is not set
CONFIG_DVB_STV0288=m
CONFIG_DVB_STB6000=m
CONFIG_DVB_STV0299=m
CONFIG_DVB_STV6110=m
CONFIG_DVB_STV0900=m
CONFIG_DVB_TDA8083=m
CONFIG_DVB_TDA10086=m
CONFIG_DVB_TDA8261=m
CONFIG_DVB_VES1X93=m
CONFIG_DVB_TUNER_ITD1000=m
CONFIG_DVB_TUNER_CX24113=m
# CONFIG_DVB_TDA826X is not set
CONFIG_DVB_TUA6100=m
CONFIG_DVB_CX24116=m
CONFIG_DVB_CX24117=m
# CONFIG_DVB_CX24120 is not set
CONFIG_DVB_SI21XX=m
# CONFIG_DVB_TS2020 is not set
# CONFIG_DVB_DS3000 is not set
CONFIG_DVB_MB86A16=m
CONFIG_DVB_TDA10071=m

#
# DVB-T (terrestrial) frontends
#
CONFIG_DVB_SP8870=m
CONFIG_DVB_SP887X=m
CONFIG_DVB_CX22700=m
# CONFIG_DVB_CX22702 is not set
# CONFIG_DVB_S5H1432 is not set
CONFIG_DVB_DRXD=m
CONFIG_DVB_L64781=m
CONFIG_DVB_TDA1004X=m
CONFIG_DVB_NXT6000=m
CONFIG_DVB_MT352=m
CONFIG_DVB_ZL10353=m
# CONFIG_DVB_DIB3000MB is not set
CONFIG_DVB_DIB3000MC=m
# CONFIG_DVB_DIB7000M is not set
# CONFIG_DVB_DIB7000P is not set
CONFIG_DVB_DIB9000=m
CONFIG_DVB_TDA10048=m
CONFIG_DVB_AF9013=m
CONFIG_DVB_EC100=m
CONFIG_DVB_STV0367=m
# CONFIG_DVB_CXD2820R is not set
CONFIG_DVB_CXD2841ER=m
CONFIG_DVB_RTL2830=m
CONFIG_DVB_RTL2832=m
CONFIG_DVB_RTL2832_SDR=m
CONFIG_DVB_SI2168=m
CONFIG_DVB_AS102_FE=m
CONFIG_DVB_ZD1301_DEMOD=m

#
# DVB-C (cable) frontends
#
CONFIG_DVB_VES1820=m
# CONFIG_DVB_TDA10021 is not set
# CONFIG_DVB_TDA10023 is not set
CONFIG_DVB_STV0297=m

#
# ATSC (North American/Korean Terrestrial/Cable DTV) frontends
#
CONFIG_DVB_NXT200X=m
# CONFIG_DVB_OR51211 is not set
CONFIG_DVB_OR51132=m
CONFIG_DVB_BCM3510=m
CONFIG_DVB_LGDT330X=m
# CONFIG_DVB_LGDT3305 is not set
CONFIG_DVB_LGDT3306A=m
CONFIG_DVB_LG2160=m
CONFIG_DVB_S5H1409=m
CONFIG_DVB_AU8522=m
CONFIG_DVB_AU8522_DTV=m
CONFIG_DVB_AU8522_V4L=m
CONFIG_DVB_S5H1411=m

#
# ISDB-T (terrestrial) frontends
#
# CONFIG_DVB_S921 is not set
CONFIG_DVB_DIB8000=m
CONFIG_DVB_MB86A20S=m

#
# ISDB-S (satellite) & ISDB-T (terrestrial) frontends
#
CONFIG_DVB_TC90522=m
CONFIG_DVB_MN88443X=m

#
# Digital terrestrial only tuners/PLL
#
# CONFIG_DVB_PLL is not set
CONFIG_DVB_TUNER_DIB0070=m
# CONFIG_DVB_TUNER_DIB0090 is not set

#
# SEC control devices for DVB-S
#
# CONFIG_DVB_DRX39XYJ is not set
CONFIG_DVB_LNBH25=m
CONFIG_DVB_LNBH29=m
# CONFIG_DVB_LNBP21 is not set
# CONFIG_DVB_LNBP22 is not set
CONFIG_DVB_ISL6405=m
CONFIG_DVB_ISL6421=m
# CONFIG_DVB_ISL6423 is not set
CONFIG_DVB_A8293=m
# CONFIG_DVB_LGS8GL5 is not set
# CONFIG_DVB_LGS8GXX is not set
# CONFIG_DVB_ATBM8830 is not set
CONFIG_DVB_TDA665x=m
CONFIG_DVB_IX2505V=m
CONFIG_DVB_M88RS2000=m
CONFIG_DVB_AF9033=m
CONFIG_DVB_HORUS3A=m
CONFIG_DVB_ASCOT2E=m
CONFIG_DVB_HELENE=m

#
# Common Interface (EN50221) controller drivers
#
CONFIG_DVB_CXD2099=m
# CONFIG_DVB_SP2 is not set
# end of Customise DVB Frontends

#
# Tools to develop new frontends
#
# CONFIG_DVB_DUMMY_FE is not set
# end of Media ancillary drivers

#
# Graphics support
#
# CONFIG_DRM is not set

#
# ARM devices
#
# end of ARM devices

#
# Frame buffer Devices
#
# CONFIG_FB is not set
# end of Frame buffer Devices

#
# Backlight & LCD device support
#
CONFIG_LCD_CLASS_DEVICE=m
CONFIG_LCD_PLATFORM=m
CONFIG_BACKLIGHT_CLASS_DEVICE=m
CONFIG_BACKLIGHT_GENERIC=m
# CONFIG_BACKLIGHT_LM3533 is not set
# CONFIG_BACKLIGHT_DA9052 is not set
CONFIG_BACKLIGHT_MAX8925=m
# CONFIG_BACKLIGHT_QCOM_WLED is not set
CONFIG_BACKLIGHT_SAHARA=m
CONFIG_BACKLIGHT_ADP5520=m
# CONFIG_BACKLIGHT_ADP8860 is not set
CONFIG_BACKLIGHT_ADP8870=m
CONFIG_BACKLIGHT_PCF50633=m
# CONFIG_BACKLIGHT_AAT2870 is not set
# CONFIG_BACKLIGHT_LM3639 is not set
CONFIG_BACKLIGHT_TPS65217=m
# CONFIG_BACKLIGHT_AS3711 is not set
CONFIG_BACKLIGHT_GPIO=m
CONFIG_BACKLIGHT_LV5207LP=m
CONFIG_BACKLIGHT_BD6107=m
CONFIG_BACKLIGHT_ARCXCNN=m
CONFIG_BACKLIGHT_RAVE_SP=m
# CONFIG_BACKLIGHT_LED is not set
# end of Backlight & LCD device support

CONFIG_HDMI=y

#
# Console display driver support
#
CONFIG_VGA_CONSOLE=y
# CONFIG_VGACON_SOFT_SCROLLBACK is not set
CONFIG_DUMMY_CONSOLE=y
CONFIG_DUMMY_CONSOLE_COLUMNS=80
CONFIG_DUMMY_CONSOLE_ROWS=25
# end of Console display driver support
# end of Graphics support

# CONFIG_SOUND is not set

#
# HID support
#
CONFIG_HID=y
# CONFIG_HID_BATTERY_STRENGTH is not set
CONFIG_HIDRAW=y
CONFIG_UHID=m
CONFIG_HID_GENERIC=m

#
# Special HID drivers
#
CONFIG_HID_A4TECH=m
# CONFIG_HID_ACCUTOUCH is not set
# CONFIG_HID_ACRUX is not set
CONFIG_HID_APPLE=m
# CONFIG_HID_APPLEIR is not set
CONFIG_HID_ASUS=y
CONFIG_HID_AUREAL=m
# CONFIG_HID_BELKIN is not set
# CONFIG_HID_BETOP_FF is not set
# CONFIG_HID_BIGBEN_FF is not set
CONFIG_HID_CHERRY=y
CONFIG_HID_CHICONY=y
CONFIG_HID_CORSAIR=m
# CONFIG_HID_COUGAR is not set
CONFIG_HID_MACALLY=y
CONFIG_HID_CMEDIA=m
CONFIG_HID_CP2112=y
# CONFIG_HID_CREATIVE_SB0540 is not set
CONFIG_HID_CYPRESS=m
CONFIG_HID_DRAGONRISE=m
# CONFIG_DRAGONRISE_FF is not set
CONFIG_HID_EMS_FF=y
CONFIG_HID_ELAN=m
# CONFIG_HID_ELECOM is not set
# CONFIG_HID_ELO is not set
# CONFIG_HID_EZKEY is not set
CONFIG_HID_GEMBIRD=m
# CONFIG_HID_GFRM is not set
# CONFIG_HID_GLORIOUS is not set
# CONFIG_HID_HOLTEK is not set
CONFIG_HID_GT683R=y
CONFIG_HID_KEYTOUCH=m
# CONFIG_HID_KYE is not set
# CONFIG_HID_UCLOGIC is not set
# CONFIG_HID_WALTOP is not set
# CONFIG_HID_VIEWSONIC is not set
CONFIG_HID_GYRATION=y
CONFIG_HID_ICADE=m
CONFIG_HID_ITE=m
CONFIG_HID_JABRA=y
CONFIG_HID_TWINHAN=y
CONFIG_HID_KENSINGTON=m
# CONFIG_HID_LCPOWER is not set
CONFIG_HID_LED=y
CONFIG_HID_LENOVO=y
CONFIG_HID_LOGITECH=y
CONFIG_HID_LOGITECH_DJ=m
CONFIG_HID_LOGITECH_HIDPP=m
CONFIG_LOGITECH_FF=y
CONFIG_LOGIRUMBLEPAD2_FF=y
CONFIG_LOGIG940_FF=y
# CONFIG_LOGIWHEELS_FF is not set
CONFIG_HID_MAGICMOUSE=y
CONFIG_HID_MALTRON=y
CONFIG_HID_MAYFLASH=m
# CONFIG_HID_REDRAGON is not set
CONFIG_HID_MICROSOFT=y
# CONFIG_HID_MONTEREY is not set
# CONFIG_HID_MULTITOUCH is not set
# CONFIG_HID_NTI is not set
# CONFIG_HID_NTRIG is not set
CONFIG_HID_ORTEK=y
# CONFIG_HID_PANTHERLORD is not set
# CONFIG_HID_PENMOUNT is not set
CONFIG_HID_PETALYNX=y
CONFIG_HID_PICOLCD=y
CONFIG_HID_PICOLCD_LEDS=y
CONFIG_HID_PICOLCD_CIR=y
CONFIG_HID_PLANTRONICS=y
CONFIG_HID_PRIMAX=m
# CONFIG_HID_RETRODE is not set
CONFIG_HID_ROCCAT=m
CONFIG_HID_SAITEK=m
# CONFIG_HID_SAMSUNG is not set
CONFIG_HID_SONY=m
CONFIG_SONY_FF=y
CONFIG_HID_SPEEDLINK=m
CONFIG_HID_STEAM=y
CONFIG_HID_STEELSERIES=m
# CONFIG_HID_SUNPLUS is not set
CONFIG_HID_RMI=m
CONFIG_HID_GREENASIA=m
# CONFIG_GREENASIA_FF is not set
CONFIG_HID_SMARTJOYPLUS=y
# CONFIG_SMARTJOYPLUS_FF is not set
# CONFIG_HID_TIVO is not set
CONFIG_HID_TOPSEED=y
CONFIG_HID_THINGM=y
CONFIG_HID_THRUSTMASTER=y
# CONFIG_THRUSTMASTER_FF is not set
# CONFIG_HID_UDRAW_PS3 is not set
CONFIG_HID_U2FZERO=y
CONFIG_HID_WACOM=y
CONFIG_HID_WIIMOTE=y
# CONFIG_HID_XINMO is not set
CONFIG_HID_ZEROPLUS=y
CONFIG_ZEROPLUS_FF=y
CONFIG_HID_ZYDACRON=y
CONFIG_HID_SENSOR_HUB=y
CONFIG_HID_SENSOR_CUSTOM_SENSOR=m
# CONFIG_HID_ALPS is not set
CONFIG_HID_MCP2221=m
# end of Special HID drivers

#
# USB HID support
#
CONFIG_USB_HID=y
CONFIG_HID_PID=y
CONFIG_USB_HIDDEV=y
# end of USB HID support

#
# I2C HID support
#
CONFIG_I2C_HID=y
# end of I2C HID support
# end of HID support

CONFIG_USB_OHCI_LITTLE_ENDIAN=y
CONFIG_USB_SUPPORT=y
CONFIG_USB_COMMON=y
# CONFIG_USB_LED_TRIG is not set
CONFIG_USB_ULPI_BUS=y
# CONFIG_USB_CONN_GPIO is not set
CONFIG_USB_ARCH_HAS_HCD=y
CONFIG_USB=y
CONFIG_USB_ANNOUNCE_NEW_DEVICES=y

#
# Miscellaneous USB options
#
# CONFIG_USB_DEFAULT_PERSIST is not set
# CONFIG_USB_DYNAMIC_MINORS is not set
# CONFIG_USB_OTG is not set
CONFIG_USB_OTG_PRODUCTLIST=y
# CONFIG_USB_LEDS_TRIGGER_USBPORT is not set
CONFIG_USB_AUTOSUSPEND_DELAY=2
CONFIG_USB_MON=m

#
# USB Host Controller Drivers
#
CONFIG_USB_C67X00_HCD=y
CONFIG_USB_XHCI_HCD=m
# CONFIG_USB_XHCI_DBGCAP is not set
CONFIG_USB_XHCI_PCI_RENESAS=m
CONFIG_USB_XHCI_PLATFORM=m
# CONFIG_USB_EHCI_HCD is not set
# CONFIG_USB_OXU210HP_HCD is not set
CONFIG_USB_ISP116X_HCD=m
CONFIG_USB_FOTG210_HCD=m
# CONFIG_USB_OHCI_HCD is not set
# CONFIG_USB_SL811_HCD is not set
CONFIG_USB_R8A66597_HCD=m
CONFIG_USB_HCD_SSB=m
# CONFIG_USB_HCD_TEST_MODE is not set

#
# USB Device Class drivers
#
CONFIG_USB_ACM=y
CONFIG_USB_PRINTER=y
CONFIG_USB_WDM=m
CONFIG_USB_TMC=y

#
# NOTE: USB_STORAGE depends on SCSI but BLK_DEV_SD may
#

#
# also be needed; see USB_STORAGE Help for more info
#
CONFIG_USB_STORAGE=y
CONFIG_USB_STORAGE_DEBUG=y
CONFIG_USB_STORAGE_REALTEK=y
CONFIG_REALTEK_AUTOPM=y
CONFIG_USB_STORAGE_DATAFAB=y
# CONFIG_USB_STORAGE_FREECOM is not set
CONFIG_USB_STORAGE_ISD200=y
CONFIG_USB_STORAGE_USBAT=m
# CONFIG_USB_STORAGE_SDDR09 is not set
CONFIG_USB_STORAGE_SDDR55=y
# CONFIG_USB_STORAGE_JUMPSHOT is not set
CONFIG_USB_STORAGE_ALAUDA=y
CONFIG_USB_STORAGE_ONETOUCH=y
CONFIG_USB_STORAGE_KARMA=y
CONFIG_USB_STORAGE_CYPRESS_ATACB=m
CONFIG_USB_STORAGE_ENE_UB6250=m
# CONFIG_USB_UAS is not set

#
# USB Imaging devices
#
CONFIG_USB_MDC800=m
CONFIG_USB_MICROTEK=m
# CONFIG_USB_CDNS3 is not set
# CONFIG_USB_MUSB_HDRC is not set
CONFIG_USB_DWC3=m
CONFIG_USB_DWC3_ULPI=y
# CONFIG_USB_DWC3_HOST is not set
CONFIG_USB_DWC3_GADGET=y
# CONFIG_USB_DWC3_DUAL_ROLE is not set

#
# Platform Glue Driver Support
#
CONFIG_USB_DWC3_OF_SIMPLE=m
CONFIG_USB_DWC2=y
CONFIG_USB_DWC2_HOST=y

#
# Gadget/Dual-role mode requires USB Gadget support to be enabled
#
CONFIG_USB_DWC2_DEBUG=y
# CONFIG_USB_DWC2_VERBOSE is not set
# CONFIG_USB_DWC2_TRACK_MISSED_SOFS is not set
CONFIG_USB_DWC2_DEBUG_PERIODIC=y
CONFIG_USB_CHIPIDEA=m
# CONFIG_USB_CHIPIDEA_UDC is not set
CONFIG_USB_CHIPIDEA_MSM=m
CONFIG_USB_CHIPIDEA_IMX=m
CONFIG_USB_CHIPIDEA_GENERIC=m
CONFIG_USB_ISP1760=m
CONFIG_USB_ISP1761_UDC=y
# CONFIG_USB_ISP1760_HOST_ROLE is not set
CONFIG_USB_ISP1760_GADGET_ROLE=y
# CONFIG_USB_ISP1760_DUAL_ROLE is not set

#
# USB port drivers
#
CONFIG_USB_USS720=m
CONFIG_USB_SERIAL=y
CONFIG_USB_SERIAL_CONSOLE=y
CONFIG_USB_SERIAL_GENERIC=y
CONFIG_USB_SERIAL_SIMPLE=y
# CONFIG_USB_SERIAL_AIRCABLE is not set
CONFIG_USB_SERIAL_ARK3116=m
CONFIG_USB_SERIAL_BELKIN=m
CONFIG_USB_SERIAL_CH341=y
CONFIG_USB_SERIAL_WHITEHEAT=y
CONFIG_USB_SERIAL_DIGI_ACCELEPORT=m
# CONFIG_USB_SERIAL_CP210X is not set
# CONFIG_USB_SERIAL_CYPRESS_M8 is not set
CONFIG_USB_SERIAL_EMPEG=m
# CONFIG_USB_SERIAL_FTDI_SIO is not set
CONFIG_USB_SERIAL_VISOR=m
CONFIG_USB_SERIAL_IPAQ=m
CONFIG_USB_SERIAL_IR=m
# CONFIG_USB_SERIAL_EDGEPORT is not set
CONFIG_USB_SERIAL_EDGEPORT_TI=y
CONFIG_USB_SERIAL_F81232=y
CONFIG_USB_SERIAL_F8153X=m
CONFIG_USB_SERIAL_GARMIN=m
CONFIG_USB_SERIAL_IPW=m
CONFIG_USB_SERIAL_IUU=m
CONFIG_USB_SERIAL_KEYSPAN_PDA=m
CONFIG_USB_SERIAL_KEYSPAN=m
CONFIG_USB_SERIAL_KLSI=m
# CONFIG_USB_SERIAL_KOBIL_SCT is not set
CONFIG_USB_SERIAL_MCT_U232=y
CONFIG_USB_SERIAL_METRO=m
CONFIG_USB_SERIAL_MOS7720=y
# CONFIG_USB_SERIAL_MOS7840 is not set
# CONFIG_USB_SERIAL_MXUPORT is not set
# CONFIG_USB_SERIAL_NAVMAN is not set
CONFIG_USB_SERIAL_PL2303=m
# CONFIG_USB_SERIAL_OTI6858 is not set
CONFIG_USB_SERIAL_QCAUX=y
CONFIG_USB_SERIAL_QUALCOMM=m
CONFIG_USB_SERIAL_SPCP8X5=m
# CONFIG_USB_SERIAL_SAFE is not set
CONFIG_USB_SERIAL_SIERRAWIRELESS=y
CONFIG_USB_SERIAL_SYMBOL=m
CONFIG_USB_SERIAL_TI=y
CONFIG_USB_SERIAL_CYBERJACK=y
# CONFIG_USB_SERIAL_XIRCOM is not set
CONFIG_USB_SERIAL_WWAN=y
CONFIG_USB_SERIAL_OPTION=y
CONFIG_USB_SERIAL_OMNINET=y
# CONFIG_USB_SERIAL_OPTICON is not set
CONFIG_USB_SERIAL_XSENS_MT=y
CONFIG_USB_SERIAL_WISHBONE=m
# CONFIG_USB_SERIAL_SSU100 is not set
CONFIG_USB_SERIAL_QT2=m
CONFIG_USB_SERIAL_UPD78F0730=y
# CONFIG_USB_SERIAL_DEBUG is not set

#
# USB Miscellaneous drivers
#
CONFIG_USB_EMI62=y
CONFIG_USB_EMI26=m
# CONFIG_USB_ADUTUX is not set
# CONFIG_USB_SEVSEG is not set
CONFIG_USB_LEGOTOWER=m
# CONFIG_USB_LCD is not set
CONFIG_USB_CYPRESS_CY7C63=y
# CONFIG_USB_CYTHERM is not set
CONFIG_USB_IDMOUSE=m
# CONFIG_USB_FTDI_ELAN is not set
# CONFIG_USB_APPLEDISPLAY is not set
CONFIG_APPLE_MFI_FASTCHARGE=y
CONFIG_USB_LD=m
# CONFIG_USB_TRANCEVIBRATOR is not set
# CONFIG_USB_IOWARRIOR is not set
CONFIG_USB_TEST=m
CONFIG_USB_EHSET_TEST_FIXTURE=y
CONFIG_USB_ISIGHTFW=y
# CONFIG_USB_YUREX is not set
CONFIG_USB_EZUSB_FX2=y
# CONFIG_USB_HUB_USB251XB is not set
CONFIG_USB_HSIC_USB3503=y
# CONFIG_USB_HSIC_USB4604 is not set
# CONFIG_USB_LINK_LAYER_TEST is not set
# CONFIG_USB_CHAOSKEY is not set

#
# USB Physical Layer drivers
#
CONFIG_USB_PHY=y
# CONFIG_NOP_USB_XCEIV is not set
# CONFIG_USB_GPIO_VBUS is not set
CONFIG_TAHVO_USB=m
# CONFIG_TAHVO_USB_HOST_BY_DEFAULT is not set
CONFIG_USB_ISP1301=y
# end of USB Physical Layer drivers

CONFIG_USB_GADGET=m
CONFIG_USB_GADGET_DEBUG_FILES=y
CONFIG_USB_GADGET_DEBUG_FS=y
CONFIG_USB_GADGET_VBUS_DRAW=2
CONFIG_USB_GADGET_STORAGE_NUM_BUFFERS=2
# CONFIG_U_SERIAL_CONSOLE is not set

#
# USB Peripheral Controller
#
# CONFIG_USB_FOTG210_UDC is not set
CONFIG_USB_GR_UDC=m
# CONFIG_USB_R8A66597 is not set
CONFIG_USB_PXA27X=m
CONFIG_USB_MV_UDC=m
# CONFIG_USB_MV_U3D is not set
# CONFIG_USB_SNP_UDC_PLAT is not set
# CONFIG_USB_M66592 is not set
CONFIG_USB_BDC_UDC=m

#
# Platform Support
#
CONFIG_USB_NET2272=m
# CONFIG_USB_NET2272_DMA is not set
CONFIG_USB_GADGET_XILINX=m
CONFIG_USB_DUMMY_HCD=m
# end of USB Peripheral Controller

CONFIG_USB_LIBCOMPOSITE=m
CONFIG_USB_F_ACM=m
CONFIG_USB_F_SS_LB=m
CONFIG_USB_U_SERIAL=m
CONFIG_USB_F_MASS_STORAGE=m
CONFIG_USB_F_HID=m
CONFIG_USB_F_PRINTER=m
# CONFIG_USB_CONFIGFS is not set

#
# USB Gadget precomposed configurations
#
CONFIG_USB_ZERO=m
CONFIG_USB_GADGETFS=m
# CONFIG_USB_FUNCTIONFS is not set
# CONFIG_USB_MASS_STORAGE is not set
# CONFIG_USB_GADGET_TARGET is not set
# CONFIG_USB_G_SERIAL is not set
CONFIG_USB_G_PRINTER=m
CONFIG_USB_G_ACM_MS=m
CONFIG_USB_G_HID=m
# CONFIG_USB_G_DBGP is not set
# CONFIG_USB_G_WEBCAM is not set
CONFIG_USB_RAW_GADGET=m
# end of USB Gadget precomposed configurations

CONFIG_TYPEC=y
CONFIG_TYPEC_TCPM=y
# CONFIG_TYPEC_TCPCI is not set
CONFIG_TYPEC_FUSB302=m
# CONFIG_TYPEC_UCSI is not set
# CONFIG_TYPEC_HD3SS3220 is not set
CONFIG_TYPEC_TPS6598X=m

#
# USB Type-C Multiplexer/DeMultiplexer Switch support
#
CONFIG_TYPEC_MUX_PI3USB30532=y
# end of USB Type-C Multiplexer/DeMultiplexer Switch support

#
# USB Type-C Alternate Mode drivers
#
CONFIG_TYPEC_DP_ALTMODE=y
CONFIG_TYPEC_NVIDIA_ALTMODE=m
# end of USB Type-C Alternate Mode drivers

CONFIG_USB_ROLE_SWITCH=y
# CONFIG_MMC is not set
CONFIG_MEMSTICK=y
CONFIG_MEMSTICK_DEBUG=y

#
# MemoryStick drivers
#
# CONFIG_MEMSTICK_UNSAFE_RESUME is not set
CONFIG_MSPRO_BLOCK=m
# CONFIG_MS_BLOCK is not set

#
# MemoryStick Host Controller Drivers
#
CONFIG_MEMSTICK_REALTEK_USB=y
CONFIG_NEW_LEDS=y
CONFIG_LEDS_CLASS=y
# CONFIG_LEDS_CLASS_FLASH is not set
CONFIG_LEDS_BRIGHTNESS_HW_CHANGED=y

#
# LED drivers
#
CONFIG_LEDS_AN30259A=y
# CONFIG_LEDS_APU is not set
CONFIG_LEDS_AW2013=m
# CONFIG_LEDS_BCM6328 is not set
CONFIG_LEDS_BCM6358=y
# CONFIG_LEDS_LM3530 is not set
CONFIG_LEDS_LM3532=y
CONFIG_LEDS_LM3533=m
# CONFIG_LEDS_LM3642 is not set
CONFIG_LEDS_LM3692X=m
# CONFIG_LEDS_MT6323 is not set
CONFIG_LEDS_PCA9532=y
CONFIG_LEDS_PCA9532_GPIO=y
CONFIG_LEDS_GPIO=y
# CONFIG_LEDS_LP3944 is not set
CONFIG_LEDS_LP3952=m
CONFIG_LEDS_LP55XX_COMMON=y
CONFIG_LEDS_LP5521=y
CONFIG_LEDS_LP5523=m
CONFIG_LEDS_LP5562=y
# CONFIG_LEDS_LP8501 is not set
CONFIG_LEDS_LP8860=m
CONFIG_LEDS_CLEVO_MAIL=y
CONFIG_LEDS_PCA955X=y
# CONFIG_LEDS_PCA955X_GPIO is not set
CONFIG_LEDS_PCA963X=m
# CONFIG_LEDS_WM8350 is not set
CONFIG_LEDS_DA9052=m
# CONFIG_LEDS_REGULATOR is not set
CONFIG_LEDS_BD2802=y
CONFIG_LEDS_LT3593=y
CONFIG_LEDS_ADP5520=m
CONFIG_LEDS_MC13783=m
CONFIG_LEDS_TCA6507=m
CONFIG_LEDS_TLC591XX=m
CONFIG_LEDS_MAX77650=y
CONFIG_LEDS_MAX8997=y
CONFIG_LEDS_LM355x=m
# CONFIG_LEDS_OT200 is not set
CONFIG_LEDS_MENF21BMC=m
CONFIG_LEDS_IS31FL319X=y
CONFIG_LEDS_IS31FL32XX=m

#
# LED driver for blink(1) USB RGB LED is under Special HID drivers (HID_THINGM)
#
# CONFIG_LEDS_BLINKM is not set
# CONFIG_LEDS_SYSCON is not set
CONFIG_LEDS_MLXCPLD=m
CONFIG_LEDS_MLXREG=y
CONFIG_LEDS_USER=y
# CONFIG_LEDS_TI_LMU_COMMON is not set

#
# LED Triggers
#
CONFIG_LEDS_TRIGGERS=y
CONFIG_LEDS_TRIGGER_TIMER=m
CONFIG_LEDS_TRIGGER_ONESHOT=m
CONFIG_LEDS_TRIGGER_DISK=y
# CONFIG_LEDS_TRIGGER_MTD is not set
# CONFIG_LEDS_TRIGGER_HEARTBEAT is not set
# CONFIG_LEDS_TRIGGER_BACKLIGHT is not set
CONFIG_LEDS_TRIGGER_CPU=y
CONFIG_LEDS_TRIGGER_ACTIVITY=y
CONFIG_LEDS_TRIGGER_GPIO=m
CONFIG_LEDS_TRIGGER_DEFAULT_ON=y

#
# iptables trigger is under Netfilter config (LED target)
#
CONFIG_LEDS_TRIGGER_TRANSIENT=m
CONFIG_LEDS_TRIGGER_CAMERA=m
CONFIG_LEDS_TRIGGER_PANIC=y
# CONFIG_LEDS_TRIGGER_PATTERN is not set
CONFIG_LEDS_TRIGGER_AUDIO=m
CONFIG_ACCESSIBILITY=y
# CONFIG_A11Y_BRAILLE_CONSOLE is not set
CONFIG_EDAC_ATOMIC_SCRUB=y
CONFIG_EDAC_SUPPORT=y
CONFIG_RTC_LIB=y
CONFIG_RTC_MC146818_LIB=y
# CONFIG_RTC_CLASS is not set
# CONFIG_DMADEVICES is not set

#
# DMABUF options
#
CONFIG_SYNC_FILE=y
# CONFIG_SW_SYNC is not set
# CONFIG_UDMABUF is not set
# CONFIG_DMABUF_MOVE_NOTIFY is not set
CONFIG_DMABUF_SELFTESTS=m
# CONFIG_DMABUF_HEAPS is not set
# end of DMABUF options

CONFIG_AUXDISPLAY=y
# CONFIG_HD44780 is not set
# CONFIG_IMG_ASCII_LCD is not set
CONFIG_PARPORT_PANEL=m
CONFIG_PANEL_PARPORT=0
CONFIG_PANEL_PROFILE=5
# CONFIG_PANEL_CHANGE_MESSAGE is not set
CONFIG_CHARLCD_BL_OFF=y
# CONFIG_CHARLCD_BL_ON is not set
# CONFIG_CHARLCD_BL_FLASH is not set
CONFIG_PANEL=m
CONFIG_CHARLCD=m
CONFIG_UIO=y
CONFIG_UIO_PDRV_GENIRQ=m
CONFIG_UIO_DMEM_GENIRQ=y
CONFIG_UIO_PRUSS=y
CONFIG_VIRT_DRIVERS=y
CONFIG_VIRTIO=y
CONFIG_VIRTIO_MENU=y
CONFIG_VIRTIO_VDPA=y
# CONFIG_VIRTIO_BALLOON is not set
CONFIG_VIRTIO_INPUT=y
CONFIG_VIRTIO_MMIO=m
# CONFIG_VIRTIO_MMIO_CMDLINE_DEVICES is not set
CONFIG_VDPA=y
# CONFIG_VHOST_MENU is not set

#
# Microsoft Hyper-V guest support
#
# end of Microsoft Hyper-V guest support

CONFIG_GREYBUS=y
CONFIG_GREYBUS_ES2=y
CONFIG_STAGING=y
CONFIG_COMEDI=y
# CONFIG_COMEDI_DEBUG is not set
CONFIG_COMEDI_DEFAULT_BUF_SIZE_KB=2048
CONFIG_COMEDI_DEFAULT_BUF_MAXSIZE_KB=20480
# CONFIG_COMEDI_MISC_DRIVERS is not set
CONFIG_COMEDI_ISA_DRIVERS=y
# CONFIG_COMEDI_PCL711 is not set
CONFIG_COMEDI_PCL724=m
CONFIG_COMEDI_PCL726=m
CONFIG_COMEDI_PCL730=y
CONFIG_COMEDI_PCL812=y
CONFIG_COMEDI_PCL816=y
CONFIG_COMEDI_PCL818=y
CONFIG_COMEDI_PCM3724=m
CONFIG_COMEDI_AMPLC_DIO200_ISA=m
# CONFIG_COMEDI_AMPLC_PC236_ISA is not set
# CONFIG_COMEDI_AMPLC_PC263_ISA is not set
CONFIG_COMEDI_RTI800=y
# CONFIG_COMEDI_RTI802 is not set
# CONFIG_COMEDI_DAC02 is not set
# CONFIG_COMEDI_DAS16M1 is not set
CONFIG_COMEDI_DAS08_ISA=y
CONFIG_COMEDI_DAS16=y
CONFIG_COMEDI_DAS800=m
CONFIG_COMEDI_DAS1800=m
CONFIG_COMEDI_DAS6402=m
# CONFIG_COMEDI_DT2801 is not set
CONFIG_COMEDI_DT2811=m
CONFIG_COMEDI_DT2814=y
CONFIG_COMEDI_DT2815=y
# CONFIG_COMEDI_DT2817 is not set
CONFIG_COMEDI_DT282X=y
CONFIG_COMEDI_DMM32AT=y
# CONFIG_COMEDI_FL512 is not set
CONFIG_COMEDI_AIO_AIO12_8=y
CONFIG_COMEDI_AIO_IIRO_16=m
CONFIG_COMEDI_II_PCI20KC=y
CONFIG_COMEDI_C6XDIGIO=m
CONFIG_COMEDI_MPC624=m
# CONFIG_COMEDI_ADQ12B is not set
CONFIG_COMEDI_NI_AT_A2150=y
CONFIG_COMEDI_NI_AT_AO=m
# CONFIG_COMEDI_NI_ATMIO is not set
CONFIG_COMEDI_NI_ATMIO16D=m
CONFIG_COMEDI_NI_LABPC_ISA=y
CONFIG_COMEDI_PCMAD=m
CONFIG_COMEDI_PCMDA12=y
CONFIG_COMEDI_PCMMIO=m
# CONFIG_COMEDI_PCMUIO is not set
CONFIG_COMEDI_MULTIQ3=y
# CONFIG_COMEDI_S526 is not set
# CONFIG_COMEDI_PCMCIA_DRIVERS is not set
CONFIG_COMEDI_USB_DRIVERS=y
CONFIG_COMEDI_DT9812=y
# CONFIG_COMEDI_NI_USB6501 is not set
# CONFIG_COMEDI_USBDUX is not set
CONFIG_COMEDI_USBDUXFAST=y
CONFIG_COMEDI_USBDUXSIGMA=y
# CONFIG_COMEDI_VMK80XX is not set
CONFIG_COMEDI_8254=y
CONFIG_COMEDI_8255=y
CONFIG_COMEDI_8255_SA=y
CONFIG_COMEDI_KCOMEDILIB=m
CONFIG_COMEDI_AMPLC_DIO200=m
CONFIG_COMEDI_DAS08=y
CONFIG_COMEDI_ISADMA=y
CONFIG_COMEDI_NI_LABPC=y
CONFIG_COMEDI_NI_LABPC_ISADMA=y

#
# IIO staging drivers
#

#
# Accelerometers
#
# end of Accelerometers

#
# Analog to digital converters
#
# end of Analog to digital converters

#
# Analog digital bi-direction converters
#
CONFIG_ADT7316=m
# CONFIG_ADT7316_I2C is not set
# end of Analog digital bi-direction converters

#
# Capacitance to digital converters
#
CONFIG_AD7150=m
CONFIG_AD7746=m
# end of Capacitance to digital converters

#
# Direct Digital Synthesis
#
# end of Direct Digital Synthesis

#
# Network Analyzer, Impedance Converters
#
# CONFIG_AD5933 is not set
# end of Network Analyzer, Impedance Converters

#
# Active energy metering IC
#
CONFIG_ADE7854=m
# CONFIG_ADE7854_I2C is not set
# end of Active energy metering IC

#
# Resolver to digital converters
#
# end of Resolver to digital converters
# end of IIO staging drivers

#
# Speakup console speech
#
CONFIG_SPEAKUP=y
CONFIG_SPEAKUP_SYNTH_ACNTSA=y
# CONFIG_SPEAKUP_SYNTH_APOLLO is not set
CONFIG_SPEAKUP_SYNTH_AUDPTR=m
# CONFIG_SPEAKUP_SYNTH_BNS is not set
# CONFIG_SPEAKUP_SYNTH_DECTLK is not set
CONFIG_SPEAKUP_SYNTH_DECEXT=m
# CONFIG_SPEAKUP_SYNTH_LTLK is not set
CONFIG_SPEAKUP_SYNTH_SOFT=m
CONFIG_SPEAKUP_SYNTH_SPKOUT=y
# CONFIG_SPEAKUP_SYNTH_TXPRT is not set
CONFIG_SPEAKUP_SYNTH_DUMMY=m
# end of Speakup console speech

# CONFIG_STAGING_MEDIA is not set

#
# Android
#
# CONFIG_ASHMEM is not set
CONFIG_ION=y
# CONFIG_ION_SYSTEM_HEAP is not set
# end of Android

# CONFIG_STAGING_BOARD is not set
CONFIG_GOLDFISH_AUDIO=m
CONFIG_GS_FPGABOOT=y
CONFIG_UNISYSSPAR=y
CONFIG_MOST_COMPONENTS=y
# CONFIG_MOST_CDEV is not set
# CONFIG_MOST_VIDEO is not set
# CONFIG_MOST_DIM2 is not set
# CONFIG_MOST_I2C is not set
CONFIG_GREYBUS_BOOTROM=m
# CONFIG_GREYBUS_HID is not set
CONFIG_GREYBUS_LIGHT=y
CONFIG_GREYBUS_LOG=y
CONFIG_GREYBUS_LOOPBACK=m
# CONFIG_GREYBUS_POWER is not set
CONFIG_GREYBUS_RAW=y
CONFIG_GREYBUS_VIBRATOR=y
CONFIG_GREYBUS_BRIDGED_PHY=m
CONFIG_GREYBUS_GPIO=m
# CONFIG_GREYBUS_I2C is not set
CONFIG_GREYBUS_UART=m
# CONFIG_GREYBUS_USB is not set

#
# Gasket devices
#
# end of Gasket devices

# CONFIG_XIL_AXIS_FIFO is not set
CONFIG_FIELDBUS_DEV=y
CONFIG_HMS_ANYBUSS_BUS=y
# CONFIG_ARCX_ANYBUS_CONTROLLER is not set
CONFIG_HMS_PROFINET=m
# CONFIG_X86_PLATFORM_DEVICES is not set
CONFIG_GOLDFISH_PIPE=y
# CONFIG_MFD_CROS_EC is not set
# CONFIG_CHROME_PLATFORMS is not set
CONFIG_MELLANOX_PLATFORM=y
CONFIG_MLXREG_HOTPLUG=y
# CONFIG_MLXREG_IO is not set
CONFIG_HAVE_CLK=y
CONFIG_CLKDEV_LOOKUP=y
CONFIG_HAVE_CLK_PREPARE=y
CONFIG_COMMON_CLK=y
CONFIG_COMMON_CLK_MAX77686=y
CONFIG_COMMON_CLK_MAX9485=m
# CONFIG_COMMON_CLK_RK808 is not set
CONFIG_COMMON_CLK_SI5341=y
CONFIG_COMMON_CLK_SI5351=m
# CONFIG_COMMON_CLK_SI514 is not set
CONFIG_COMMON_CLK_SI544=m
CONFIG_COMMON_CLK_SI570=y
CONFIG_COMMON_CLK_CDCE706=m
CONFIG_COMMON_CLK_CDCE925=y
CONFIG_COMMON_CLK_CS2000_CP=y
# CONFIG_COMMON_CLK_S2MPS11 is not set
# CONFIG_COMMON_CLK_LOCHNAGAR is not set
CONFIG_COMMON_CLK_VC5=y
# CONFIG_COMMON_CLK_BD718XX is not set
CONFIG_COMMON_CLK_FIXED_MMIO=y
# CONFIG_CLK_LGM_CGU is not set
CONFIG_HWSPINLOCK=y

#
# Clock Source drivers
#
CONFIG_TIMER_OF=y
CONFIG_TIMER_PROBE=y
CONFIG_CLKSRC_I8253=y
CONFIG_CLKEVT_I8253=y
CONFIG_I8253_LOCK=y
CONFIG_CLKBLD_I8253=y
CONFIG_CLKSRC_MMIO=y
CONFIG_MICROCHIP_PIT64B=y
# end of Clock Source drivers

# CONFIG_MAILBOX is not set
CONFIG_IOMMU_SUPPORT=y

#
# Generic IOMMU Pagetable Support
#
# end of Generic IOMMU Pagetable Support

# CONFIG_IOMMU_DEBUGFS is not set

#
# Remoteproc drivers
#
# CONFIG_REMOTEPROC is not set
# end of Remoteproc drivers

#
# Rpmsg drivers
#
CONFIG_RPMSG=m
CONFIG_RPMSG_VIRTIO=m
# end of Rpmsg drivers

CONFIG_SOUNDWIRE=m

#
# SoundWire Devices
#

#
# SOC (System On Chip) specific Drivers
#

#
# Amlogic SoC drivers
#
# end of Amlogic SoC drivers

#
# Aspeed SoC drivers
#
# end of Aspeed SoC drivers

#
# Broadcom SoC drivers
#
# end of Broadcom SoC drivers

#
# NXP/Freescale QorIQ SoC drivers
#
# end of NXP/Freescale QorIQ SoC drivers

#
# i.MX SoC drivers
#
# end of i.MX SoC drivers

#
# Qualcomm SoC drivers
#
# end of Qualcomm SoC drivers

CONFIG_SOC_TI=y

#
# Xilinx SoC drivers
#
CONFIG_XILINX_VCU=y
# end of Xilinx SoC drivers
# end of SOC (System On Chip) specific Drivers

CONFIG_PM_DEVFREQ=y

#
# DEVFREQ Governors
#
CONFIG_DEVFREQ_GOV_SIMPLE_ONDEMAND=m
# CONFIG_DEVFREQ_GOV_PERFORMANCE is not set
CONFIG_DEVFREQ_GOV_POWERSAVE=m
CONFIG_DEVFREQ_GOV_USERSPACE=m
CONFIG_DEVFREQ_GOV_PASSIVE=y

#
# DEVFREQ Drivers
#
CONFIG_PM_DEVFREQ_EVENT=y
CONFIG_EXTCON=y

#
# Extcon Device Drivers
#
CONFIG_EXTCON_ADC_JACK=m
CONFIG_EXTCON_FSA9480=y
CONFIG_EXTCON_GPIO=y
CONFIG_EXTCON_MAX14577=m
CONFIG_EXTCON_MAX3355=y
CONFIG_EXTCON_MAX77843=y
CONFIG_EXTCON_MAX8997=y
CONFIG_EXTCON_PTN5150=y
# CONFIG_EXTCON_RT8973A is not set
CONFIG_EXTCON_SM5502=m
CONFIG_EXTCON_USB_GPIO=y
# CONFIG_MEMORY is not set
CONFIG_IIO=m
CONFIG_IIO_BUFFER=y
CONFIG_IIO_BUFFER_CB=m
CONFIG_IIO_BUFFER_DMA=m
CONFIG_IIO_BUFFER_DMAENGINE=m
CONFIG_IIO_BUFFER_HW_CONSUMER=m
CONFIG_IIO_KFIFO_BUF=m
CONFIG_IIO_TRIGGERED_BUFFER=m
CONFIG_IIO_CONFIGFS=m
CONFIG_IIO_TRIGGER=y
CONFIG_IIO_CONSUMERS_PER_TRIGGER=2
# CONFIG_IIO_SW_DEVICE is not set
CONFIG_IIO_SW_TRIGGER=m

#
# Accelerometers
#
CONFIG_ADXL345=m
CONFIG_ADXL345_I2C=m
CONFIG_ADXL372=m
CONFIG_ADXL372_I2C=m
CONFIG_BMA180=m
CONFIG_BMA400=m
CONFIG_BMA400_I2C=m
CONFIG_BMC150_ACCEL=m
CONFIG_BMC150_ACCEL_I2C=m
CONFIG_DA280=m
CONFIG_DA311=m
CONFIG_DMARD06=m
CONFIG_DMARD09=m
# CONFIG_DMARD10 is not set
CONFIG_HID_SENSOR_ACCEL_3D=m
# CONFIG_KXSD9 is not set
CONFIG_KXCJK1013=m
CONFIG_MC3230=m
# CONFIG_MMA7455_I2C is not set
CONFIG_MMA7660=m
# CONFIG_MMA8452 is not set
CONFIG_MMA9551_CORE=m
# CONFIG_MMA9551 is not set
CONFIG_MMA9553=m
CONFIG_MXC4005=m
# CONFIG_MXC6255 is not set
# CONFIG_STK8312 is not set
CONFIG_STK8BA50=m
# end of Accelerometers

#
# Analog to digital converters
#
CONFIG_AD7091R5=m
# CONFIG_AD7291 is not set
# CONFIG_AD7606_IFACE_PARALLEL is not set
CONFIG_AD799X=m
CONFIG_ADI_AXI_ADC=m
# CONFIG_CC10001_ADC is not set
CONFIG_DA9150_GPADC=m
CONFIG_DLN2_ADC=m
CONFIG_ENVELOPE_DETECTOR=m
CONFIG_HX711=m
CONFIG_LTC2471=m
CONFIG_LTC2485=m
# CONFIG_LTC2497 is not set
CONFIG_MAX1363=m
CONFIG_MAX9611=m
CONFIG_MCP3422=m
CONFIG_MEN_Z188_ADC=m
CONFIG_NAU7802=m
CONFIG_SD_ADC_MODULATOR=m
CONFIG_STMPE_ADC=m
CONFIG_TI_ADC081C=m
# CONFIG_TI_ADS1015 is not set
CONFIG_TI_AM335X_ADC=m
# CONFIG_VF610_ADC is not set
CONFIG_VIPERBOARD_ADC=m
# CONFIG_XILINX_XADC is not set
# end of Analog to digital converters

#
# Analog Front Ends
#
# CONFIG_IIO_RESCALE is not set
# end of Analog Front Ends

#
# Amplifiers
#
CONFIG_HMC425=m
# end of Amplifiers

#
# Chemical Sensors
#
CONFIG_ATLAS_PH_SENSOR=m
CONFIG_ATLAS_EZO_SENSOR=m
CONFIG_BME680=m
CONFIG_BME680_I2C=m
# CONFIG_CCS811 is not set
# CONFIG_IAQCORE is not set
CONFIG_PMS7003=m
CONFIG_SENSIRION_SGP30=m
# CONFIG_SPS30 is not set
CONFIG_VZ89X=m
# end of Chemical Sensors

#
# Hid Sensor IIO Common
#
CONFIG_HID_SENSOR_IIO_COMMON=m
CONFIG_HID_SENSOR_IIO_TRIGGER=m
# end of Hid Sensor IIO Common

CONFIG_IIO_MS_SENSORS_I2C=m

#
# SSP Sensor Common
#
# end of SSP Sensor Common

CONFIG_IIO_ST_SENSORS_I2C=m
CONFIG_IIO_ST_SENSORS_CORE=m

#
# Digital to analog converters
#
CONFIG_AD5064=m
CONFIG_AD5380=m
CONFIG_AD5446=m
CONFIG_AD5592R_BASE=m
CONFIG_AD5593R=m
CONFIG_AD5686=m
CONFIG_AD5696_I2C=m
# CONFIG_DPOT_DAC is not set
CONFIG_DS4424=m
CONFIG_M62332=m
# CONFIG_MAX517 is not set
CONFIG_MAX5821=m
# CONFIG_MCP4725 is not set
CONFIG_TI_DAC5571=m
# CONFIG_VF610_DAC is not set
# end of Digital to analog converters

#
# IIO dummy driver
#
# end of IIO dummy driver

#
# Frequency Synthesizers DDS/PLL
#

#
# Clock Generator/Distribution
#
# end of Clock Generator/Distribution

#
# Phase-Locked Loop (PLL) frequency synthesizers
#
# end of Phase-Locked Loop (PLL) frequency synthesizers
# end of Frequency Synthesizers DDS/PLL

#
# Digital gyroscope sensors
#
CONFIG_BMG160=m
CONFIG_BMG160_I2C=m
CONFIG_FXAS21002C=m
CONFIG_FXAS21002C_I2C=m
CONFIG_HID_SENSOR_GYRO_3D=m
CONFIG_MPU3050=m
CONFIG_MPU3050_I2C=m
# CONFIG_IIO_ST_GYRO_3AXIS is not set
CONFIG_ITG3200=m
# end of Digital gyroscope sensors

#
# Health Sensors
#

#
# Heart Rate Monitors
#
CONFIG_AFE4404=m
CONFIG_MAX30100=m
CONFIG_MAX30102=m
# end of Heart Rate Monitors
# end of Health Sensors

#
# Humidity sensors
#
CONFIG_AM2315=m
CONFIG_DHT11=m
# CONFIG_HDC100X is not set
# CONFIG_HID_SENSOR_HUMIDITY is not set
# CONFIG_HTS221 is not set
CONFIG_HTU21=m
CONFIG_SI7005=m
CONFIG_SI7020=m
# end of Humidity sensors

#
# Inertial measurement units
#
# CONFIG_BMI160_I2C is not set
# CONFIG_FXOS8700_I2C is not set
CONFIG_KMX61=m
CONFIG_INV_MPU6050_IIO=m
CONFIG_INV_MPU6050_I2C=m
CONFIG_IIO_ST_LSM6DSX=m
CONFIG_IIO_ST_LSM6DSX_I2C=m
CONFIG_IIO_ST_LSM6DSX_I3C=m
# end of Inertial measurement units

#
# Light sensors
#
CONFIG_ADJD_S311=m
CONFIG_ADUX1020=m
# CONFIG_AL3010 is not set
CONFIG_AL3320A=m
CONFIG_APDS9300=m
CONFIG_APDS9960=m
# CONFIG_BH1750 is not set
CONFIG_BH1780=m
CONFIG_CM32181=m
# CONFIG_CM3232 is not set
CONFIG_CM3323=m
CONFIG_CM3605=m
CONFIG_CM36651=m
# CONFIG_GP2AP002 is not set
CONFIG_GP2AP020A00F=m
CONFIG_SENSORS_ISL29018=m
CONFIG_SENSORS_ISL29028=m
# CONFIG_ISL29125 is not set
CONFIG_HID_SENSOR_ALS=m
CONFIG_HID_SENSOR_PROX=m
CONFIG_JSA1212=m
CONFIG_RPR0521=m
CONFIG_SENSORS_LM3533=m
CONFIG_LTR501=m
CONFIG_LV0104CS=m
# CONFIG_MAX44000 is not set
CONFIG_MAX44009=m
# CONFIG_NOA1305 is not set
CONFIG_OPT3001=m
CONFIG_PA12203001=m
# CONFIG_SI1133 is not set
CONFIG_SI1145=m
# CONFIG_STK3310 is not set
CONFIG_ST_UVIS25=m
CONFIG_ST_UVIS25_I2C=m
# CONFIG_TCS3414 is not set
# CONFIG_TCS3472 is not set
CONFIG_SENSORS_TSL2563=m
CONFIG_TSL2583=m
CONFIG_TSL2772=m
CONFIG_TSL4531=m
CONFIG_US5182D=m
CONFIG_VCNL4000=m
CONFIG_VCNL4035=m
# CONFIG_VEML6030 is not set
# CONFIG_VEML6070 is not set
CONFIG_VL6180=m
CONFIG_ZOPT2201=m
# end of Light sensors

#
# Magnetometer sensors
#
CONFIG_AK8974=m
CONFIG_AK8975=m
CONFIG_AK09911=m
# CONFIG_BMC150_MAGN_I2C is not set
CONFIG_MAG3110=m
CONFIG_HID_SENSOR_MAGNETOMETER_3D=m
CONFIG_MMC35240=m
CONFIG_IIO_ST_MAGN_3AXIS=m
CONFIG_IIO_ST_MAGN_I2C_3AXIS=m
CONFIG_SENSORS_HMC5843=m
CONFIG_SENSORS_HMC5843_I2C=m
CONFIG_SENSORS_RM3100=m
CONFIG_SENSORS_RM3100_I2C=m
# end of Magnetometer sensors

#
# Multiplexers
#
CONFIG_IIO_MUX=m
# end of Multiplexers

#
# Inclinometer sensors
#
# CONFIG_HID_SENSOR_INCLINOMETER_3D is not set
CONFIG_HID_SENSOR_DEVICE_ROTATION=m
# end of Inclinometer sensors

#
# Triggers - standalone
#
CONFIG_IIO_HRTIMER_TRIGGER=m
# CONFIG_IIO_INTERRUPT_TRIGGER is not set
# CONFIG_IIO_TIGHTLOOP_TRIGGER is not set
# CONFIG_IIO_SYSFS_TRIGGER is not set
# end of Triggers - standalone

#
# Linear and angular position sensors
#
# end of Linear and angular position sensors

#
# Digital potentiometers
#
CONFIG_AD5272=m
# CONFIG_DS1803 is not set
# CONFIG_MAX5432 is not set
CONFIG_MCP4018=m
# CONFIG_MCP4531 is not set
CONFIG_TPL0102=m
# end of Digital potentiometers

#
# Digital potentiostats
#
# CONFIG_LMP91000 is not set
# end of Digital potentiostats

#
# Pressure sensors
#
# CONFIG_ABP060MG is not set
CONFIG_BMP280=m
CONFIG_BMP280_I2C=m
CONFIG_DLHL60D=m
# CONFIG_DPS310 is not set
CONFIG_HID_SENSOR_PRESS=m
# CONFIG_HP03 is not set
CONFIG_ICP10100=m
CONFIG_MPL115=m
CONFIG_MPL115_I2C=m
# CONFIG_MPL3115 is not set
# CONFIG_MS5611 is not set
CONFIG_MS5637=m
CONFIG_IIO_ST_PRESS=m
CONFIG_IIO_ST_PRESS_I2C=m
CONFIG_T5403=m
CONFIG_HP206C=m
CONFIG_ZPA2326=m
CONFIG_ZPA2326_I2C=m
# end of Pressure sensors

#
# Lightning sensors
#
# end of Lightning sensors

#
# Proximity and distance sensors
#
# CONFIG_ISL29501 is not set
CONFIG_LIDAR_LITE_V2=m
CONFIG_MB1232=m
CONFIG_PING=m
CONFIG_RFD77402=m
CONFIG_SRF04=m
# CONFIG_SX9310 is not set
CONFIG_SX9500=m
# CONFIG_SRF08 is not set
CONFIG_VCNL3020=m
# CONFIG_VL53L0X_I2C is not set
# end of Proximity and distance sensors

#
# Resolver to digital converters
#
# end of Resolver to digital converters

#
# Temperature sensors
#
CONFIG_HID_SENSOR_TEMP=m
# CONFIG_MLX90614 is not set
# CONFIG_MLX90632 is not set
CONFIG_TMP006=m
# CONFIG_TMP007 is not set
CONFIG_TSYS01=m
CONFIG_TSYS02D=m
# end of Temperature sensors

# CONFIG_PWM is not set

#
# IRQ chip support
#
CONFIG_IRQCHIP=y
# CONFIG_AL_FIC is not set
CONFIG_MADERA_IRQ=m
# end of IRQ chip support

CONFIG_IPACK_BUS=m
# CONFIG_SERIAL_IPOCTAL is not set
CONFIG_RESET_CONTROLLER=y
# CONFIG_RESET_BRCMSTB_RESCAL is not set
# CONFIG_RESET_INTEL_GW is not set
CONFIG_RESET_TI_SYSCON=m

#
# PHY Subsystem
#
CONFIG_GENERIC_PHY=y
CONFIG_GENERIC_PHY_MIPI_DPHY=y
CONFIG_BCM_KONA_USB2_PHY=y
CONFIG_PHY_CADENCE_TORRENT=y
CONFIG_PHY_CADENCE_DPHY=m
CONFIG_PHY_CADENCE_SIERRA=y
CONFIG_PHY_CADENCE_SALVO=m
CONFIG_PHY_FSL_IMX8MQ_USB=m
CONFIG_PHY_MIXEL_MIPI_DPHY=m
CONFIG_PHY_PXA_28NM_HSIC=y
CONFIG_PHY_PXA_28NM_USB2=y
# CONFIG_PHY_CPCAP_USB is not set
CONFIG_PHY_MAPPHONE_MDM6600=m
# CONFIG_PHY_OCELOT_SERDES is not set
CONFIG_PHY_QCOM_USB_HS=m
# CONFIG_PHY_QCOM_USB_HSIC is not set
CONFIG_PHY_SAMSUNG_USB2=m
# CONFIG_PHY_TUSB1210 is not set
CONFIG_PHY_INTEL_COMBO=y
CONFIG_PHY_INTEL_EMMC=y
# end of PHY Subsystem

# CONFIG_POWERCAP is not set
CONFIG_MCB=m
CONFIG_MCB_LPC=m

#
# Performance monitor support
#
# end of Performance monitor support

# CONFIG_RAS is not set

#
# Android
#
CONFIG_ANDROID=y
# CONFIG_ANDROID_BINDER_IPC is not set
# end of Android

CONFIG_DAX=y
CONFIG_DEV_DAX=y
CONFIG_NVMEM=y
# CONFIG_NVMEM_SYSFS is not set
# CONFIG_RAVE_SP_EEPROM is not set

#
# HW tracing support
#
CONFIG_STM=m
CONFIG_STM_PROTO_BASIC=m
CONFIG_STM_PROTO_SYS_T=m
CONFIG_STM_DUMMY=m
CONFIG_STM_SOURCE_CONSOLE=m
# CONFIG_STM_SOURCE_HEARTBEAT is not set
CONFIG_INTEL_TH=y
CONFIG_INTEL_TH_GTH=m
# CONFIG_INTEL_TH_STH is not set
# CONFIG_INTEL_TH_MSU is not set
CONFIG_INTEL_TH_PTI=m
# CONFIG_INTEL_TH_DEBUG is not set
# end of HW tracing support

CONFIG_FPGA=y
CONFIG_ALTERA_PR_IP_CORE=m
# CONFIG_ALTERA_PR_IP_CORE_PLAT is not set
CONFIG_FPGA_BRIDGE=y
CONFIG_ALTERA_FREEZE_BRIDGE=m
# CONFIG_XILINX_PR_DECOUPLER is not set
CONFIG_FPGA_REGION=y
# CONFIG_OF_FPGA_REGION is not set
CONFIG_FPGA_DFL=y
# CONFIG_FPGA_DFL_FME is not set
CONFIG_FPGA_DFL_AFU=m
CONFIG_FSI=y
# CONFIG_FSI_NEW_DEV_NODE is not set
CONFIG_FSI_MASTER_GPIO=m
CONFIG_FSI_MASTER_HUB=m
# CONFIG_FSI_MASTER_ASPEED is not set
CONFIG_FSI_SCOM=y
CONFIG_FSI_SBEFIFO=m
CONFIG_FSI_OCC=m
# CONFIG_TEE is not set
CONFIG_MULTIPLEXER=m

#
# Multiplexer drivers
#
# CONFIG_MUX_ADG792A is not set
CONFIG_MUX_GPIO=m
CONFIG_MUX_MMIO=m
# end of Multiplexer drivers

CONFIG_PM_OPP=y
CONFIG_SIOX=m
# CONFIG_SIOX_BUS_GPIO is not set
# CONFIG_SLIMBUS is not set
# CONFIG_INTERCONNECT is not set
CONFIG_COUNTER=m
CONFIG_FTM_QUADDEC=m
CONFIG_MOST=y
# end of Device Drivers

#
# File systems
#
CONFIG_DCACHE_WORD_ACCESS=y
CONFIG_VALIDATE_FS_PARSER=y
# CONFIG_FSINFO is not set
CONFIG_FS_IOMAP=y
CONFIG_EXT2_FS=m
CONFIG_EXT2_FS_XATTR=y
CONFIG_EXT2_FS_POSIX_ACL=y
CONFIG_EXT2_FS_SECURITY=y
CONFIG_EXT3_FS=y
# CONFIG_EXT3_FS_POSIX_ACL is not set
CONFIG_EXT3_FS_SECURITY=y
CONFIG_EXT4_FS=y
# CONFIG_EXT4_FS_POSIX_ACL is not set
CONFIG_EXT4_FS_SECURITY=y
CONFIG_EXT4_DEBUG=y
CONFIG_EXT4_KUNIT_TESTS=y
CONFIG_JBD2=y
CONFIG_JBD2_DEBUG=y
CONFIG_FS_MBCACHE=y
# CONFIG_REISERFS_FS is not set
CONFIG_JFS_FS=m
# CONFIG_JFS_POSIX_ACL is not set
# CONFIG_JFS_SECURITY is not set
CONFIG_JFS_DEBUG=y
# CONFIG_JFS_STATISTICS is not set
CONFIG_XFS_FS=m
CONFIG_XFS_QUOTA=y
CONFIG_XFS_POSIX_ACL=y
# CONFIG_XFS_RT is not set
# CONFIG_XFS_ONLINE_SCRUB is not set
CONFIG_XFS_DEBUG=y
# CONFIG_XFS_ASSERT_FATAL is not set
CONFIG_GFS2_FS=y
# CONFIG_BTRFS_FS is not set
CONFIG_NILFS2_FS=m
CONFIG_F2FS_FS=m
# CONFIG_F2FS_STAT_FS is not set
CONFIG_F2FS_FS_XATTR=y
CONFIG_F2FS_FS_POSIX_ACL=y
CONFIG_F2FS_FS_SECURITY=y
CONFIG_F2FS_CHECK_FS=y
CONFIG_F2FS_FAULT_INJECTION=y
CONFIG_F2FS_FS_COMPRESSION=y
# CONFIG_F2FS_FS_LZO is not set
CONFIG_F2FS_FS_LZ4=y
# CONFIG_F2FS_FS_ZSTD is not set
CONFIG_ZONEFS_FS=y
CONFIG_FS_DAX=y
CONFIG_FS_POSIX_ACL=y
CONFIG_EXPORTFS=y
# CONFIG_EXPORTFS_BLOCK_OPS is not set
CONFIG_FILE_LOCKING=y
CONFIG_MANDATORY_FILE_LOCKING=y
CONFIG_FS_ENCRYPTION=y
CONFIG_FS_ENCRYPTION_ALGS=y
# CONFIG_FS_ENCRYPTION_INLINE_CRYPT is not set
CONFIG_FS_VERITY=y
CONFIG_FS_VERITY_DEBUG=y
# CONFIG_FS_VERITY_BUILTIN_SIGNATURES is not set
CONFIG_FSNOTIFY=y
CONFIG_DNOTIFY=y
CONFIG_INOTIFY_USER=y
CONFIG_FANOTIFY=y
# CONFIG_FANOTIFY_ACCESS_PERMISSIONS is not set
# CONFIG_MOUNT_NOTIFICATIONS is not set
CONFIG_SB_NOTIFICATIONS=y
# CONFIG_QUOTA is not set
CONFIG_QUOTACTL=y
# CONFIG_AUTOFS4_FS is not set
CONFIG_AUTOFS_FS=y
CONFIG_FUSE_FS=m
CONFIG_CUSE=m
# CONFIG_VIRTIO_FS is not set
# CONFIG_OVERLAY_FS is not set

#
# Caches
#
# CONFIG_FSCACHE is not set
# end of Caches

#
# CD-ROM/DVD Filesystems
#
# CONFIG_ISO9660_FS is not set
# CONFIG_UDF_FS is not set
# end of CD-ROM/DVD Filesystems

#
# DOS/FAT/EXFAT/NT Filesystems
#
CONFIG_FAT_FS=m
CONFIG_MSDOS_FS=m
CONFIG_VFAT_FS=m
CONFIG_FAT_DEFAULT_CODEPAGE=437
CONFIG_FAT_DEFAULT_IOCHARSET="iso8859-1"
CONFIG_FAT_DEFAULT_UTF8=y
CONFIG_EXFAT_FS=m
CONFIG_EXFAT_DEFAULT_IOCHARSET="utf8"
# CONFIG_NTFS_FS is not set
# end of DOS/FAT/EXFAT/NT Filesystems

#
# Pseudo filesystems
#
CONFIG_PROC_FS=y
# CONFIG_PROC_KCORE is not set
CONFIG_PROC_SYSCTL=y
CONFIG_PROC_PAGE_MONITOR=y
# CONFIG_PROC_CHILDREN is not set
CONFIG_PROC_PID_ARCH_STATUS=y
CONFIG_PROC_CPU_RESCTRL=y
CONFIG_KERNFS=y
CONFIG_SYSFS=y
# CONFIG_TMPFS is not set
CONFIG_HUGETLBFS=y
CONFIG_HUGETLB_PAGE=y
CONFIG_MEMFD_CREATE=y
CONFIG_CONFIGFS_FS=y
# end of Pseudo filesystems

# CONFIG_MISC_FILESYSTEMS is not set
CONFIG_NLS=y
CONFIG_NLS_DEFAULT="iso8859-1"
CONFIG_NLS_CODEPAGE_437=y
CONFIG_NLS_CODEPAGE_737=y
# CONFIG_NLS_CODEPAGE_775 is not set
# CONFIG_NLS_CODEPAGE_850 is not set
CONFIG_NLS_CODEPAGE_852=y
# CONFIG_NLS_CODEPAGE_855 is not set
CONFIG_NLS_CODEPAGE_857=m
# CONFIG_NLS_CODEPAGE_860 is not set
# CONFIG_NLS_CODEPAGE_861 is not set
CONFIG_NLS_CODEPAGE_862=y
CONFIG_NLS_CODEPAGE_863=y
CONFIG_NLS_CODEPAGE_864=y
CONFIG_NLS_CODEPAGE_865=m
CONFIG_NLS_CODEPAGE_866=y
CONFIG_NLS_CODEPAGE_869=y
CONFIG_NLS_CODEPAGE_936=y
CONFIG_NLS_CODEPAGE_950=m
CONFIG_NLS_CODEPAGE_932=y
CONFIG_NLS_CODEPAGE_949=y
CONFIG_NLS_CODEPAGE_874=y
CONFIG_NLS_ISO8859_8=y
# CONFIG_NLS_CODEPAGE_1250 is not set
CONFIG_NLS_CODEPAGE_1251=m
CONFIG_NLS_ASCII=m
CONFIG_NLS_ISO8859_1=m
# CONFIG_NLS_ISO8859_2 is not set
CONFIG_NLS_ISO8859_3=m
# CONFIG_NLS_ISO8859_4 is not set
# CONFIG_NLS_ISO8859_5 is not set
# CONFIG_NLS_ISO8859_6 is not set
CONFIG_NLS_ISO8859_7=y
CONFIG_NLS_ISO8859_9=y
# CONFIG_NLS_ISO8859_13 is not set
CONFIG_NLS_ISO8859_14=m
CONFIG_NLS_ISO8859_15=m
# CONFIG_NLS_KOI8_R is not set
CONFIG_NLS_KOI8_U=m
CONFIG_NLS_MAC_ROMAN=y
CONFIG_NLS_MAC_CELTIC=m
# CONFIG_NLS_MAC_CENTEURO is not set
# CONFIG_NLS_MAC_CROATIAN is not set
CONFIG_NLS_MAC_CYRILLIC=m
CONFIG_NLS_MAC_GAELIC=y
CONFIG_NLS_MAC_GREEK=y
CONFIG_NLS_MAC_ICELAND=m
# CONFIG_NLS_MAC_INUIT is not set
CONFIG_NLS_MAC_ROMANIAN=m
CONFIG_NLS_MAC_TURKISH=y
CONFIG_NLS_UTF8=m
# CONFIG_UNICODE is not set
CONFIG_IO_WQ=y
# end of File systems

#
# Security options
#
CONFIG_KEYS=y
# CONFIG_KEYS_REQUEST_CACHE is not set
# CONFIG_PERSISTENT_KEYRINGS is not set
# CONFIG_TRUSTED_KEYS is not set
# CONFIG_ENCRYPTED_KEYS is not set
# CONFIG_KEY_DH_OPERATIONS is not set
# CONFIG_KEY_NOTIFICATIONS is not set
# CONFIG_SECURITY_DMESG_RESTRICT is not set
CONFIG_SECURITY=y
CONFIG_SECURITYFS=y
CONFIG_SECURITY_NETWORK=y
# CONFIG_PAGE_TABLE_ISOLATION is not set
CONFIG_SECURITY_PATH=y
CONFIG_HAVE_HARDENED_USERCOPY_ALLOCATOR=y
CONFIG_HARDENED_USERCOPY=y
CONFIG_HARDENED_USERCOPY_FALLBACK=y
CONFIG_FORTIFY_SOURCE=y
# CONFIG_STATIC_USERMODEHELPER is not set
CONFIG_SECURITY_LOADPIN=y
# CONFIG_SECURITY_LOADPIN_ENFORCE is not set
CONFIG_SECURITY_YAMA=y
CONFIG_SECURITY_SAFESETID=y
# CONFIG_SECURITY_LOCKDOWN_LSM is not set
# CONFIG_INTEGRITY is not set
CONFIG_DEFAULT_SECURITY_DAC=y
CONFIG_LSM="lockdown,yama,loadpin,safesetid,integrity,bpf"

#
# Kernel hardening options
#

#
# Memory initialization
#
CONFIG_INIT_STACK_NONE=y
CONFIG_INIT_ON_ALLOC_DEFAULT_ON=y
CONFIG_INIT_ON_FREE_DEFAULT_ON=y
# end of Memory initialization
# end of Kernel hardening options
# end of Security options

CONFIG_CRYPTO=y

#
# Crypto core or helper
#
CONFIG_CRYPTO_ALGAPI=y
CONFIG_CRYPTO_ALGAPI2=y
CONFIG_CRYPTO_AEAD=y
CONFIG_CRYPTO_AEAD2=y
CONFIG_CRYPTO_SKCIPHER=y
CONFIG_CRYPTO_SKCIPHER2=y
CONFIG_CRYPTO_HASH=y
CONFIG_CRYPTO_HASH2=y
CONFIG_CRYPTO_RNG=y
CONFIG_CRYPTO_RNG2=y
CONFIG_CRYPTO_RNG_DEFAULT=y
CONFIG_CRYPTO_AKCIPHER2=y
CONFIG_CRYPTO_AKCIPHER=y
CONFIG_CRYPTO_KPP2=y
CONFIG_CRYPTO_KPP=y
CONFIG_CRYPTO_ACOMP2=y
CONFIG_CRYPTO_MANAGER=y
CONFIG_CRYPTO_MANAGER2=y
# CONFIG_CRYPTO_MANAGER_DISABLE_TESTS is not set
CONFIG_CRYPTO_GF128MUL=y
CONFIG_CRYPTO_NULL=y
CONFIG_CRYPTO_NULL2=y
CONFIG_CRYPTO_CRYPTD=y
CONFIG_CRYPTO_AUTHENC=y
CONFIG_CRYPTO_TEST=m
CONFIG_CRYPTO_SIMD=m
CONFIG_CRYPTO_ENGINE=y

#
# Public-key cryptography
#
CONFIG_CRYPTO_RSA=m
CONFIG_CRYPTO_DH=m
CONFIG_CRYPTO_ECC=y
CONFIG_CRYPTO_ECDH=y
CONFIG_CRYPTO_ECRDSA=y
CONFIG_CRYPTO_CURVE25519=m

#
# Authenticated Encryption with Associated Data
#
CONFIG_CRYPTO_CCM=y
CONFIG_CRYPTO_GCM=m
CONFIG_CRYPTO_CHACHA20POLY1305=m
CONFIG_CRYPTO_AEGIS128=m
CONFIG_CRYPTO_SEQIV=m
CONFIG_CRYPTO_ECHAINIV=y

#
# Block modes
#
CONFIG_CRYPTO_CBC=y
CONFIG_CRYPTO_CFB=y
CONFIG_CRYPTO_CTR=y
CONFIG_CRYPTO_CTS=y
CONFIG_CRYPTO_ECB=y
CONFIG_CRYPTO_LRW=m
# CONFIG_CRYPTO_OFB is not set
# CONFIG_CRYPTO_PCBC is not set
CONFIG_CRYPTO_XTS=y
CONFIG_CRYPTO_KEYWRAP=y
CONFIG_CRYPTO_NHPOLY1305=y
CONFIG_CRYPTO_ADIANTUM=y
# CONFIG_CRYPTO_ESSIV is not set

#
# Hash modes
#
CONFIG_CRYPTO_CMAC=y
CONFIG_CRYPTO_HMAC=y
CONFIG_CRYPTO_XCBC=y
CONFIG_CRYPTO_VMAC=y

#
# Digest
#
CONFIG_CRYPTO_CRC32C=y
# CONFIG_CRYPTO_CRC32C_INTEL is not set
CONFIG_CRYPTO_CRC32=m
CONFIG_CRYPTO_CRC32_PCLMUL=y
CONFIG_CRYPTO_XXHASH=m
CONFIG_CRYPTO_BLAKE2B=m
CONFIG_CRYPTO_BLAKE2S=m
CONFIG_CRYPTO_CRCT10DIF=y
CONFIG_CRYPTO_GHASH=y
CONFIG_CRYPTO_POLY1305=m
CONFIG_CRYPTO_MD4=y
CONFIG_CRYPTO_MD5=m
# CONFIG_CRYPTO_MICHAEL_MIC is not set
CONFIG_CRYPTO_RMD128=m
CONFIG_CRYPTO_RMD160=m
CONFIG_CRYPTO_RMD256=y
CONFIG_CRYPTO_RMD320=y
CONFIG_CRYPTO_SHA1=m
CONFIG_CRYPTO_SHA256=y
CONFIG_CRYPTO_SHA512=y
# CONFIG_CRYPTO_SHA3 is not set
CONFIG_CRYPTO_SM3=y
CONFIG_CRYPTO_STREEBOG=y
# CONFIG_CRYPTO_TGR192 is not set
# CONFIG_CRYPTO_WP512 is not set

#
# Ciphers
#
CONFIG_CRYPTO_AES=y
CONFIG_CRYPTO_AES_TI=m
CONFIG_CRYPTO_AES_NI_INTEL=m
# CONFIG_CRYPTO_ANUBIS is not set
# CONFIG_CRYPTO_ARC4 is not set
# CONFIG_CRYPTO_BLOWFISH is not set
CONFIG_CRYPTO_CAMELLIA=m
CONFIG_CRYPTO_CAST_COMMON=y
CONFIG_CRYPTO_CAST5=y
# CONFIG_CRYPTO_CAST6 is not set
# CONFIG_CRYPTO_DES is not set
CONFIG_CRYPTO_FCRYPT=m
CONFIG_CRYPTO_KHAZAD=y
CONFIG_CRYPTO_SALSA20=y
CONFIG_CRYPTO_CHACHA20=y
CONFIG_CRYPTO_SEED=m
CONFIG_CRYPTO_SERPENT=m
# CONFIG_CRYPTO_SERPENT_SSE2_586 is not set
CONFIG_CRYPTO_SM4=y
CONFIG_CRYPTO_TEA=y
# CONFIG_CRYPTO_TWOFISH is not set
CONFIG_CRYPTO_TWOFISH_COMMON=y
CONFIG_CRYPTO_TWOFISH_586=y

#
# Compression
#
CONFIG_CRYPTO_DEFLATE=m
CONFIG_CRYPTO_LZO=y
CONFIG_CRYPTO_842=y
CONFIG_CRYPTO_LZ4=y
CONFIG_CRYPTO_LZ4HC=m
CONFIG_CRYPTO_ZSTD=m

#
# Random Number Generation
#
# CONFIG_CRYPTO_ANSI_CPRNG is not set
CONFIG_CRYPTO_DRBG_MENU=y
CONFIG_CRYPTO_DRBG_HMAC=y
# CONFIG_CRYPTO_DRBG_HASH is not set
CONFIG_CRYPTO_DRBG_CTR=y
CONFIG_CRYPTO_DRBG=y
CONFIG_CRYPTO_JITTERENTROPY=y
CONFIG_CRYPTO_HASH_INFO=y

#
# Crypto library routines
#
CONFIG_CRYPTO_LIB_AES=y
CONFIG_CRYPTO_LIB_BLAKE2S_GENERIC=y
CONFIG_CRYPTO_LIB_BLAKE2S=y
CONFIG_CRYPTO_LIB_CHACHA_GENERIC=y
CONFIG_CRYPTO_LIB_CHACHA=y
CONFIG_CRYPTO_LIB_CURVE25519_GENERIC=m
# CONFIG_CRYPTO_LIB_CURVE25519 is not set
CONFIG_CRYPTO_LIB_DES=m
CONFIG_CRYPTO_LIB_POLY1305_RSIZE=1
CONFIG_CRYPTO_LIB_POLY1305_GENERIC=y
CONFIG_CRYPTO_LIB_POLY1305=y
CONFIG_CRYPTO_LIB_CHACHA20POLY1305=y
CONFIG_CRYPTO_LIB_SHA256=y
CONFIG_CRYPTO_HW=y
CONFIG_CRYPTO_DEV_PADLOCK=m
CONFIG_CRYPTO_DEV_PADLOCK_AES=m
CONFIG_CRYPTO_DEV_PADLOCK_SHA=m
CONFIG_CRYPTO_DEV_ATMEL_I2C=m
CONFIG_CRYPTO_DEV_ATMEL_ECC=m
CONFIG_CRYPTO_DEV_ATMEL_SHA204A=m
CONFIG_CRYPTO_DEV_VIRTIO=y
# CONFIG_CRYPTO_DEV_SAFEXCEL is not set
CONFIG_CRYPTO_DEV_CCREE=m
CONFIG_CRYPTO_DEV_AMLOGIC_GXL=y
# CONFIG_CRYPTO_DEV_AMLOGIC_GXL_DEBUG is not set
CONFIG_ASYMMETRIC_KEY_TYPE=y
CONFIG_ASYMMETRIC_PUBLIC_KEY_SUBTYPE=m
CONFIG_X509_CERTIFICATE_PARSER=m
CONFIG_PKCS8_PRIVATE_KEY_PARSER=m
CONFIG_PKCS7_MESSAGE_PARSER=m

#
# Certificates for signature checking
#
# CONFIG_SYSTEM_TRUSTED_KEYRING is not set
CONFIG_SYSTEM_BLACKLIST_KEYRING=y
CONFIG_SYSTEM_BLACKLIST_HASH_LIST=""
# end of Certificates for signature checking

#
# Library routines
#
CONFIG_LINEAR_RANGES=y
CONFIG_PACKING=y
CONFIG_BITREVERSE=y
CONFIG_GENERIC_STRNCPY_FROM_USER=y
CONFIG_GENERIC_STRNLEN_USER=y
CONFIG_GENERIC_FIND_FIRST_BIT=y
CONFIG_CORDIC=m
CONFIG_PRIME_NUMBERS=m
CONFIG_RATIONAL=y
CONFIG_GENERIC_PCI_IOMAP=y
CONFIG_GENERIC_IOMAP=y
CONFIG_ARCH_HAS_FAST_MULTIPLIER=y
CONFIG_ARCH_USE_SYM_ANNOTATIONS=y
CONFIG_CRC_CCITT=m
CONFIG_CRC16=y
CONFIG_CRC_T10DIF=y
CONFIG_CRC_ITU_T=m
CONFIG_CRC32=y
CONFIG_CRC32_SELFTEST=m
# CONFIG_CRC32_SLICEBY8 is not set
# CONFIG_CRC32_SLICEBY4 is not set
CONFIG_CRC32_SARWATE=y
# CONFIG_CRC32_BIT is not set
CONFIG_CRC64=m
CONFIG_CRC4=y
# CONFIG_CRC7 is not set
CONFIG_LIBCRC32C=y
CONFIG_CRC8=y
CONFIG_XXHASH=y
# CONFIG_RANDOM32_SELFTEST is not set
CONFIG_842_COMPRESS=y
CONFIG_842_DECOMPRESS=y
CONFIG_ZLIB_INFLATE=m
CONFIG_ZLIB_DEFLATE=m
CONFIG_LZO_COMPRESS=y
CONFIG_LZO_DECOMPRESS=y
CONFIG_LZ4_COMPRESS=y
CONFIG_LZ4HC_COMPRESS=m
CONFIG_LZ4_DECOMPRESS=y
CONFIG_ZSTD_COMPRESS=m
CONFIG_ZSTD_DECOMPRESS=m
CONFIG_XZ_DEC=y
CONFIG_XZ_DEC_X86=y
CONFIG_XZ_DEC_POWERPC=y
CONFIG_XZ_DEC_IA64=y
CONFIG_XZ_DEC_ARM=y
CONFIG_XZ_DEC_ARMTHUMB=y
CONFIG_XZ_DEC_SPARC=y
CONFIG_XZ_DEC_BCJ=y
# CONFIG_XZ_DEC_TEST is not set
CONFIG_DECOMPRESS_BZIP2=y
CONFIG_DECOMPRESS_XZ=y
CONFIG_GENERIC_ALLOCATOR=y
CONFIG_BCH=y
CONFIG_BCH_CONST_PARAMS=y
CONFIG_XARRAY_MULTI=y
CONFIG_ASSOCIATIVE_ARRAY=y
CONFIG_HAS_IOMEM=y
CONFIG_HAS_IOPORT_MAP=y
CONFIG_HAS_DMA=y
CONFIG_NEED_SG_DMA_LENGTH=y
CONFIG_NEED_DMA_MAP_STATE=y
CONFIG_ARCH_DMA_ADDR_T_64BIT=y
CONFIG_DMA_DECLARE_COHERENT=y
CONFIG_SWIOTLB=y
# CONFIG_DMA_API_DEBUG is not set
CONFIG_SGL_ALLOC=y
CONFIG_GLOB=y
CONFIG_GLOB_SELFTEST=m
CONFIG_CLZ_TAB=y
# CONFIG_IRQ_POLL is not set
CONFIG_MPILIB=m
CONFIG_LIBFDT=y
CONFIG_OID_REGISTRY=y
CONFIG_HAVE_GENERIC_VDSO=y
CONFIG_GENERIC_GETTIMEOFDAY=y
CONFIG_GENERIC_VDSO_32=y
CONFIG_GENERIC_VDSO_TIME_NS=y
CONFIG_FONT_SUPPORT=y
CONFIG_FONT_8x16=y
CONFIG_FONT_AUTOSELECT=y
CONFIG_SG_POOL=y
CONFIG_ARCH_STACKWALK=y
CONFIG_SBITMAP=y
CONFIG_STRING_SELFTEST=y
# end of Library routines

#
# Kernel hacking
#

#
# printk and dmesg options
#
CONFIG_PRINTK_TIME=y
# CONFIG_PRINTK_CALLER is not set
CONFIG_CONSOLE_LOGLEVEL_DEFAULT=7
CONFIG_CONSOLE_LOGLEVEL_QUIET=4
CONFIG_MESSAGE_LOGLEVEL_DEFAULT=4
CONFIG_DYNAMIC_DEBUG=y
CONFIG_DYNAMIC_DEBUG_CORE=y
CONFIG_SYMBOLIC_ERRNAME=y
CONFIG_DEBUG_BUGVERBOSE=y
# end of printk and dmesg options

#
# Compile-time checks and compiler options
#
# CONFIG_ENABLE_MUST_CHECK is not set
CONFIG_FRAME_WARN=1024
CONFIG_STRIP_ASM_SYMS=y
# CONFIG_HEADERS_INSTALL is not set
CONFIG_DEBUG_SECTION_MISMATCH=y
CONFIG_SECTION_MISMATCH_WARN_ONLY=y
CONFIG_FRAME_POINTER=y
# end of Compile-time checks and compiler options

#
# Generic Kernel Debugging Instruments
#
# CONFIG_MAGIC_SYSRQ is not set
CONFIG_DEBUG_FS=y
CONFIG_HAVE_ARCH_KGDB=y
CONFIG_ARCH_HAS_UBSAN_SANITIZE_ALL=y
# CONFIG_UBSAN is not set
# end of Generic Kernel Debugging Instruments

# CONFIG_DEBUG_KERNEL is not set

#
# Memory Debugging
#
CONFIG_PAGE_EXTENSION=y
# CONFIG_PAGE_POISONING is not set
CONFIG_DEBUG_RODATA_TEST=y
CONFIG_ARCH_HAS_DEBUG_WX=y
# CONFIG_DEBUG_WX is not set
CONFIG_GENERIC_PTDUMP=y
CONFIG_SLUB_DEBUG_ON=y
# CONFIG_SLUB_STATS is not set
CONFIG_HAVE_DEBUG_KMEMLEAK=y
CONFIG_ARCH_HAS_DEBUG_VIRTUAL=y
CONFIG_DEBUG_MEMORY_INIT=y
CONFIG_HAVE_DEBUG_STACKOVERFLOW=y
CONFIG_CC_HAS_KASAN_GENERIC=y
# end of Memory Debugging

#
# Debug Oops, Lockups and Hangs
#
CONFIG_PANIC_ON_OOPS=y
CONFIG_PANIC_ON_OOPS_VALUE=1
CONFIG_PANIC_TIMEOUT=0
CONFIG_TEST_LOCKUP=y
# end of Debug Oops, Lockups and Hangs

#
# Scheduler Debugging
#
# end of Scheduler Debugging

# CONFIG_DEBUG_TIMEKEEPING is not set

#
# Lock Debugging (spinlocks, mutexes, etc...)
#
CONFIG_LOCK_DEBUGGING_SUPPORT=y
# CONFIG_WW_MUTEX_SELFTEST is not set
# end of Lock Debugging (spinlocks, mutexes, etc...)

# CONFIG_STACKTRACE is not set
# CONFIG_WARN_ALL_UNSEEDED_RANDOM is not set

#
# Debug kernel data structures
#
CONFIG_DEBUG_LIST=y
CONFIG_BUG_ON_DATA_CORRUPTION=y
# end of Debug kernel data structures

#
# RCU Debugging
#
CONFIG_RCU_CPU_STALL_TIMEOUT=21
# end of RCU Debugging

CONFIG_USER_STACKTRACE_SUPPORT=y
CONFIG_HAVE_FUNCTION_TRACER=y
CONFIG_HAVE_FUNCTION_GRAPH_TRACER=y
CONFIG_HAVE_DYNAMIC_FTRACE=y
CONFIG_HAVE_DYNAMIC_FTRACE_WITH_REGS=y
CONFIG_HAVE_DYNAMIC_FTRACE_WITH_DIRECT_CALLS=y
CONFIG_HAVE_FTRACE_MCOUNT_RECORD=y
CONFIG_HAVE_SYSCALL_TRACEPOINTS=y
CONFIG_HAVE_C_RECORDMCOUNT=y
CONFIG_TRACING_SUPPORT=y
# CONFIG_FTRACE is not set
# CONFIG_SAMPLES is not set
CONFIG_ARCH_HAS_DEVMEM_IS_ALLOWED=y
# CONFIG_STRICT_DEVMEM is not set

#
# x86 Debugging
#
CONFIG_DEBUG_AID_FOR_SYZBOT=y
CONFIG_TRACE_IRQFLAGS_SUPPORT=y
CONFIG_X86_VERBOSE_BOOTUP=y
CONFIG_EARLY_PRINTK=y
CONFIG_HAVE_MMIOTRACE_SUPPORT=y
# CONFIG_IO_DELAY_0X80 is not set
# CONFIG_IO_DELAY_0XED is not set
CONFIG_IO_DELAY_UDELAY=y
# CONFIG_IO_DELAY_NONE is not set
CONFIG_UNWINDER_FRAME_POINTER=y
# end of x86 Debugging

#
# Kernel Testing and Coverage
#
CONFIG_KUNIT=y
CONFIG_KUNIT_DEBUGFS=y
CONFIG_KUNIT_TEST=y
CONFIG_KUNIT_EXAMPLE_TEST=y
CONFIG_KUNIT_ALL_TESTS=y
CONFIG_FUNCTION_ERROR_INJECTION=y
CONFIG_CC_HAS_SANCOV_TRACE_PC=y
# CONFIG_RUNTIME_TESTING_MENU is not set
CONFIG_MEMTEST=y
# end of Kernel Testing and Coverage
# end of Kernel hacking

^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-16-22-52 uploaded (net: IPVS)
  2020-07-17 15:30   ` mmotm 2020-07-16-22-52 uploaded (net: IPVS) Randy Dunlap
@ 2020-07-18  1:27     ` Stephen Rothwell
  0 siblings, 0 replies; 203+ messages in thread
From: Stephen Rothwell @ 2020-07-18  1:27 UTC (permalink / raw)
  To: Randy Dunlap
  Cc: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, netdev, Wensong Zhang,
	Simon Horman, Julian Anastasov, lvs-devel, Andrew Sy Kim,
	Pablo Neira Ayuso

[-- Attachment #1: Type: text/plain, Size: 634 bytes --]

Hi all,

On Fri, 17 Jul 2020 08:30:04 -0700 Randy Dunlap <rdunlap@infradead.org> wrote:
>
> (also in linux-next)
> 
> Many of these errors:
> 
> In file included from ../net/netfilter/ipvs/ip_vs_conn.c:37:0:
> ../include/net/ip_vs.h: In function ‘ip_vs_enqueue_expire_nodest_conns’:
> ../include/net/ip_vs.h:1536:61: error: parameter name omitted
>  static inline void ip_vs_enqueue_expire_nodest_conns(struct netns_ipvs) {}

Caused by commit

  04231e52d355 ("ipvs: queue delayed work to expire no destination connections if expire_nodest_conn=1")

from the netfilter-next tree.
-- 
Cheers,
Stephen Rothwell

[-- Attachment #2: OpenPGP digital signature --]
[-- Type: application/pgp-signature, Size: 488 bytes --]

^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-16-22-52 uploaded (mm/hugetlb.c)
  2020-07-17 15:35   ` mmotm 2020-07-16-22-52 uploaded (mm/hugetlb.c) Randy Dunlap
@ 2020-07-18  1:32     ` Stephen Rothwell
  0 siblings, 0 replies; 203+ messages in thread
From: Stephen Rothwell @ 2020-07-18  1:32 UTC (permalink / raw)
  To: Randy Dunlap
  Cc: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits

[-- Attachment #1: Type: text/plain, Size: 1169 bytes --]

Hi Randy,

On Fri, 17 Jul 2020 08:35:45 -0700 Randy Dunlap <rdunlap@infradead.org> wrote:
>
> on i386:
> 6 of 10 builds failed with:
> 
> ../mm/hugetlb.c:1302:20: error: redefinition of ‘destroy_compound_gigantic_page’
>  static inline void destroy_compound_gigantic_page(struct hstate *h,
>                     ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
> ../mm/hugetlb.c:1223:13: note: previous definition of ‘destroy_compound_gigantic_page’ was here
>  static void destroy_compound_gigantic_page(struct hstate *h, struct page *page,
>              ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

Reported here: https://lore.kernel.org/lkml/20200717213127.3bd426e1@canb.auug.org.au/

> ../mm/hugetlb.c:1223:13: warning: ‘destroy_compound_gigantic_page’ defined but not used [-Wunused-function]
> ../mm/hugetlb.c:50:https://lore.kernel.org/lkml/20200709191111.0b63f84d@canb.auug.org.au/20: warning: ‘hugetlb_cma’ defined but not used [-Wunused-variable]
>  static struct cma *hugetlb_cma[MAX_NUMNODES];
>                     ^~~~~~~~~~~

Reported here: https://lore.kernel.org/lkml/20200709191111.0b63f84d@canb.auug.org.au/

-- 
Cheers,
Stephen Rothwell

[-- Attachment #2: OpenPGP digital signature --]
[-- Type: application/pgp-signature, Size: 488 bytes --]

^ permalink raw reply	[flat|nested] 203+ messages in thread

* mmotm 2020-07-20-19-06 uploaded
  2020-07-03 22:14 incoming Andrew Morton
                   ` (9 preceding siblings ...)
  2020-07-17  5:53 ` mmotm 2020-07-16-22-52 uploaded Andrew Morton
@ 2020-07-21  2:07 ` Andrew Morton
  2020-07-21  6:09   ` mmotm 2020-07-20-19-06 uploaded (net/ipv6/ip6_vti.o) Randy Dunlap
  10 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2020-07-21  2:07 UTC (permalink / raw)
  To: broonie, linux-fsdevel, linux-kernel, linux-mm, linux-next,
	mhocko, mm-commits, sfr

The mm-of-the-moment snapshot 2020-07-20-19-06 has been uploaded to

   http://www.ozlabs.org/~akpm/mmotm/

mmotm-readme.txt says

README for mm-of-the-moment:

http://www.ozlabs.org/~akpm/mmotm/

This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
more than once a week.

You will need quilt to apply these patches to the latest Linus release (5.x
or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
http://ozlabs.org/~akpm/mmotm/series

The file broken-out.tar.gz contains two datestamp files: .DATE and
.DATE-yyyy-mm-dd-hh-mm-ss.  Both contain the string yyyy-mm-dd-hh-mm-ss,
followed by the base kernel version against which this patch series is to
be applied.

This tree is partially included in linux-next.  To see which patches are
included in linux-next, consult the `series' file.  Only the patches
within the #NEXT_PATCHES_START/#NEXT_PATCHES_END markers are included in
linux-next.


A full copy of the full kernel tree with the linux-next and mmotm patches
already applied is available through git within an hour of the mmotm
release.  Individual mmotm releases are tagged.  The master branch always
points to the latest release, so it's constantly rebasing.

	https://github.com/hnaz/linux-mm

The directory http://www.ozlabs.org/~akpm/mmots/ (mm-of-the-second)
contains daily snapshots of the -mm tree.  It is updated more frequently
than mmotm, and is untested.

A git copy of this tree is also available at

	https://github.com/hnaz/linux-mm



This mmotm tree contains the following patches against 5.8-rc6:
(patches marked "*" will be included in linux-next)

  origin.patch
* mm-shuffle-dont-move-pages-between-zones-and-dont-read-garbage-memmaps.patch
* mm-avoid-access-flag-update-tlb-flush-for-retried-page-fault.patch
* mm-avoid-access-flag-update-tlb-flush-for-retried-page-fault-v2.patch
* mm-close-race-between-munmap-and-expand_upwards-downwards.patch
* mm-close-race-between-munmap-and-expand_upwards-downwards-fix.patch
* vfs-xattr-mm-shmem-kernfs-release-simple-xattr-entry-in-a-right-way.patch
* mm-initialize-return-of-vm_insert_pages.patch
* mm-memcontrol-fix-oops-inside-mem_cgroup_get_nr_swap_pages.patch
* proc-kpageflags-prevent-an-integer-overflow-in-stable_page_flags.patch
* proc-kpageflags-do-not-use-uninitialized-struct-pages.patch
* mm-memcg-fix-refcount-error-while-moving-and-swapping.patch
* mm-memcg-slab-fix-memory-leak-at-non-root-kmem_cache-destroy.patch
* mm-hugetlb-avoid-hardcoding-while-checking-if-cma-is-enabled.patch
* mm-hugetlb-avoid-hardcoding-while-checking-if-cma-is-enabled-fix.patch
* mailmap-add-entry-for-mike-rapoport.patch
* squashfs-fix-length-field-overlap-check-in-metadata-reading.patch
* scripts-decode_stacktrace-strip-basepath-from-all-paths.patch
* checkpatch-test-git_dir-changes.patch
* kthread-remove-incorrect-comment-in-kthread_create_on_cpu.patch
* scripts-tagssh-collect-compiled-source-precisely.patch
* scripts-tagssh-collect-compiled-source-precisely-v2.patch
* bloat-o-meter-support-comparing-library-archives.patch
* scripts-decode_stacktrace-skip-missing-symbols.patch
* scripts-decode_stacktrace-guess-basepath-if-not-specified.patch
* scripts-decode_stacktrace-guess-path-to-modules.patch
* scripts-decode_stacktrace-guess-path-to-vmlinux-by-release-name.patch
* const_structscheckpatch-add-regulator_ops.patch
* scripts-spellingtxt-add-more-spellings-to-spellingtxt.patch
* ntfs-fix-ntfs_test_inode-and-ntfs_init_locked_inode-function-type.patch
* ocfs2-fix-remounting-needed-after-setfacl-command.patch
* ocfs2-suballoch-delete-a-duplicated-word.patch
* ocfs2-clear-links-count-in-ocfs2_mknod-if-an-error-occurs.patch
* ocfs2-fix-ocfs2-corrupt-when-iputting-an-inode.patch
* ocfs2-change-slot-number-type-s16-to-u16.patch
* ramfs-support-o_tmpfile.patch
* kernel-watchdog-flush-all-printk-nmi-buffers-when-hardlockup-detected.patch
  mm.patch
* mm-treewide-rename-kzfree-to-kfree_sensitive.patch
* mm-ksize-should-silently-accept-a-null-pointer.patch
* mm-expand-config_slab_freelist_hardened-to-include-slab.patch
* slab-add-naive-detection-of-double-free.patch
* slab-add-naive-detection-of-double-free-fix.patch
* mm-slab-check-gfp_slab_bug_mask-before-alloc_pages-in-kmalloc_order.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks.patch
* mm-slub-extend-slub_debug-syntax-for-multiple-blocks-fix.patch
* mm-slub-make-some-slub_debug-related-attributes-read-only.patch
* mm-slub-remove-runtime-allocation-order-changes.patch
* mm-slub-make-remaining-slub_debug-related-attributes-read-only.patch
* mm-slub-make-reclaim_account-attribute-read-only.patch
* mm-slub-introduce-static-key-for-slub_debug.patch
* mm-slub-introduce-kmem_cache_debug_flags.patch
* mm-slub-introduce-kmem_cache_debug_flags-fix.patch
* mm-slub-extend-checks-guarded-by-slub_debug-static-key.patch
* mm-slab-slub-move-and-improve-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj.patch
* mm-slab-slub-improve-error-reporting-and-overhead-of-cache_from_obj-fix.patch
* slub-drop-lockdep_assert_held-from-put_map.patch
* mm-kcsan-instrument-slab-slub-free-with-assert_exclusive_access.patch
* mm-debug_vm_pgtable-add-tests-validating-arch-helpers-for-core-mm-features.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers.patch
* mm-debug_vm_pgtable-add-tests-validating-advanced-arch-page-table-helpers-v5.patch
* mm-debug_vm_pgtable-add-debug-prints-for-individual-tests.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers.patch
* documentation-mm-add-descriptions-for-arch-page-table-helpers-v5.patch
* mm-handle-page-mapping-better-in-dump_page.patch
* mm-handle-page-mapping-better-in-dump_page-fix.patch
* mm-dump-compound-page-information-on-a-second-line.patch
* mm-print-head-flags-in-dump_page.patch
* mm-switch-dump_page-to-get_kernel_nofault.patch
* mm-print-the-inode-number-in-dump_page.patch
* mm-print-hashed-address-of-struct-page.patch
* mm-filemap-clear-idle-flag-for-writes.patch
* mm-filemap-add-missing-fgp_-flags-in-kerneldoc-comment-for-pagecache_get_page.patch
* mm-gupc-fix-the-comment-of-return-value-for-populate_vma_page_range.patch
* mm-swap-simplify-alloc_swap_slot_cache.patch
* mm-swap-simplify-enable_swap_slots_cache.patch
* mm-swap-remove-redundant-check-for-swap_slot_cache_initialized.patch
* tmpfs-per-superblock-i_ino-support.patch
* tmpfs-support-64-bit-inums-per-sb.patch
* mm-kmem-make-memcg_kmem_enabled-irreversible.patch
* mm-memcg-factor-out-memcg-and-lruvec-level-changes-out-of-__mod_lruvec_state.patch
* mm-memcg-prepare-for-byte-sized-vmstat-items.patch
* mm-memcg-convert-vmstat-slab-counters-to-bytes.patch
* mm-slub-implement-slub-version-of-obj_to_index.patch
* mm-memcontrol-decouple-reference-counting-from-page-accounting.patch
* mm-memcg-slab-obj_cgroup-api.patch
* mm-memcg-slab-allocate-obj_cgroups-for-non-root-slab-pages.patch
* mm-memcg-slab-save-obj_cgroup-for-non-root-slab-objects.patch
* mm-memcg-slab-charge-individual-slab-objects-instead-of-pages.patch
* mm-memcg-slab-deprecate-memorykmemslabinfo.patch
* mm-memcg-slab-move-memcg_kmem_bypass-to-memcontrolh.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-accounted-allocations.patch
* mm-memcg-slab-simplify-memcg-cache-creation.patch
* mm-memcg-slab-remove-memcg_kmem_get_cache.patch
* mm-memcg-slab-deprecate-slab_root_caches.patch
* mm-memcg-slab-remove-redundant-check-in-memcg_accumulate_slabinfo.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-allocations.patch
* mm-memcg-slab-use-a-single-set-of-kmem_caches-for-all-allocations-fix.patch
* kselftests-cgroup-add-kernel-memory-accounting-tests.patch
* tools-cgroup-add-memcg_slabinfopy-tool.patch
* percpu-return-number-of-released-bytes-from-pcpu_free_area.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix-fix.patch
* mm-memcg-percpu-account-percpu-memory-to-memory-cgroups-fix-2.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics.patch
* mm-memcg-percpu-per-memcg-percpu-memory-statistics-v3.patch
* mm-memcg-charge-memcg-percpu-memory-to-the-parent-cgroup.patch
* kselftests-cgroup-add-perpcu-memory-accounting-test.patch
* mm-memcontrol-account-kernel-stack-per-node.patch
* mm-memcg-slab-remove-unused-argument-by-charge_slab_page.patch
* mm-slab-rename-uncharge_slab_page-to-unaccount_slab_page.patch
* mm-kmem-switch-to-static_branch_likely-in-memcg_kmem_enabled.patch
* mm-memcontrol-avoid-workload-stalls-when-lowering-memoryhigh.patch
* mm-memcg-reclaim-more-aggressively-before-high-allocator-throttling.patch
* mm-memcg-unify-reclaim-retry-limits-with-page-allocator.patch
* mm-memcg-avoid-stale-protection-values-when-cgroup-is-above-protection.patch
* mm-memcg-decouple-elowmin-state-mutations-from-protection-checks.patch
* memcg-oom-check-memcg-margin-for-parallel-oom.patch
* mm-remove-redundant-check-non_swap_entry.patch
* mm-memoryc-make-remap_pfn_range-reject-unaligned-addr.patch
* mm-remove-unneeded-includes-of-asm-pgalloch.patch
* mm-remove-unneeded-includes-of-asm-pgalloch-fix.patch
* opeinrisc-switch-to-generic-version-of-pte-allocation.patch
* xtensa-switch-to-generic-version-of-pte-allocation.patch
* asm-generic-pgalloc-provide-generic-pmd_alloc_one-and-pmd_free_one.patch
* asm-generic-pgalloc-provide-generic-pud_alloc_one-and-pud_free_one.patch
* asm-generic-pgalloc-provide-generic-pgd_free.patch
* mm-move-lib-ioremapc-to-mm.patch
* mm-move-pd_alloc_track-to-separate-header-file.patch
* mm-mmap-fix-the-adjusted-length-error.patch
* mm-mmap-optimize-a-branch-judgment-in-ksys_mmap_pgoff.patch
* proc-meminfo-avoid-open-coded-reading-of-vm_committed_as.patch
* mm-utilc-make-vm_memory_committed-more-accurate.patch
* percpu_counter-add-percpu_counter_sync.patch
* mm-adjust-vm_committed_as_batch-according-to-vm-overcommit-policy.patch
* mm-pgtable-make-generic-pgprot_-macros-available-for-no-mmu.patch
* riscv-use-generic-pgprot_-macros-from-linux-pgtableh.patch
* mm-sparsemem-enable-vmem_altmap-support-in-vmemmap_populate_basepages.patch
* mm-sparsemem-enable-vmem_altmap-support-in-vmemmap_alloc_block_buf.patch
* arm64-mm-enable-vmem_altmap-support-for-vmemmap-mappings.patch
* mm-mremap-it-is-sure-to-have-enough-space-when-extent-meets-requirement.patch
* mm-mremap-calculate-extent-in-one-place.patch
* mm-mremap-start-addresses-are-properly-aligned.patch
* mm-sparse-never-partially-remove-memmap-for-early-section.patch
* mm-sparse-only-sub-section-aligned-range-would-be-populated.patch
* mm-sparse-cleanup-the-code-surrounding-memory_present.patch
* vmalloc-convert-to-xarray.patch
* mm-vmalloc-simplify-merge_or_add_vmap_area-func.patch
* mm-vmalloc-simplify-augment_tree_propagate_check-func.patch
* mm-vmalloc-switch-to-propagate-callback.patch
* mm-vmalloc-update-the-header-about-kva-rework.patch
* mm-vmalloc-remove-redundant-asignmnet-in-unmap_kernel_range_noflush.patch
* mm-vmallocc-remove-bug-from-the-find_va_links.patch
* kasan-improve-and-simplify-kconfigkasan.patch
* kasan-update-required-compiler-versions-in-documentation.patch
* rcu-kasan-record-and-print-call_rcu-call-stack.patch
* rcu-kasan-record-and-print-call_rcu-call-stack-v8.patch
* kasan-record-and-print-the-free-track.patch
* kasan-record-and-print-the-free-track-v8.patch
* kasan-add-tests-for-call_rcu-stack-recording.patch
* kasan-update-documentation-for-generic-kasan.patch
* kasan-remove-kasan_unpoison_stack_above_sp_to.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan.patch
* kasan-fix-kasan-unit-tests-for-tag-based-kasan-v4.patch
* mm-page_alloc-use-unlikely-in-task_capc.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast.patch
* page_alloc-consider-highatomic-reserve-in-watermark-fast-v5.patch
* mm-page_alloc-skip-waternark_boost-for-atomic-order-0-allocations.patch
* mm-page_alloc-skip-watermark_boost-for-atomic-order-0-allocations-fix.patch
* mm-drop-vm_total_pages.patch
* mm-page_alloc-drop-nr_free_pagecache_pages.patch
* mm-memory_hotplug-document-why-shuffle_zone-is-relevant.patch
* mm-shuffle-remove-dynamic-reconfiguration.patch
* powerpc-numa-set-numa_node-for-all-possible-cpus.patch
* powerpc-numa-prefer-node-id-queried-from-vphn.patch
* mm-page_alloc-keep-memoryless-cpuless-node-0-offline.patch
* mm-page_allocc-replace-the-definition-of-nr_migratetype_bits-with-pb_migratetype_bits.patch
* mm-page_allocc-extract-the-common-part-in-pfn_to_bitidx.patch
* mm-page_allocc-simplify-pageblock-bitmap-access.patch
* mm-page_allocc-remove-unnecessary-end_bitidx-for-_pfnblock_flags_mask.patch
* mm-page_alloc-silence-a-kasan-false-positive.patch
* mm-page_alloc-fallbacks-at-most-has-3-elements.patch
* mm-page_alloc-skip-setting-nodemask-when-we-are-in-interrupt.patch
* mm-huge_memoryc-update-tlb-entry-if-pmd-is-changed.patch
* mips-do-not-call-flush_tlb_all-when-setting-pmd-entry.patch
* mm-hugetlb-split-hugetlb_cma-in-nodes-with-memory.patch
* mm-thp-replace-http-links-with-https-ones.patch
* mm-thp-replace-http-links-with-https-ones-fix.patch
* mm-vmscanc-fixed-typo.patch
* mm-vmscan-consistent-update-to-pgrefill.patch
* mm-proactive-compaction.patch
* mm-proactive-compaction-fix.patch
* mm-use-unsigned-types-for-fragmentation-score.patch
* mm-oom-make-the-calculation-of-oom-badness-more-accurate.patch
* mm-oom-make-the-calculation-of-oom-badness-more-accurate-v3.patch
* doc-mm-sync-up-oom_score_adj-documentation.patch
* doc-mm-clarify-proc-pid-oom_score-value-range.patch
* hugetlbfs-prevent-filesystem-stacking-of-hugetlbfs.patch
* mm-migrate-optimize-migrate_vma_setup-for-holes.patch
* mm-migrate-optimize-migrate_vma_setup-for-holes-v2.patch
* mm-migrate-add-migrate-shared-test-for-migrate_vma_.patch
* mm-thp-remove-debug_cow-switch.patch
* mm-store-compound_nr-as-well-as-compound_order.patch
* mm-move-page-flags-include-to-top-of-file.patch
* mm-add-thp_order.patch
* mm-add-thp_size.patch
* mm-replace-hpage_nr_pages-with-thp_nr_pages.patch
* mm-add-thp_head.patch
* mm-introduce-offset_in_thp.patch
* mm-vmstat-add-events-for-thp-migration-without-split.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix.patch
* mm-vmstat-add-events-for-thp-migration-without-split-fix-2.patch
* mm-cma-fix-null-pointer-dereference-when-cma-could-not-be-activated.patch
* mm-cma-fix-the-name-of-cma-areas.patch
* mm-cma-fix-the-name-of-cma-areas-fix.patch
* mm-hugetlb-fix-the-name-of-hugetlb-cma.patch
* mmhwpoison-cleanup-unused-pagehuge-check.patch
* mm-hwpoison-remove-recalculating-hpage.patch
* mmmadvise-call-soft_offline_page-without-mf_count_increased.patch
* mmmadvise-refactor-madvise_inject_error.patch
* mmhwpoison-inject-dont-pin-for-hwpoison_filter.patch
* mmhwpoison-un-export-get_hwpoison_page-and-make-it-static.patch
* mmhwpoison-kill-put_hwpoison_page.patch
* mmhwpoison-remove-mf_count_increased.patch
* mmhwpoison-remove-flag-argument-from-soft-offline-functions.patch
* mmhwpoison-unify-thp-handling-for-hard-and-soft-offline.patch
* mmhwpoison-rework-soft-offline-for-free-pages.patch
* mmhwpoison-rework-soft-offline-for-in-use-pages.patch
* mmhwpoison-rework-soft-offline-for-in-use-pages-fix.patch
* mmhwpoison-refactor-soft_offline_huge_page-and-__soft_offline_page.patch
* mmhwpoison-return-0-if-the-page-is-already-poisoned-in-soft-offline.patch
* mmhwpoison-introduce-mf_msg_unsplit_thp.patch
* mm-vmstat-fix-proc-sys-vm-stat_refresh-generating-false-warnings.patch
* mm-vmstat-fix-proc-sys-vm-stat_refresh-generating-false-warnings-fix.patch
* mm-vmstat-fix-proc-sys-vm-stat_refresh-generating-false-warnings-fix-2.patch
* sched-mm-optimize-current_gfp_context.patch
* x86-mm-use-max-memory-block-size-on-bare-metal.patch
* x86-mm-use-max-memory-block-size-on-bare-metal-v3.patch
* mm-memory_hotplug-introduce-default-dummy-memory_add_physaddr_to_nid.patch
* mm-memory_hotplug-fix-unpaired-mem_hotplug_begin-done.patch
* linux-sched-mmh-drop-duplicated-words-in-comments.patch
* mm-drop-duplicated-words-in-linux-pgtableh.patch
* mm-drop-duplicated-words-in-linux-mmh.patch
* highmem-linux-highmemh-fix-duplicated-words-in-a-comment.patch
* frontswap-linux-frontswaph-drop-duplicated-word-in-a-comment.patch
* memcontrol-drop-duplicate-word-and-fix-spello-in-linux-memcontrolh.patch
* syscalls-use-uaccess_kernel-in-addr_limit_user_check.patch
* nds32-use-uaccess_kernel-in-show_regs.patch
* riscv-include-asm-pgtableh-in-asm-uaccessh.patch
* uaccess-remove-segment_eq.patch
* uaccess-add-force_uaccess_beginend-helpers.patch
* uaccess-add-force_uaccess_beginend-helpers-v2.patch
* exec-use-force_uaccess_begin-during-exec-and-exit.patch
* info-task-hung-in-generic_file_write_iter.patch
* info-task-hung-in-generic_file_write-fix.patch
* kernel-hung_taskc-monitor-killed-tasks.patch
* fix-annotation-of-ioreadwrite1632be.patch
* proc-sysctl-make-protected_-world-readable.patch
* clang-linux-compiler-clangh-drop-duplicated-word-in-a-comment.patch
* linux-exportfsh-drop-duplicated-word-in-a-comment.patch
* linux-async_txh-drop-duplicated-word-in-a-comment.patch
* xz-drop-duplicated-word-in-linux-xzh.patch
* sparse-group-the-defines-by-functionality.patch
* bitmap-fix-bitmap_cut-for-partial-overlapping-case.patch
* bitmap-add-test-for-bitmap_cut.patch
* lib-generic-radix-treec-remove-unneeded-__rcu.patch
* lib-test_bitops-do-the-full-test-during-module-init.patch
* lib-optimize-cpumask_local_spread.patch
* lib-test_lockupc-make-symbol-test_works-static.patch
* iomap-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* rtl818x-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* ntb-intel-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* virtio-pci-constify-ioreadx-iomem-argument-as-in-generic-implementation.patch
* bits-add-tests-of-genmask.patch
* bits-add-tests-of-genmask-fix.patch
* bits-add-tests-of-genmask-fix-2.patch
* checkpatch-add-test-for-possible-misuse-of-is_enabled-without-config_.patch
* checkpatch-support-deprecated-terms-checking.patch
* scripts-deprecated_terms-recommend-denylist-allowlist-instead-of-blacklist-whitelist.patch
* checkpatch-add-fix-option-for-assign_in_if.patch
* checkpatch-fix-const_struct-when-const_structscheckpatch-is-missing.patch
* autofs-fix-doubled-word.patch
* fs-minix-check-return-value-of-sb_getblk.patch
* fs-minix-dont-allow-getting-deleted-inodes.patch
* fs-minix-reject-too-large-maximum-file-size.patch
* fs-minix-set-s_maxbytes-correctly.patch
* fs-minix-fix-block-limit-check-for-v1-filesystems.patch
* fs-minix-remove-expected-error-message-in-block_to_path.patch
* fs-ufs-avoid-potential-u32-multiplication-overflow.patch
* fatfs-switch-write_lock-to-read_lock-in-fat_ioctl_get_attributes.patch
* vfat-fat-msdos-filesystem-replace-http-links-with-https-ones.patch
* fat-fix-fat_ra_init-for-data-clusters-==-0.patch
* fs-signalfdc-fix-inconsistent-return-codes-for-signalfd4.patch
* selftests-kmod-use-variable-name-in-kmod_test_0001.patch
* kmod-remove-redundant-be-an-in-the-comment.patch
* test_kmod-avoid-potential-double-free-in-trigger_config_run_type.patch
* coredump-add-%f-for-executable-filename.patch
* exec-change-uselib2-is_sreg-failure-to-eacces.patch
* exec-move-s_isreg-check-earlier.patch
* exec-move-path_noexec-check-earlier.patch
* kdump-append-kernel-build-id-string-to-vmcoreinfo.patch
* rapidio-rio_mport_cdev-use-struct_size-helper.patch
* rapidio-use-struct_size-helper.patch
* rapidio-rio_mport_cdev-use-array_size-helper-in-copy_fromto_user.patch
* kernel-panicc-make-oops_may_print-return-bool.patch
* lib-kconfigdebug-fix-typo-in-the-help-text-of-config_panic_timeout.patch
* aio-simplify-read_events.patch
* kcov-unconditionally-add-fno-stack-protector-to-compiler-options.patch
* kcov-make-some-symbols-static.patch
* ipc-uninline-functions.patch
* ipc-shmc-remove-the-superfluous-break.patch
  linux-next.patch
  linux-next-rejects.patch
* mm-page_isolation-prefer-the-node-of-the-source-page.patch
* mm-migrate-move-migration-helper-from-h-to-c.patch
* mm-hugetlb-unify-migration-callbacks.patch
* mm-migrate-clear-__gfp_reclaim-to-make-the-migration-callback-consistent-with-regular-thp-allocations.patch
* mm-migrate-clear-__gfp_reclaim-to-make-the-migration-callback-consistent-with-regular-thp-allocations-fix.patch
* mm-migrate-make-a-standard-migration-target-allocation-function.patch
* mm-mempolicy-use-a-standard-migration-target-allocation-callback.patch
* mm-page_alloc-remove-a-wrapper-for-alloc_migration_target.patch
* mm-memory-failure-remove-a-wrapper-for-alloc_migration_target.patch
* mm-memory_hotplug-remove-a-wrapper-for-alloc_migration_target.patch
* scripts-deprecated_terms-sync-with-inclusive-terms.patch
* mm-do-page-fault-accounting-in-handle_mm_fault.patch
* mm-alpha-use-general-page-fault-accounting.patch
* mm-arc-use-general-page-fault-accounting.patch
* mm-arm-use-general-page-fault-accounting.patch
* mm-arm64-use-general-page-fault-accounting.patch
* mm-csky-use-general-page-fault-accounting.patch
* mm-hexagon-use-general-page-fault-accounting.patch
* mm-ia64-use-general-page-fault-accounting.patch
* mm-m68k-use-general-page-fault-accounting.patch
* mm-microblaze-use-general-page-fault-accounting.patch
* mm-mips-use-general-page-fault-accounting.patch
* mm-nds32-use-general-page-fault-accounting.patch
* mm-nios2-use-general-page-fault-accounting.patch
* mm-openrisc-use-general-page-fault-accounting.patch
* mm-parisc-use-general-page-fault-accounting.patch
* mm-powerpc-use-general-page-fault-accounting.patch
* mm-riscv-use-general-page-fault-accounting.patch
* mm-s390-use-general-page-fault-accounting.patch
* mm-sh-use-general-page-fault-accounting.patch
* mm-sparc32-use-general-page-fault-accounting.patch
* mm-sparc64-use-general-page-fault-accounting.patch
* mm-x86-use-general-page-fault-accounting.patch
* mm-xtensa-use-general-page-fault-accounting.patch
* mm-clean-up-the-last-pieces-of-page-fault-accountings.patch
* mm-gup-remove-task_struct-pointer-for-all-gup-code.patch
* mm-gup-remove-task_struct-pointer-for-all-gup-code-fix.patch
* mm-madvise-pass-task-and-mm-to-do_madvise.patch
* pid-move-pidfd_get_pid-to-pidc.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix.patch
* mm-madvise-introduce-process_madvise-syscall-an-external-memory-hinting-api-fix-2.patch
* mm-madvise-check-fatal-signal-pending-of-target-process.patch
* all-arch-remove-system-call-sys_sysctl.patch
* all-arch-remove-system-call-sys_sysctl-fix.patch
* mm-kmemleak-silence-kcsan-splats-in-checksum.patch
* mm-frontswap-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races-v2.patch
* mm-swap_state-mark-various-intentional-data-races.patch
* mm-filemap-fix-a-data-race-in-filemap_fault.patch
* mm-swapfile-fix-and-annotate-various-data-races.patch
* mm-swapfile-fix-and-annotate-various-data-races-v2.patch
* mm-page_counter-fix-various-data-races-at-memsw.patch
* mm-memcontrol-fix-a-data-race-in-scan-count.patch
* mm-list_lru-fix-a-data-race-in-list_lru_count_one.patch
* mm-mempool-fix-a-data-race-in-mempool_free.patch
* mm-rmap-annotate-a-data-race-at-tlb_flush_batched.patch
* mm-swap-annotate-data-races-for-lru_rotate_pvecs.patch
* mm-annotate-a-data-race-in-page_zonenum.patch
* include-asm-generic-vmlinuxldsh-align-ro_after_init.patch
* sh-clkfwk-remove-r8-r16-r32.patch
* sh-use-generic-strncpy.patch
* sh-add-missing-export_symbol-for-__delay.patch
  make-sure-nobodys-leaking-resources.patch
  releasing-resources-with-children.patch
  mutex-subsystem-synchro-test-module.patch
  kernel-forkc-export-kernel_thread-to-modules.patch
  workaround-for-a-pci-restoring-bug.patch


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-20-19-06 uploaded (net/ipv6/ip6_vti.o)
  2020-07-21  2:07 ` mmotm 2020-07-20-19-06 uploaded Andrew Morton
@ 2020-07-21  6:09   ` Randy Dunlap
  2020-07-21  6:14     ` Steffen Klassert
  2020-07-21  6:54     ` Stephen Rothwell
  0 siblings, 2 replies; 203+ messages in thread
From: Randy Dunlap @ 2020-07-21  6:09 UTC (permalink / raw)
  To: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, sfr, netdev, Alexey Kuznetsov,
	Hideaki YOSHIFUJI, David Miller

[-- Attachment #1: Type: text/plain, Size: 796 bytes --]

On 7/20/20 7:07 PM, Andrew Morton wrote:
> The mm-of-the-moment snapshot 2020-07-20-19-06 has been uploaded to
> 
>    http://www.ozlabs.org/~akpm/mmotm/
> 
> mmotm-readme.txt says
> 
> README for mm-of-the-moment:
> 
> http://www.ozlabs.org/~akpm/mmotm/
> 
> This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
> more than once a week.
> 
> You will need quilt to apply these patches to the latest Linus release (5.x
> or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
> http://ozlabs.org/~akpm/mmotm/series
> 


on i386:

ld: net/ipv6/ip6_vti.o: in function `vti6_rcv_tunnel':
ip6_vti.c:(.text+0x2d11): undefined reference to `xfrm6_tunnel_spi_lookup'

Full randconfig file is attached.

-- 
~Randy
Reported-by: Randy Dunlap <rdunlap@infradead.org>

[-- Attachment #2: config-r4081 --]
[-- Type: text/plain, Size: 142585 bytes --]

#
# Automatically generated file; DO NOT EDIT.
# Linux/i386 5.8.0-rc6-mm1 Kernel Configuration
#
CONFIG_CC_VERSION_TEXT="gcc (SUSE Linux) 7.5.0"
CONFIG_CC_IS_GCC=y
CONFIG_GCC_VERSION=70500
CONFIG_LD_VERSION=232000000
CONFIG_CLANG_VERSION=0
CONFIG_CC_HAS_ASM_GOTO=y
CONFIG_CC_HAS_ASM_INLINE=y
CONFIG_CONSTRUCTORS=y
CONFIG_IRQ_WORK=y
CONFIG_BUILDTIME_TABLE_SORT=y
CONFIG_THREAD_INFO_IN_TASK=y

#
# General setup
#
CONFIG_INIT_ENV_ARG_LIMIT=32
CONFIG_COMPILE_TEST=y
CONFIG_LOCALVERSION=""
CONFIG_BUILD_SALT=""
CONFIG_HAVE_KERNEL_GZIP=y
CONFIG_HAVE_KERNEL_BZIP2=y
CONFIG_HAVE_KERNEL_LZMA=y
CONFIG_HAVE_KERNEL_XZ=y
CONFIG_HAVE_KERNEL_LZO=y
CONFIG_HAVE_KERNEL_LZ4=y
# CONFIG_KERNEL_GZIP is not set
# CONFIG_KERNEL_BZIP2 is not set
CONFIG_KERNEL_LZMA=y
# CONFIG_KERNEL_XZ is not set
# CONFIG_KERNEL_LZO is not set
# CONFIG_KERNEL_LZ4 is not set
CONFIG_DEFAULT_INIT=""
CONFIG_DEFAULT_HOSTNAME="(none)"
CONFIG_SYSVIPC=y
CONFIG_SYSVIPC_SYSCTL=y
CONFIG_POSIX_MQUEUE=y
CONFIG_POSIX_MQUEUE_SYSCTL=y
CONFIG_WATCH_QUEUE=y
CONFIG_CROSS_MEMORY_ATTACH=y
CONFIG_USELIB=y
# CONFIG_AUDIT is not set
CONFIG_HAVE_ARCH_AUDITSYSCALL=y

#
# IRQ subsystem
#
CONFIG_GENERIC_IRQ_PROBE=y
CONFIG_GENERIC_IRQ_SHOW=y
CONFIG_GENERIC_IRQ_EFFECTIVE_AFF_MASK=y
CONFIG_GENERIC_PENDING_IRQ=y
CONFIG_GENERIC_IRQ_MIGRATION=y
CONFIG_HARDIRQS_SW_RESEND=y
CONFIG_GENERIC_IRQ_CHIP=y
CONFIG_IRQ_DOMAIN=y
CONFIG_IRQ_DOMAIN_HIERARCHY=y
CONFIG_IRQ_FASTEOI_HIERARCHY_HANDLERS=y
CONFIG_GENERIC_MSI_IRQ=y
CONFIG_GENERIC_MSI_IRQ_DOMAIN=y
CONFIG_GENERIC_IRQ_MATRIX_ALLOCATOR=y
CONFIG_GENERIC_IRQ_RESERVATION_MODE=y
CONFIG_IRQ_FORCED_THREADING=y
CONFIG_SPARSE_IRQ=y
# CONFIG_GENERIC_IRQ_DEBUGFS is not set
# end of IRQ subsystem

CONFIG_CLOCKSOURCE_WATCHDOG=y
CONFIG_ARCH_CLOCKSOURCE_INIT=y
CONFIG_CLOCKSOURCE_VALIDATE_LAST_CYCLE=y
CONFIG_GENERIC_TIME_VSYSCALL=y
CONFIG_GENERIC_CLOCKEVENTS=y
CONFIG_GENERIC_CLOCKEVENTS_BROADCAST=y
CONFIG_GENERIC_CLOCKEVENTS_MIN_ADJUST=y
CONFIG_GENERIC_CMOS_UPDATE=y

#
# Timers subsystem
#
CONFIG_TICK_ONESHOT=y
CONFIG_HZ_PERIODIC=y
# CONFIG_NO_HZ_IDLE is not set
CONFIG_NO_HZ=y
CONFIG_HIGH_RES_TIMERS=y
# end of Timers subsystem

# CONFIG_PREEMPT_NONE is not set
CONFIG_PREEMPT_VOLUNTARY=y
# CONFIG_PREEMPT is not set

#
# CPU/Task time and stats accounting
#
CONFIG_TICK_CPU_ACCOUNTING=y
# CONFIG_IRQ_TIME_ACCOUNTING is not set
CONFIG_SCHED_THERMAL_PRESSURE=y
CONFIG_BSD_PROCESS_ACCT=y
# CONFIG_BSD_PROCESS_ACCT_V3 is not set
# CONFIG_TASKSTATS is not set
# CONFIG_PSI is not set
# end of CPU/Task time and stats accounting

CONFIG_CPU_ISOLATION=y

#
# RCU Subsystem
#
CONFIG_TREE_RCU=y
# CONFIG_RCU_EXPERT is not set
CONFIG_SRCU=y
CONFIG_TREE_SRCU=y
CONFIG_TASKS_RCU_GENERIC=y
CONFIG_TASKS_RCU=y
CONFIG_TASKS_RUDE_RCU=y
CONFIG_TASKS_TRACE_RCU=y
CONFIG_RCU_STALL_COMMON=y
CONFIG_RCU_NEED_SEGCBLIST=y
# end of RCU Subsystem

CONFIG_BUILD_BIN2C=y
CONFIG_IKCONFIG=y
# CONFIG_IKCONFIG_PROC is not set
CONFIG_IKHEADERS=m
CONFIG_LOG_BUF_SHIFT=17
CONFIG_LOG_CPU_MAX_BUF_SHIFT=12
CONFIG_PRINTK_SAFE_LOG_BUF_SHIFT=13
CONFIG_HAVE_UNSTABLE_SCHED_CLOCK=y

#
# Scheduler features
#
# end of Scheduler features

CONFIG_ARCH_WANT_BATCHED_UNMAP_TLB_FLUSH=y
CONFIG_CGROUPS=y
CONFIG_PAGE_COUNTER=y
CONFIG_MEMCG=y
CONFIG_CGROUP_SCHED=y
CONFIG_FAIR_GROUP_SCHED=y
# CONFIG_CFS_BANDWIDTH is not set
CONFIG_RT_GROUP_SCHED=y
# CONFIG_CGROUP_PIDS is not set
# CONFIG_CGROUP_RDMA is not set
CONFIG_CGROUP_FREEZER=y
# CONFIG_CGROUP_HUGETLB is not set
# CONFIG_CPUSETS is not set
# CONFIG_CGROUP_DEVICE is not set
CONFIG_CGROUP_CPUACCT=y
# CONFIG_CGROUP_PERF is not set
CONFIG_CGROUP_BPF=y
CONFIG_CGROUP_DEBUG=y
CONFIG_SOCK_CGROUP_DATA=y
# CONFIG_NAMESPACES is not set
CONFIG_CHECKPOINT_RESTORE=y
CONFIG_SCHED_AUTOGROUP=y
CONFIG_SYSFS_DEPRECATED=y
# CONFIG_SYSFS_DEPRECATED_V2 is not set
# CONFIG_RELAY is not set
CONFIG_BLK_DEV_INITRD=y
CONFIG_INITRAMFS_SOURCE=""
CONFIG_RD_GZIP=y
# CONFIG_RD_BZIP2 is not set
# CONFIG_RD_LZMA is not set
CONFIG_RD_XZ=y
CONFIG_RD_LZO=y
# CONFIG_RD_LZ4 is not set
# CONFIG_BOOT_CONFIG is not set
CONFIG_CC_OPTIMIZE_FOR_PERFORMANCE=y
# CONFIG_CC_OPTIMIZE_FOR_SIZE is not set
CONFIG_SYSCTL=y
CONFIG_HAVE_UID16=y
CONFIG_SYSCTL_EXCEPTION_TRACE=y
CONFIG_HAVE_PCSPKR_PLATFORM=y
CONFIG_BPF=y
CONFIG_EXPERT=y
CONFIG_UID16=y
CONFIG_MULTIUSER=y
CONFIG_SGETMASK_SYSCALL=y
CONFIG_SYSFS_SYSCALL=y
# CONFIG_FHANDLE is not set
CONFIG_POSIX_TIMERS=y
CONFIG_PRINTK=y
CONFIG_PRINTK_NMI=y
# CONFIG_BUG is not set
CONFIG_PCSPKR_PLATFORM=y
CONFIG_BASE_FULL=y
# CONFIG_FUTEX is not set
# CONFIG_EPOLL is not set
CONFIG_SIGNALFD=y
# CONFIG_TIMERFD is not set
CONFIG_EVENTFD=y
CONFIG_SHMEM=y
# CONFIG_AIO is not set
# CONFIG_IO_URING is not set
# CONFIG_ADVISE_SYSCALLS is not set
CONFIG_MEMBARRIER=y
CONFIG_KALLSYMS=y
CONFIG_KALLSYMS_ALL=y
CONFIG_KALLSYMS_BASE_RELATIVE=y
CONFIG_BPF_SYSCALL=y
CONFIG_USERFAULTFD=y
CONFIG_ARCH_HAS_MEMBARRIER_SYNC_CORE=y
CONFIG_RSEQ=y
CONFIG_DEBUG_RSEQ=y
# CONFIG_EMBEDDED is not set
CONFIG_HAVE_PERF_EVENTS=y
CONFIG_PERF_USE_VMALLOC=y
CONFIG_PC104=y

#
# Kernel Performance Events And Counters
#
CONFIG_PERF_EVENTS=y
CONFIG_DEBUG_PERF_USE_VMALLOC=y
# end of Kernel Performance Events And Counters

# CONFIG_VM_EVENT_COUNTERS is not set
# CONFIG_COMPAT_BRK is not set
# CONFIG_SLAB is not set
# CONFIG_SLUB is not set
CONFIG_SLOB=y
CONFIG_SLAB_MERGE_DEFAULT=y
CONFIG_SHUFFLE_PAGE_ALLOCATOR=y
CONFIG_SYSTEM_DATA_VERIFICATION=y
# CONFIG_PROFILING is not set
CONFIG_TRACEPOINTS=y
# end of General setup

CONFIG_X86_32=y
CONFIG_FORCE_DYNAMIC_FTRACE=y
CONFIG_X86=y
CONFIG_INSTRUCTION_DECODER=y
CONFIG_OUTPUT_FORMAT="elf32-i386"
CONFIG_LOCKDEP_SUPPORT=y
CONFIG_STACKTRACE_SUPPORT=y
CONFIG_MMU=y
CONFIG_ARCH_MMAP_RND_BITS_MIN=8
CONFIG_ARCH_MMAP_RND_BITS_MAX=16
CONFIG_ARCH_MMAP_RND_COMPAT_BITS_MIN=8
CONFIG_ARCH_MMAP_RND_COMPAT_BITS_MAX=16
CONFIG_GENERIC_ISA_DMA=y
CONFIG_ARCH_MAY_HAVE_PC_FDC=y
CONFIG_GENERIC_CALIBRATE_DELAY=y
CONFIG_ARCH_HAS_CPU_RELAX=y
CONFIG_ARCH_HAS_CACHE_LINE_SIZE=y
CONFIG_ARCH_HAS_FILTER_PGPROT=y
CONFIG_HAVE_SETUP_PER_CPU_AREA=y
CONFIG_NEED_PER_CPU_EMBED_FIRST_CHUNK=y
CONFIG_NEED_PER_CPU_PAGE_FIRST_CHUNK=y
CONFIG_ARCH_HIBERNATION_POSSIBLE=y
CONFIG_ARCH_SUSPEND_POSSIBLE=y
CONFIG_ARCH_WANT_GENERAL_HUGETLB=y
CONFIG_ARCH_SUPPORTS_DEBUG_PAGEALLOC=y
CONFIG_X86_32_SMP=y
CONFIG_X86_32_LAZY_GS=y
CONFIG_ARCH_SUPPORTS_UPROBES=y
CONFIG_FIX_EARLYCON_MEM=y
CONFIG_PGTABLE_LEVELS=3
CONFIG_CC_HAS_SANE_STACKPROTECTOR=y

#
# Processor type and features
#
CONFIG_ZONE_DMA=y
CONFIG_SMP=y
CONFIG_X86_FEATURE_NAMES=y
CONFIG_X86_MPPARSE=y
# CONFIG_GOLDFISH is not set
# CONFIG_RETPOLINE is not set
CONFIG_X86_CPU_RESCTRL=y
# CONFIG_X86_BIGSMP is not set
# CONFIG_X86_EXTENDED_PLATFORM is not set
CONFIG_X86_32_IRIS=y
CONFIG_SCHED_OMIT_FRAME_POINTER=y
# CONFIG_HYPERVISOR_GUEST is not set
# CONFIG_M486SX is not set
CONFIG_M486=y
# CONFIG_M586 is not set
# CONFIG_M586TSC is not set
# CONFIG_M586MMX is not set
# CONFIG_M686 is not set
# CONFIG_MPENTIUMII is not set
# CONFIG_MPENTIUMIII is not set
# CONFIG_MPENTIUMM is not set
# CONFIG_MPENTIUM4 is not set
# CONFIG_MK6 is not set
# CONFIG_MK7 is not set
# CONFIG_MK8 is not set
# CONFIG_MCRUSOE is not set
# CONFIG_MEFFICEON is not set
# CONFIG_MWINCHIPC6 is not set
# CONFIG_MWINCHIP3D is not set
# CONFIG_MELAN is not set
# CONFIG_MGEODEGX1 is not set
# CONFIG_MGEODE_LX is not set
# CONFIG_MCYRIXIII is not set
# CONFIG_MVIAC3_2 is not set
# CONFIG_MVIAC7 is not set
# CONFIG_MCORE2 is not set
# CONFIG_MATOM is not set
CONFIG_X86_GENERIC=y
CONFIG_X86_INTERNODE_CACHE_SHIFT=6
CONFIG_X86_L1_CACHE_SHIFT=6
CONFIG_X86_F00F_BUG=y
CONFIG_X86_INVD_BUG=y
CONFIG_X86_ALIGNMENT_16=y
CONFIG_X86_INTEL_USERCOPY=y
CONFIG_X86_CMPXCHG64=y
CONFIG_X86_MINIMUM_CPU_FAMILY=5
CONFIG_IA32_FEAT_CTL=y
CONFIG_X86_VMX_FEATURE_NAMES=y
# CONFIG_PROCESSOR_SELECT is not set
CONFIG_CPU_SUP_INTEL=y
CONFIG_CPU_SUP_CYRIX_32=y
CONFIG_CPU_SUP_AMD=y
CONFIG_CPU_SUP_HYGON=y
CONFIG_CPU_SUP_CENTAUR=y
CONFIG_CPU_SUP_TRANSMETA_32=y
CONFIG_CPU_SUP_UMC_32=y
CONFIG_CPU_SUP_ZHAOXIN=y
# CONFIG_HPET_TIMER is not set
CONFIG_DMI=y
CONFIG_NR_CPUS_RANGE_BEGIN=2
CONFIG_NR_CPUS_RANGE_END=8
CONFIG_NR_CPUS_DEFAULT=8
CONFIG_NR_CPUS=8
CONFIG_SCHED_SMT=y
# CONFIG_SCHED_MC is not set
CONFIG_X86_LOCAL_APIC=y
CONFIG_X86_IO_APIC=y
CONFIG_X86_REROUTE_FOR_BROKEN_BOOT_IRQS=y
CONFIG_X86_MCE=y
# CONFIG_X86_MCELOG_LEGACY is not set
CONFIG_X86_MCE_INTEL=y
CONFIG_X86_ANCIENT_MCE=y
CONFIG_X86_MCE_THRESHOLD=y
CONFIG_X86_MCE_INJECT=y
CONFIG_X86_THERMAL_VECTOR=y

#
# Performance monitoring
#
# CONFIG_PERF_EVENTS_AMD_POWER is not set
# end of Performance monitoring

CONFIG_X86_LEGACY_VM86=y
CONFIG_VM86=y
CONFIG_X86_IOPL_IOPERM=y
# CONFIG_TOSHIBA is not set
CONFIG_I8K=m
# CONFIG_X86_REBOOTFIXUPS is not set
CONFIG_MICROCODE=y
# CONFIG_MICROCODE_INTEL is not set
# CONFIG_MICROCODE_AMD is not set
# CONFIG_MICROCODE_OLD_INTERFACE is not set
CONFIG_X86_MSR=y
CONFIG_X86_CPUID=y
CONFIG_NOHIGHMEM=y
# CONFIG_HIGHMEM4G is not set
# CONFIG_VMSPLIT_3G is not set
CONFIG_VMSPLIT_2G=y
# CONFIG_VMSPLIT_1G is not set
CONFIG_PAGE_OFFSET=0x80000000
CONFIG_X86_PAE=y
CONFIG_X86_CPA_STATISTICS=y
CONFIG_ARCH_FLATMEM_ENABLE=y
CONFIG_ARCH_SPARSEMEM_ENABLE=y
CONFIG_ARCH_SELECT_MEMORY_MODEL=y
CONFIG_ILLEGAL_POINTER_VALUE=0
CONFIG_X86_CHECK_BIOS_CORRUPTION=y
CONFIG_X86_BOOTPARAM_MEMORY_CORRUPTION_CHECK=y
CONFIG_X86_RESERVE_LOW=64
# CONFIG_MTRR is not set
CONFIG_ARCH_RANDOM=y
CONFIG_X86_SMAP=y
CONFIG_X86_UMIP=y
CONFIG_X86_INTEL_TSX_MODE_OFF=y
# CONFIG_X86_INTEL_TSX_MODE_ON is not set
# CONFIG_X86_INTEL_TSX_MODE_AUTO is not set
CONFIG_SECCOMP=y
# CONFIG_HZ_100 is not set
CONFIG_HZ_250=y
# CONFIG_HZ_300 is not set
# CONFIG_HZ_1000 is not set
CONFIG_HZ=250
CONFIG_SCHED_HRTICK=y
CONFIG_KEXEC=y
CONFIG_PHYSICAL_START=0x1000000
CONFIG_RELOCATABLE=y
# CONFIG_RANDOMIZE_BASE is not set
CONFIG_X86_NEED_RELOCS=y
CONFIG_PHYSICAL_ALIGN=0x200000
CONFIG_HOTPLUG_CPU=y
# CONFIG_BOOTPARAM_HOTPLUG_CPU0 is not set
CONFIG_DEBUG_HOTPLUG_CPU0=y
# CONFIG_COMPAT_VDSO is not set
# CONFIG_CMDLINE_BOOL is not set
# CONFIG_MODIFY_LDT_SYSCALL is not set
# end of Processor type and features

CONFIG_ARCH_ENABLE_SPLIT_PMD_PTLOCK=y

#
# Power management and ACPI options
#
CONFIG_SUSPEND=y
CONFIG_SUSPEND_FREEZER=y
# CONFIG_SUSPEND_SKIP_SYNC is not set
CONFIG_PM_SLEEP=y
CONFIG_PM_SLEEP_SMP=y
# CONFIG_PM_AUTOSLEEP is not set
CONFIG_PM_WAKELOCKS=y
CONFIG_PM_WAKELOCKS_LIMIT=100
CONFIG_PM_WAKELOCKS_GC=y
CONFIG_PM=y
# CONFIG_PM_DEBUG is not set
CONFIG_PM_CLK=y
CONFIG_PM_GENERIC_DOMAINS=y
# CONFIG_WQ_POWER_EFFICIENT_DEFAULT is not set
CONFIG_PM_GENERIC_DOMAINS_SLEEP=y
CONFIG_PM_GENERIC_DOMAINS_OF=y
CONFIG_ARCH_SUPPORTS_ACPI=y
# CONFIG_ACPI is not set
CONFIG_SFI=y
CONFIG_X86_APM_BOOT=y
CONFIG_APM=y
CONFIG_APM_IGNORE_USER_SUSPEND=y
# CONFIG_APM_DO_ENABLE is not set
# CONFIG_APM_DISPLAY_BLANK is not set
# CONFIG_APM_ALLOW_INTS is not set

#
# CPU Frequency scaling
#
# CONFIG_CPU_FREQ is not set
# end of CPU Frequency scaling

#
# CPU Idle
#
# CONFIG_CPU_IDLE is not set
# end of CPU Idle
# end of Power management and ACPI options

#
# Bus options (PCI etc.)
#
CONFIG_ISA_BUS=y
CONFIG_ISA_DMA_API=y
# CONFIG_ISA is not set
CONFIG_SCx200=y
CONFIG_SCx200HR_TIMER=y
CONFIG_ALIX=y
# CONFIG_NET5501 is not set
# CONFIG_GEOS is not set
CONFIG_X86_SYSFB=y
# end of Bus options (PCI etc.)

#
# Binary Emulations
#
CONFIG_COMPAT_32=y
# end of Binary Emulations

CONFIG_HAVE_ATOMIC_IOMAP=y

#
# Firmware Drivers
#
CONFIG_ARM_SCMI_POWER_DOMAIN=y
CONFIG_ARM_SCPI_POWER_DOMAIN=y
CONFIG_EDD=m
# CONFIG_EDD_OFF is not set
# CONFIG_FIRMWARE_MEMMAP is not set
# CONFIG_DMIID is not set
# CONFIG_DMI_SYSFS is not set
CONFIG_DMI_SCAN_MACHINE_NON_EFI_FALLBACK=y
CONFIG_FW_CFG_SYSFS=m
# CONFIG_FW_CFG_SYSFS_CMDLINE is not set
# CONFIG_BCM47XX_NVRAM is not set
CONFIG_TEE_BNXT_FW=m
# CONFIG_GOOGLE_FIRMWARE is not set
CONFIG_EFI_EARLYCON=y

#
# Tegra firmware driver
#
# end of Tegra firmware driver
# end of Firmware Drivers

CONFIG_HAVE_KVM=y
CONFIG_VIRTUALIZATION=y
# CONFIG_KVM is not set
CONFIG_AS_AVX512=y
CONFIG_AS_SHA1_NI=y
CONFIG_AS_SHA256_NI=y
CONFIG_AS_TPAUSE=y

#
# General architecture-dependent options
#
CONFIG_CRASH_CORE=y
CONFIG_KEXEC_CORE=y
CONFIG_HOTPLUG_SMT=y
CONFIG_HAVE_OPROFILE=y
CONFIG_OPROFILE_NMI_TIMER=y
CONFIG_KPROBES=y
# CONFIG_JUMP_LABEL is not set
CONFIG_OPTPROBES=y
CONFIG_KPROBES_ON_FTRACE=y
CONFIG_HAVE_EFFICIENT_UNALIGNED_ACCESS=y
CONFIG_ARCH_USE_BUILTIN_BSWAP=y
CONFIG_KRETPROBES=y
CONFIG_HAVE_IOREMAP_PROT=y
CONFIG_HAVE_KPROBES=y
CONFIG_HAVE_KRETPROBES=y
CONFIG_HAVE_OPTPROBES=y
CONFIG_HAVE_KPROBES_ON_FTRACE=y
CONFIG_HAVE_FUNCTION_ERROR_INJECTION=y
CONFIG_HAVE_NMI=y
CONFIG_HAVE_ARCH_TRACEHOOK=y
CONFIG_HAVE_DMA_CONTIGUOUS=y
CONFIG_GENERIC_SMP_IDLE_THREAD=y
CONFIG_ARCH_HAS_FORTIFY_SOURCE=y
CONFIG_ARCH_HAS_SET_MEMORY=y
CONFIG_ARCH_HAS_SET_DIRECT_MAP=y
CONFIG_HAVE_ARCH_THREAD_STRUCT_WHITELIST=y
CONFIG_ARCH_WANTS_DYNAMIC_TASK_STRUCT=y
CONFIG_ARCH_32BIT_OFF_T=y
CONFIG_HAVE_ASM_MODVERSIONS=y
CONFIG_HAVE_REGS_AND_STACK_ACCESS_API=y
CONFIG_HAVE_RSEQ=y
CONFIG_HAVE_FUNCTION_ARG_ACCESS_API=y
CONFIG_HAVE_HW_BREAKPOINT=y
CONFIG_HAVE_MIXED_BREAKPOINTS_REGS=y
CONFIG_HAVE_USER_RETURN_NOTIFIER=y
CONFIG_HAVE_PERF_EVENTS_NMI=y
CONFIG_HAVE_HARDLOCKUP_DETECTOR_PERF=y
CONFIG_HAVE_PERF_REGS=y
CONFIG_HAVE_PERF_USER_STACK_DUMP=y
CONFIG_HAVE_ARCH_JUMP_LABEL=y
CONFIG_HAVE_ARCH_JUMP_LABEL_RELATIVE=y
CONFIG_ARCH_HAVE_NMI_SAFE_CMPXCHG=y
CONFIG_HAVE_CMPXCHG_LOCAL=y
CONFIG_HAVE_CMPXCHG_DOUBLE=y
CONFIG_ARCH_WANT_IPC_PARSE_VERSION=y
CONFIG_HAVE_ARCH_SECCOMP_FILTER=y
CONFIG_SECCOMP_FILTER=y
CONFIG_HAVE_ARCH_STACKLEAK=y
CONFIG_HAVE_STACKPROTECTOR=y
# CONFIG_STACKPROTECTOR is not set
CONFIG_HAVE_ARCH_WITHIN_STACK_FRAMES=y
CONFIG_HAVE_IRQ_TIME_ACCOUNTING=y
CONFIG_HAVE_MOVE_PMD=y
CONFIG_HAVE_ARCH_TRANSPARENT_HUGEPAGE=y
CONFIG_HAVE_ARCH_HUGE_VMAP=y
CONFIG_ARCH_WANT_HUGE_PMD_SHARE=y
CONFIG_HAVE_MOD_ARCH_SPECIFIC=y
CONFIG_MODULES_USE_ELF_REL=y
CONFIG_ARCH_HAS_ELF_RANDOMIZE=y
CONFIG_HAVE_ARCH_MMAP_RND_BITS=y
CONFIG_HAVE_EXIT_THREAD=y
CONFIG_ARCH_MMAP_RND_BITS=8
CONFIG_ISA_BUS_API=y
CONFIG_CLONE_BACKWARDS=y
CONFIG_OLD_SIGSUSPEND3=y
CONFIG_OLD_SIGACTION=y
# CONFIG_COMPAT_32BIT_TIME is not set
CONFIG_ARCH_HAS_STRICT_KERNEL_RWX=y
CONFIG_STRICT_KERNEL_RWX=y
CONFIG_ARCH_HAS_STRICT_MODULE_RWX=y
CONFIG_STRICT_MODULE_RWX=y
CONFIG_HAVE_ARCH_PREL32_RELOCATIONS=y
CONFIG_ARCH_USE_MEMREMAP_PROT=y
CONFIG_LOCK_EVENT_COUNTS=y
CONFIG_ARCH_HAS_MEM_ENCRYPT=y

#
# GCOV-based kernel profiling
#
CONFIG_GCOV_KERNEL=y
CONFIG_ARCH_HAS_GCOV_PROFILE_ALL=y
# end of GCOV-based kernel profiling

CONFIG_HAVE_GCC_PLUGINS=y
# end of General architecture-dependent options

CONFIG_RT_MUTEXES=y
CONFIG_BASE_SMALL=0
CONFIG_MODULE_SIG_FORMAT=y
CONFIG_MODULES=y
CONFIG_MODULE_FORCE_LOAD=y
# CONFIG_MODULE_UNLOAD is not set
# CONFIG_MODVERSIONS is not set
CONFIG_MODULE_SRCVERSION_ALL=y
CONFIG_MODULE_SIG=y
# CONFIG_MODULE_SIG_FORCE is not set
CONFIG_MODULE_SIG_ALL=y
# CONFIG_MODULE_SIG_SHA1 is not set
# CONFIG_MODULE_SIG_SHA224 is not set
# CONFIG_MODULE_SIG_SHA256 is not set
CONFIG_MODULE_SIG_SHA384=y
# CONFIG_MODULE_SIG_SHA512 is not set
CONFIG_MODULE_SIG_HASH="sha384"
# CONFIG_MODULE_COMPRESS is not set
CONFIG_MODULE_ALLOW_MISSING_NAMESPACE_IMPORTS=y
# CONFIG_UNUSED_SYMBOLS is not set
# CONFIG_TRIM_UNUSED_KSYMS is not set
CONFIG_MODULES_TREE_LOOKUP=y
# CONFIG_BLOCK is not set
CONFIG_PADATA=y
CONFIG_ASN1=y
CONFIG_UNINLINE_SPIN_UNLOCK=y
CONFIG_ARCH_SUPPORTS_ATOMIC_RMW=y
CONFIG_MUTEX_SPIN_ON_OWNER=y
CONFIG_RWSEM_SPIN_ON_OWNER=y
CONFIG_LOCK_SPIN_ON_OWNER=y
CONFIG_ARCH_USE_QUEUED_SPINLOCKS=y
CONFIG_QUEUED_SPINLOCKS=y
CONFIG_ARCH_USE_QUEUED_RWLOCKS=y
CONFIG_QUEUED_RWLOCKS=y
CONFIG_ARCH_HAS_NON_OVERLAPPING_ADDRESS_SPACE=y
CONFIG_ARCH_HAS_SYNC_CORE_BEFORE_USERMODE=y
CONFIG_ARCH_HAS_SYSCALL_WRAPPER=y
CONFIG_FREEZER=y

#
# Executable file formats
#
CONFIG_BINFMT_ELF=y
CONFIG_ELFCORE=y
CONFIG_BINFMT_SCRIPT=m
CONFIG_BINFMT_MISC=y
# CONFIG_COREDUMP is not set
# end of Executable file formats

#
# Memory Management options
#
CONFIG_SELECT_MEMORY_MODEL=y
# CONFIG_FLATMEM_MANUAL is not set
CONFIG_SPARSEMEM_MANUAL=y
CONFIG_SPARSEMEM=y
CONFIG_SPARSEMEM_STATIC=y
CONFIG_HAVE_FAST_GUP=y
CONFIG_MEMORY_ISOLATION=y
CONFIG_SPLIT_PTLOCK_CPUS=4
# CONFIG_COMPACTION is not set
# CONFIG_PAGE_REPORTING is not set
CONFIG_MIGRATION=y
CONFIG_CONTIG_ALLOC=y
CONFIG_PHYS_ADDR_T_64BIT=y
CONFIG_VIRT_TO_BUS=y
# CONFIG_KSM is not set
CONFIG_DEFAULT_MMAP_MIN_ADDR=4096
# CONFIG_TRANSPARENT_HUGEPAGE is not set
# CONFIG_CLEANCACHE is not set
CONFIG_CMA=y
# CONFIG_CMA_DEBUG is not set
CONFIG_CMA_DEBUGFS=y
CONFIG_CMA_AREAS=7
# CONFIG_ZPOOL is not set
CONFIG_ZBUD=m
CONFIG_ZSMALLOC=m
CONFIG_ZSMALLOC_STAT=y
CONFIG_GENERIC_EARLY_IOREMAP=y
CONFIG_IDLE_PAGE_TRACKING=y
CONFIG_FRAME_VECTOR=y
CONFIG_PERCPU_STATS=y
# CONFIG_GUP_BENCHMARK is not set
CONFIG_GUP_GET_PTE_LOW_HIGH=y
CONFIG_ARCH_HAS_PTE_SPECIAL=y
# end of Memory Management options

CONFIG_NET=y
CONFIG_NET_INGRESS=y
CONFIG_NET_EGRESS=y
CONFIG_SKB_EXTENSIONS=y

#
# Networking options
#
# CONFIG_PACKET is not set
CONFIG_UNIX=y
CONFIG_UNIX_SCM=y
CONFIG_UNIX_DIAG=m
CONFIG_TLS=y
CONFIG_TLS_DEVICE=y
# CONFIG_TLS_TOE is not set
CONFIG_XFRM=y
CONFIG_XFRM_OFFLOAD=y
CONFIG_XFRM_ALGO=y
CONFIG_XFRM_USER=y
# CONFIG_XFRM_INTERFACE is not set
# CONFIG_XFRM_SUB_POLICY is not set
# CONFIG_XFRM_MIGRATE is not set
CONFIG_XFRM_STATISTICS=y
CONFIG_XFRM_AH=y
CONFIG_XFRM_ESP=y
CONFIG_XFRM_IPCOMP=m
# CONFIG_NET_KEY is not set
CONFIG_SMC=m
CONFIG_SMC_DIAG=m
CONFIG_XDP_SOCKETS=y
CONFIG_XDP_SOCKETS_DIAG=m
CONFIG_INET=y
# CONFIG_IP_MULTICAST is not set
CONFIG_IP_ADVANCED_ROUTER=y
# CONFIG_IP_FIB_TRIE_STATS is not set
CONFIG_IP_MULTIPLE_TABLES=y
CONFIG_IP_ROUTE_MULTIPATH=y
# CONFIG_IP_ROUTE_VERBOSE is not set
# CONFIG_IP_PNP is not set
CONFIG_NET_IPIP=m
# CONFIG_NET_IPGRE_DEMUX is not set
CONFIG_NET_IP_TUNNEL=y
# CONFIG_SYN_COOKIES is not set
CONFIG_NET_IPVTI=y
CONFIG_NET_UDP_TUNNEL=y
CONFIG_NET_FOU=m
# CONFIG_NET_FOU_IP_TUNNELS is not set
CONFIG_INET_AH=y
# CONFIG_INET_ESP is not set
CONFIG_INET_IPCOMP=m
CONFIG_INET_XFRM_TUNNEL=m
CONFIG_INET_TUNNEL=y
CONFIG_INET_DIAG=m
CONFIG_INET_TCP_DIAG=m
CONFIG_INET_UDP_DIAG=m
# CONFIG_INET_RAW_DIAG is not set
# CONFIG_INET_DIAG_DESTROY is not set
# CONFIG_TCP_CONG_ADVANCED is not set
CONFIG_TCP_CONG_CUBIC=y
CONFIG_DEFAULT_TCP_CONG="cubic"
# CONFIG_TCP_MD5SIG is not set
CONFIG_IPV6=y
# CONFIG_IPV6_ROUTER_PREF is not set
CONFIG_IPV6_OPTIMISTIC_DAD=y
# CONFIG_INET6_AH is not set
CONFIG_INET6_ESP=y
CONFIG_INET6_ESP_OFFLOAD=y
# CONFIG_INET6_ESPINTCP is not set
CONFIG_INET6_IPCOMP=m
# CONFIG_IPV6_MIP6 is not set
CONFIG_IPV6_ILA=y
CONFIG_INET6_XFRM_TUNNEL=m
CONFIG_INET6_TUNNEL=y
CONFIG_IPV6_VTI=y
CONFIG_IPV6_SIT=m
# CONFIG_IPV6_SIT_6RD is not set
CONFIG_IPV6_NDISC_NODETYPE=y
CONFIG_IPV6_TUNNEL=y
CONFIG_IPV6_FOU=m
CONFIG_IPV6_MULTIPLE_TABLES=y
# CONFIG_IPV6_SUBTREES is not set
# CONFIG_IPV6_MROUTE is not set
# CONFIG_IPV6_SEG6_LWTUNNEL is not set
CONFIG_IPV6_SEG6_HMAC=y
# CONFIG_IPV6_RPL_LWTUNNEL is not set
# CONFIG_NETLABEL is not set
CONFIG_MPTCP=y
CONFIG_INET_MPTCP_DIAG=m
CONFIG_MPTCP_IPV6=y
CONFIG_MPTCP_KUNIT_TESTS=m
# CONFIG_NETWORK_SECMARK is not set
CONFIG_NET_PTP_CLASSIFY=y
CONFIG_NETWORK_PHY_TIMESTAMPING=y
CONFIG_NETFILTER=y
# CONFIG_NETFILTER_ADVANCED is not set

#
# Core Netfilter Configuration
#
# CONFIG_NETFILTER_INGRESS is not set
CONFIG_NETFILTER_NETLINK=y
CONFIG_NETFILTER_NETLINK_LOG=y
# CONFIG_NF_CONNTRACK is not set
CONFIG_NF_LOG_COMMON=m
CONFIG_NF_LOG_NETDEV=m
CONFIG_NF_TABLES=m
# CONFIG_NF_TABLES_INET is not set
CONFIG_NF_TABLES_NETDEV=y
# CONFIG_NFT_NUMGEN is not set
CONFIG_NFT_COUNTER=m
# CONFIG_NFT_LOG is not set
# CONFIG_NFT_LIMIT is not set
CONFIG_NFT_TUNNEL=m
CONFIG_NFT_OBJREF=m
CONFIG_NFT_QUOTA=m
# CONFIG_NFT_REJECT is not set
CONFIG_NFT_COMPAT=m
CONFIG_NFT_HASH=m
# CONFIG_NFT_XFRM is not set
CONFIG_NFT_SOCKET=m
CONFIG_NFT_TPROXY=m
CONFIG_NF_DUP_NETDEV=m
CONFIG_NFT_DUP_NETDEV=m
CONFIG_NFT_FWD_NETDEV=m
CONFIG_NETFILTER_XTABLES=y

#
# Xtables combined modules
#
CONFIG_NETFILTER_XT_MARK=y

#
# Xtables targets
#
# CONFIG_NETFILTER_XT_TARGET_LOG is not set
CONFIG_NETFILTER_XT_TARGET_NFLOG=y
CONFIG_NETFILTER_XT_TARGET_TCPMSS=y

#
# Xtables matches
#
CONFIG_NETFILTER_XT_MATCH_ADDRTYPE=m
# CONFIG_NETFILTER_XT_MATCH_POLICY is not set
# end of Core Netfilter Configuration

CONFIG_IP_SET=y
CONFIG_IP_SET_MAX=256
CONFIG_IP_SET_BITMAP_IP=y
# CONFIG_IP_SET_BITMAP_IPMAC is not set
CONFIG_IP_SET_BITMAP_PORT=y
CONFIG_IP_SET_HASH_IP=y
CONFIG_IP_SET_HASH_IPMARK=y
CONFIG_IP_SET_HASH_IPPORT=m
# CONFIG_IP_SET_HASH_IPPORTIP is not set
CONFIG_IP_SET_HASH_IPPORTNET=m
# CONFIG_IP_SET_HASH_IPMAC is not set
CONFIG_IP_SET_HASH_MAC=m
CONFIG_IP_SET_HASH_NETPORTNET=y
CONFIG_IP_SET_HASH_NET=m
CONFIG_IP_SET_HASH_NETNET=y
CONFIG_IP_SET_HASH_NETPORT=m
# CONFIG_IP_SET_HASH_NETIFACE is not set
# CONFIG_IP_SET_LIST_SET is not set
CONFIG_IP_VS=m
# CONFIG_IP_VS_IPV6 is not set
# CONFIG_IP_VS_DEBUG is not set
CONFIG_IP_VS_TAB_BITS=12

#
# IPVS transport protocol load balancing support
#
CONFIG_IP_VS_PROTO_TCP=y
CONFIG_IP_VS_PROTO_UDP=y
CONFIG_IP_VS_PROTO_AH_ESP=y
CONFIG_IP_VS_PROTO_ESP=y
# CONFIG_IP_VS_PROTO_AH is not set
# CONFIG_IP_VS_PROTO_SCTP is not set

#
# IPVS scheduler
#
CONFIG_IP_VS_RR=m
CONFIG_IP_VS_WRR=m
CONFIG_IP_VS_LC=m
CONFIG_IP_VS_WLC=m
CONFIG_IP_VS_FO=m
CONFIG_IP_VS_OVF=m
CONFIG_IP_VS_LBLC=m
# CONFIG_IP_VS_LBLCR is not set
# CONFIG_IP_VS_DH is not set
CONFIG_IP_VS_SH=m
# CONFIG_IP_VS_MH is not set
# CONFIG_IP_VS_SED is not set
CONFIG_IP_VS_NQ=m

#
# IPVS SH scheduler
#
CONFIG_IP_VS_SH_TAB_BITS=8

#
# IPVS MH scheduler
#
CONFIG_IP_VS_MH_TAB_INDEX=12

#
# IPVS application helper
#

#
# IP: Netfilter Configuration
#
CONFIG_NF_DEFRAG_IPV4=m
CONFIG_NF_SOCKET_IPV4=m
CONFIG_NF_TPROXY_IPV4=m
CONFIG_NF_TABLES_IPV4=y
# CONFIG_NFT_DUP_IPV4 is not set
# CONFIG_NFT_FIB_IPV4 is not set
# CONFIG_NF_TABLES_ARP is not set
# CONFIG_NF_DUP_IPV4 is not set
# CONFIG_NF_LOG_ARP is not set
# CONFIG_NF_LOG_IPV4 is not set
CONFIG_NF_REJECT_IPV4=m
# CONFIG_IP_NF_IPTABLES is not set
# end of IP: Netfilter Configuration

#
# IPv6: Netfilter Configuration
#
# CONFIG_NF_SOCKET_IPV6 is not set
CONFIG_NF_TPROXY_IPV6=m
# CONFIG_NF_TABLES_IPV6 is not set
CONFIG_NF_DUP_IPV6=y
CONFIG_NF_REJECT_IPV6=m
# CONFIG_NF_LOG_IPV6 is not set
CONFIG_IP6_NF_IPTABLES=m
CONFIG_IP6_NF_MATCH_IPV6HEADER=m
# CONFIG_IP6_NF_FILTER is not set
# CONFIG_IP6_NF_MANGLE is not set
# CONFIG_IP6_NF_RAW is not set
# end of IPv6: Netfilter Configuration

CONFIG_BPFILTER=y
# CONFIG_IP_DCCP is not set
# CONFIG_IP_SCTP is not set
CONFIG_RDS=m
CONFIG_RDS_RDMA=m
# CONFIG_RDS_TCP is not set
CONFIG_RDS_DEBUG=y
CONFIG_TIPC=y
# CONFIG_TIPC_MEDIA_UDP is not set
CONFIG_TIPC_CRYPTO=y
CONFIG_TIPC_DIAG=y
# CONFIG_ATM is not set
CONFIG_L2TP=y
CONFIG_L2TP_DEBUGFS=y
CONFIG_L2TP_V3=y
CONFIG_L2TP_IP=m
CONFIG_L2TP_ETH=y
# CONFIG_BRIDGE is not set
# CONFIG_VLAN_8021Q is not set
# CONFIG_DECNET is not set
# CONFIG_LLC2 is not set
# CONFIG_ATALK is not set
CONFIG_X25=y
CONFIG_LAPB=y
# CONFIG_PHONET is not set
CONFIG_6LOWPAN=y
# CONFIG_6LOWPAN_DEBUGFS is not set
# CONFIG_6LOWPAN_NHC is not set
CONFIG_IEEE802154=m
CONFIG_IEEE802154_NL802154_EXPERIMENTAL=y
CONFIG_IEEE802154_SOCKET=m
# CONFIG_IEEE802154_6LOWPAN is not set
# CONFIG_MAC802154 is not set
CONFIG_NET_SCHED=y

#
# Queueing/Scheduling
#
CONFIG_NET_SCH_CBQ=y
CONFIG_NET_SCH_HTB=m
# CONFIG_NET_SCH_HFSC is not set
CONFIG_NET_SCH_PRIO=y
# CONFIG_NET_SCH_MULTIQ is not set
CONFIG_NET_SCH_RED=m
CONFIG_NET_SCH_SFB=y
CONFIG_NET_SCH_SFQ=y
# CONFIG_NET_SCH_TEQL is not set
CONFIG_NET_SCH_TBF=y
CONFIG_NET_SCH_CBS=y
CONFIG_NET_SCH_ETF=y
# CONFIG_NET_SCH_TAPRIO is not set
# CONFIG_NET_SCH_GRED is not set
CONFIG_NET_SCH_DSMARK=y
CONFIG_NET_SCH_NETEM=m
# CONFIG_NET_SCH_DRR is not set
CONFIG_NET_SCH_MQPRIO=m
CONFIG_NET_SCH_SKBPRIO=y
# CONFIG_NET_SCH_CHOKE is not set
# CONFIG_NET_SCH_QFQ is not set
CONFIG_NET_SCH_CODEL=m
# CONFIG_NET_SCH_FQ_CODEL is not set
CONFIG_NET_SCH_CAKE=m
CONFIG_NET_SCH_FQ=y
CONFIG_NET_SCH_HHF=m
CONFIG_NET_SCH_PIE=m
# CONFIG_NET_SCH_FQ_PIE is not set
CONFIG_NET_SCH_INGRESS=m
CONFIG_NET_SCH_PLUG=y
CONFIG_NET_SCH_ETS=m
# CONFIG_NET_SCH_DEFAULT is not set

#
# Classification
#
CONFIG_NET_CLS=y
CONFIG_NET_CLS_BASIC=m
CONFIG_NET_CLS_TCINDEX=m
# CONFIG_NET_CLS_ROUTE4 is not set
# CONFIG_NET_CLS_FW is not set
CONFIG_NET_CLS_U32=m
CONFIG_CLS_U32_PERF=y
CONFIG_CLS_U32_MARK=y
# CONFIG_NET_CLS_RSVP is not set
CONFIG_NET_CLS_RSVP6=m
CONFIG_NET_CLS_FLOW=y
CONFIG_NET_CLS_CGROUP=y
CONFIG_NET_CLS_BPF=m
# CONFIG_NET_CLS_FLOWER is not set
CONFIG_NET_CLS_MATCHALL=m
# CONFIG_NET_EMATCH is not set
CONFIG_NET_CLS_ACT=y
CONFIG_NET_ACT_POLICE=y
CONFIG_NET_ACT_GACT=y
CONFIG_GACT_PROB=y
CONFIG_NET_ACT_MIRRED=m
CONFIG_NET_ACT_SAMPLE=m
CONFIG_NET_ACT_NAT=y
# CONFIG_NET_ACT_PEDIT is not set
CONFIG_NET_ACT_SIMP=y
# CONFIG_NET_ACT_SKBEDIT is not set
# CONFIG_NET_ACT_CSUM is not set
CONFIG_NET_ACT_MPLS=m
CONFIG_NET_ACT_VLAN=m
CONFIG_NET_ACT_BPF=m
# CONFIG_NET_ACT_SKBMOD is not set
# CONFIG_NET_ACT_IFE is not set
# CONFIG_NET_ACT_TUNNEL_KEY is not set
CONFIG_NET_ACT_GATE=y
CONFIG_NET_TC_SKB_EXT=y
CONFIG_NET_SCH_FIFO=y
CONFIG_DCB=y
CONFIG_DNS_RESOLVER=y
CONFIG_BATMAN_ADV=m
# CONFIG_BATMAN_ADV_BATMAN_V is not set
CONFIG_BATMAN_ADV_BLA=y
# CONFIG_BATMAN_ADV_DAT is not set
CONFIG_BATMAN_ADV_NC=y
CONFIG_BATMAN_ADV_MCAST=y
# CONFIG_BATMAN_ADV_DEBUGFS is not set
CONFIG_BATMAN_ADV_DEBUG=y
CONFIG_BATMAN_ADV_SYSFS=y
# CONFIG_BATMAN_ADV_TRACING is not set
CONFIG_OPENVSWITCH=m
CONFIG_VSOCKETS=y
CONFIG_VSOCKETS_DIAG=y
# CONFIG_VSOCKETS_LOOPBACK is not set
# CONFIG_VIRTIO_VSOCKETS is not set
# CONFIG_NETLINK_DIAG is not set
CONFIG_MPLS=y
CONFIG_NET_MPLS_GSO=m
# CONFIG_MPLS_ROUTING is not set
CONFIG_NET_NSH=m
# CONFIG_HSR is not set
# CONFIG_NET_SWITCHDEV is not set
CONFIG_NET_L3_MASTER_DEV=y
CONFIG_QRTR=m
CONFIG_QRTR_SMD=m
CONFIG_QRTR_TUN=m
# CONFIG_QRTR_MHI is not set
# CONFIG_NET_NCSI is not set
CONFIG_RPS=y
CONFIG_RFS_ACCEL=y
CONFIG_XPS=y
# CONFIG_CGROUP_NET_PRIO is not set
CONFIG_CGROUP_NET_CLASSID=y
CONFIG_NET_RX_BUSY_POLL=y
CONFIG_BQL=y
# CONFIG_BPF_JIT is not set
# CONFIG_BPF_STREAM_PARSER is not set
CONFIG_NET_FLOW_LIMIT=y

#
# Network testing
#
CONFIG_NET_PKTGEN=y
# CONFIG_NET_DROP_MONITOR is not set
# end of Network testing
# end of Networking options

# CONFIG_HAMRADIO is not set
# CONFIG_CAN is not set
# CONFIG_BT is not set
CONFIG_AF_RXRPC=m
CONFIG_AF_RXRPC_IPV6=y
# CONFIG_AF_RXRPC_INJECT_LOSS is not set
CONFIG_AF_RXRPC_DEBUG=y
# CONFIG_RXKAD is not set
CONFIG_AF_KCM=y
CONFIG_STREAM_PARSER=y
CONFIG_FIB_RULES=y
# CONFIG_WIRELESS is not set
CONFIG_WIMAX=m
CONFIG_WIMAX_DEBUG_LEVEL=8
CONFIG_RFKILL=y
CONFIG_RFKILL_LEDS=y
# CONFIG_RFKILL_INPUT is not set
CONFIG_RFKILL_GPIO=y
# CONFIG_NET_9P is not set
CONFIG_CAIF=y
# CONFIG_CAIF_DEBUG is not set
CONFIG_CAIF_NETDEV=y
CONFIG_CAIF_USB=m
CONFIG_CEPH_LIB=y
# CONFIG_CEPH_LIB_PRETTYDEBUG is not set
CONFIG_CEPH_LIB_USE_DNS_RESOLVER=y
# CONFIG_NFC is not set
CONFIG_PSAMPLE=m
CONFIG_NET_IFE=y
CONFIG_LWTUNNEL=y
# CONFIG_LWTUNNEL_BPF is not set
CONFIG_DST_CACHE=y
CONFIG_GRO_CELLS=y
CONFIG_SOCK_VALIDATE_XMIT=y
CONFIG_NET_SOCK_MSG=y
CONFIG_FAILOVER=y
CONFIG_ETHTOOL_NETLINK=y
CONFIG_HAVE_EBPF_JIT=y

#
# Device Drivers
#
CONFIG_HAVE_EISA=y
# CONFIG_EISA is not set
CONFIG_HAVE_PCI=y
# CONFIG_PCI is not set
# CONFIG_PCCARD is not set

#
# Generic Driver Options
#
# CONFIG_UEVENT_HELPER is not set
# CONFIG_DEVTMPFS is not set
CONFIG_STANDALONE=y
CONFIG_PREVENT_FIRMWARE_BUILD=y

#
# Firmware loader
#
CONFIG_FW_LOADER=y
CONFIG_FW_LOADER_PAGED_BUF=y
CONFIG_EXTRA_FIRMWARE=""
CONFIG_FW_LOADER_USER_HELPER=y
# CONFIG_FW_LOADER_USER_HELPER_FALLBACK is not set
# CONFIG_FW_LOADER_COMPRESS is not set
# CONFIG_FW_CACHE is not set
# end of Firmware loader

CONFIG_WANT_DEV_COREDUMP=y
CONFIG_ALLOW_DEV_COREDUMP=y
CONFIG_DEV_COREDUMP=y
# CONFIG_DEBUG_DRIVER is not set
# CONFIG_DEBUG_DEVRES is not set
CONFIG_DEBUG_TEST_DRIVER_REMOVE=y
CONFIG_PM_QOS_KUNIT_TEST=y
CONFIG_TEST_ASYNC_DRIVER_PROBE=m
CONFIG_KUNIT_DRIVER_PE_TEST=y
CONFIG_GENERIC_CPU_AUTOPROBE=y
CONFIG_GENERIC_CPU_VULNERABILITIES=y
CONFIG_SOC_BUS=y
CONFIG_REGMAP=y
CONFIG_REGMAP_I2C=y
CONFIG_REGMAP_SPMI=m
CONFIG_REGMAP_MMIO=y
CONFIG_REGMAP_IRQ=y
CONFIG_DMA_SHARED_BUFFER=y
# CONFIG_DMA_FENCE_TRACE is not set
# end of Generic Driver Options

#
# Bus devices
#
CONFIG_ARM_INTEGRATOR_LM=y
# CONFIG_BT1_APB is not set
# CONFIG_BT1_AXI is not set
# CONFIG_HISILICON_LPC is not set
# CONFIG_QCOM_EBI2 is not set
# CONFIG_SIMPLE_PM_BUS is not set
CONFIG_FSL_MC_BUS=y
CONFIG_MHI_BUS=m
# end of Bus devices

# CONFIG_CONNECTOR is not set
CONFIG_GNSS=m
CONFIG_MTD=m
CONFIG_MTD_TESTS=m

#
# Partition parsers
#
CONFIG_MTD_AR7_PARTS=m
# CONFIG_MTD_BCM63XX_PARTS is not set
CONFIG_MTD_CMDLINE_PARTS=m
CONFIG_MTD_OF_PARTS=m
# CONFIG_MTD_PARSER_IMAGETAG is not set
CONFIG_MTD_PARSER_TRX=m
# CONFIG_MTD_SHARPSL_PARTS is not set
CONFIG_MTD_REDBOOT_PARTS=m
CONFIG_MTD_REDBOOT_DIRECTORY_BLOCK=-1
# CONFIG_MTD_REDBOOT_PARTS_UNALLOCATED is not set
# CONFIG_MTD_REDBOOT_PARTS_READONLY is not set
# end of Partition parsers

#
# User Modules And Translation Layers
#
# CONFIG_MTD_OOPS is not set
# CONFIG_MTD_PARTITIONED_MASTER is not set

#
# RAM/ROM/Flash chip drivers
#
CONFIG_MTD_CFI=m
CONFIG_MTD_JEDECPROBE=m
CONFIG_MTD_GEN_PROBE=m
# CONFIG_MTD_CFI_ADV_OPTIONS is not set
CONFIG_MTD_MAP_BANK_WIDTH_1=y
CONFIG_MTD_MAP_BANK_WIDTH_2=y
CONFIG_MTD_MAP_BANK_WIDTH_4=y
CONFIG_MTD_CFI_I1=y
CONFIG_MTD_CFI_I2=y
CONFIG_MTD_CFI_INTELEXT=m
CONFIG_MTD_CFI_AMDSTD=m
CONFIG_MTD_CFI_STAA=m
CONFIG_MTD_CFI_UTIL=m
CONFIG_MTD_RAM=m
CONFIG_MTD_ROM=m
CONFIG_MTD_ABSENT=m
# end of RAM/ROM/Flash chip drivers

#
# Mapping drivers for chip access
#
CONFIG_MTD_COMPLEX_MAPPINGS=y
# CONFIG_MTD_PHYSMAP is not set
CONFIG_MTD_SC520CDP=m
CONFIG_MTD_NETSC520=m
CONFIG_MTD_TS5500=m
# CONFIG_MTD_SBC_GXX is not set
# CONFIG_MTD_SCx200_DOCFLASH is not set
CONFIG_MTD_AMD76XROM=m
CONFIG_MTD_ICHXROM=m
CONFIG_MTD_NETtel=m
CONFIG_MTD_L440GX=m
CONFIG_MTD_PLATRAM=m
# end of Mapping drivers for chip access

#
# Self-contained MTD device drivers
#
CONFIG_MTD_SLRAM=m
CONFIG_MTD_PHRAM=m
CONFIG_MTD_MTDRAM=m
CONFIG_MTDRAM_TOTAL_SIZE=4096
CONFIG_MTDRAM_ERASE_SIZE=128

#
# Disk-On-Chip Device Drivers
#
# CONFIG_MTD_DOCG3 is not set
# end of Self-contained MTD device drivers

#
# NAND
#
CONFIG_MTD_NAND_CORE=m
CONFIG_MTD_ONENAND=m
CONFIG_MTD_ONENAND_VERIFY_WRITE=y
# CONFIG_MTD_ONENAND_GENERIC is not set
# CONFIG_MTD_ONENAND_SAMSUNG is not set
CONFIG_MTD_ONENAND_OTP=y
CONFIG_MTD_ONENAND_2X_PROGRAM=y
CONFIG_MTD_NAND_ECC_SW_HAMMING=m
# CONFIG_MTD_NAND_ECC_SW_HAMMING_SMC is not set
CONFIG_MTD_RAW_NAND=m
# CONFIG_MTD_NAND_ECC_SW_BCH is not set

#
# Raw/parallel NAND flash controllers
#
# CONFIG_MTD_NAND_DENALI_DT is not set
CONFIG_MTD_NAND_AMS_DELTA=m
# CONFIG_MTD_NAND_OMAP2 is not set
# CONFIG_MTD_NAND_TANGO is not set
CONFIG_MTD_NAND_SHARPSL=m
# CONFIG_MTD_NAND_CS553X is not set
CONFIG_MTD_NAND_ATMEL=m
# CONFIG_MTD_NAND_MARVELL is not set
# CONFIG_MTD_NAND_SLC_LPC32XX is not set
CONFIG_MTD_NAND_MLC_LPC32XX=m
CONFIG_MTD_NAND_BRCMNAND=m
CONFIG_MTD_NAND_OXNAS=m
# CONFIG_MTD_NAND_FSL_IFC is not set
CONFIG_MTD_NAND_VF610_NFC=m
# CONFIG_MTD_NAND_MXC is not set
CONFIG_MTD_NAND_SH_FLCTL=m
# CONFIG_MTD_NAND_DAVINCI is not set
CONFIG_MTD_NAND_TXX9NDFMC=m
# CONFIG_MTD_NAND_FSMC is not set
# CONFIG_MTD_NAND_SUNXI is not set
# CONFIG_MTD_NAND_HISI504 is not set
# CONFIG_MTD_NAND_QCOM is not set
CONFIG_MTD_NAND_MTK=m
CONFIG_MTD_NAND_MXIC=m
CONFIG_MTD_NAND_TEGRA=m
CONFIG_MTD_NAND_STM32_FMC2=m
CONFIG_MTD_NAND_MESON=m
# CONFIG_MTD_NAND_GPIO is not set
# CONFIG_MTD_NAND_PLATFORM is not set
# CONFIG_MTD_NAND_CADENCE is not set
CONFIG_MTD_NAND_ARASAN=m

#
# Misc
#
CONFIG_MTD_NAND_NANDSIM=m
# CONFIG_MTD_NAND_DISKONCHIP is not set
# end of NAND

#
# LPDDR & LPDDR2 PCM memory drivers
#
CONFIG_MTD_LPDDR=m
CONFIG_MTD_QINFO_PROBE=m
# end of LPDDR & LPDDR2 PCM memory drivers

CONFIG_MTD_UBI=m
CONFIG_MTD_UBI_WL_THRESHOLD=4096
CONFIG_MTD_UBI_BEB_LIMIT=20
# CONFIG_MTD_UBI_FASTMAP is not set
CONFIG_MTD_UBI_GLUEBI=m
# CONFIG_MTD_HYPERBUS is not set
CONFIG_DTC=y
CONFIG_OF=y
CONFIG_OF_UNITTEST=y
CONFIG_OF_ALL_DTBS=y
CONFIG_OF_FLATTREE=y
CONFIG_OF_EARLY_FLATTREE=y
CONFIG_OF_KOBJ=y
CONFIG_OF_DYNAMIC=y
CONFIG_OF_ADDRESS=y
CONFIG_OF_IRQ=y
CONFIG_OF_RESERVED_MEM=y
CONFIG_OF_RESOLVE=y
CONFIG_OF_OVERLAY=y
CONFIG_ARCH_MIGHT_HAVE_PC_PARPORT=y
CONFIG_PARPORT=m
# CONFIG_PARPORT_PC is not set
# CONFIG_PARPORT_AX88796 is not set
# CONFIG_PARPORT_1284 is not set
CONFIG_PARPORT_NOT_PC=y

#
# NVME Support
#
# end of NVME Support

#
# Misc devices
#
CONFIG_SENSORS_LIS3LV02D=y
CONFIG_AD525X_DPOT=y
# CONFIG_AD525X_DPOT_I2C is not set
# CONFIG_DUMMY_IRQ is not set
CONFIG_ICS932S401=m
# CONFIG_ATMEL_SSC is not set
CONFIG_ENCLOSURE_SERVICES=m
CONFIG_QCOM_COINCELL=y
CONFIG_QCOM_FASTRPC=m
CONFIG_APDS9802ALS=y
CONFIG_ISL29003=m
CONFIG_ISL29020=y
CONFIG_SENSORS_TSL2550=y
CONFIG_SENSORS_BH1770=y
CONFIG_SENSORS_APDS990X=y
CONFIG_HMC6352=m
CONFIG_DS1682=y
CONFIG_SRAM=y
CONFIG_XILINX_SDFEC=y
CONFIG_PVPANIC=m
CONFIG_C2PORT=m
# CONFIG_C2PORT_DURAMAR_2150 is not set

#
# EEPROM support
#
# CONFIG_EEPROM_AT24 is not set
# CONFIG_EEPROM_LEGACY is not set
CONFIG_EEPROM_MAX6875=y
CONFIG_EEPROM_93CX6=m
CONFIG_EEPROM_IDT_89HPESX=y
CONFIG_EEPROM_EE1004=m
# end of EEPROM support

#
# Texas Instruments shared transport line discipline
#
# CONFIG_TI_ST is not set
# end of Texas Instruments shared transport line discipline

CONFIG_SENSORS_LIS3_I2C=y
CONFIG_ALTERA_STAPL=y

#
# Intel MIC & related support
#
CONFIG_VOP_BUS=y
CONFIG_VOP=m
# end of Intel MIC & related support

CONFIG_ECHO=y
# CONFIG_MISC_RTSX_USB is not set
CONFIG_UACCE=m
# end of Misc devices

CONFIG_HAVE_IDE=y

#
# SCSI device support
#
CONFIG_SCSI_MOD=y
# end of SCSI device support

#
# IEEE 1394 (FireWire) support
#
# CONFIG_FIREWIRE is not set
# end of IEEE 1394 (FireWire) support

# CONFIG_MACINTOSH_DRIVERS is not set
# CONFIG_NETDEVICES is not set

#
# Input device support
#
CONFIG_INPUT=y
CONFIG_INPUT_LEDS=m
CONFIG_INPUT_FF_MEMLESS=m
# CONFIG_INPUT_POLLDEV is not set
CONFIG_INPUT_SPARSEKMAP=y
CONFIG_INPUT_MATRIXKMAP=m

#
# Userland interfaces
#
CONFIG_INPUT_MOUSEDEV=y
# CONFIG_INPUT_MOUSEDEV_PSAUX is not set
CONFIG_INPUT_MOUSEDEV_SCREEN_X=1024
CONFIG_INPUT_MOUSEDEV_SCREEN_Y=768
# CONFIG_INPUT_JOYDEV is not set
CONFIG_INPUT_EVDEV=y
CONFIG_INPUT_EVBUG=m

#
# Input Device Drivers
#
# CONFIG_INPUT_KEYBOARD is not set
# CONFIG_INPUT_MOUSE is not set
CONFIG_INPUT_JOYSTICK=y
CONFIG_JOYSTICK_ANALOG=y
# CONFIG_JOYSTICK_A3D is not set
# CONFIG_JOYSTICK_ADI is not set
# CONFIG_JOYSTICK_COBRA is not set
CONFIG_JOYSTICK_GF2K=m
# CONFIG_JOYSTICK_GRIP is not set
CONFIG_JOYSTICK_GRIP_MP=m
CONFIG_JOYSTICK_GUILLEMOT=m
CONFIG_JOYSTICK_INTERACT=y
CONFIG_JOYSTICK_SIDEWINDER=m
CONFIG_JOYSTICK_TMDC=m
CONFIG_JOYSTICK_IFORCE=m
CONFIG_JOYSTICK_IFORCE_USB=m
CONFIG_JOYSTICK_IFORCE_232=m
# CONFIG_JOYSTICK_WARRIOR is not set
# CONFIG_JOYSTICK_MAGELLAN is not set
# CONFIG_JOYSTICK_SPACEORB is not set
# CONFIG_JOYSTICK_SPACEBALL is not set
# CONFIG_JOYSTICK_STINGER is not set
CONFIG_JOYSTICK_TWIDJOY=y
# CONFIG_JOYSTICK_ZHENHUA is not set
CONFIG_JOYSTICK_DB9=m
# CONFIG_JOYSTICK_GAMECON is not set
CONFIG_JOYSTICK_TURBOGRAFX=m
CONFIG_JOYSTICK_AS5011=m
# CONFIG_JOYSTICK_JOYDUMP is not set
# CONFIG_JOYSTICK_XPAD is not set
CONFIG_JOYSTICK_WALKERA0701=m
# CONFIG_JOYSTICK_PXRC is not set
CONFIG_JOYSTICK_FSIA6B=m
CONFIG_INPUT_TABLET=y
CONFIG_TABLET_USB_ACECAD=m
CONFIG_TABLET_USB_AIPTEK=m
CONFIG_TABLET_USB_GTCO=m
# CONFIG_TABLET_USB_HANWANG is not set
# CONFIG_TABLET_USB_KBTAB is not set
# CONFIG_TABLET_USB_PEGASUS is not set
# CONFIG_TABLET_SERIAL_WACOM4 is not set
# CONFIG_INPUT_TOUCHSCREEN is not set
# CONFIG_INPUT_MISC is not set
CONFIG_RMI4_CORE=m
# CONFIG_RMI4_I2C is not set
CONFIG_RMI4_SMB=m
CONFIG_RMI4_F03=y
CONFIG_RMI4_F03_SERIO=m
CONFIG_RMI4_2D_SENSOR=y
CONFIG_RMI4_F11=y
CONFIG_RMI4_F12=y
CONFIG_RMI4_F30=y
# CONFIG_RMI4_F34 is not set
CONFIG_RMI4_F54=y
CONFIG_RMI4_F55=y

#
# Hardware I/O ports
#
CONFIG_SERIO=y
CONFIG_ARCH_MIGHT_HAVE_PC_SERIO=y
# CONFIG_SERIO_I8042 is not set
CONFIG_SERIO_SERPORT=m
CONFIG_SERIO_CT82C710=y
CONFIG_SERIO_PARKBD=m
# CONFIG_SERIO_LIBPS2 is not set
CONFIG_SERIO_RAW=m
# CONFIG_SERIO_ALTERA_PS2 is not set
CONFIG_SERIO_PS2MULT=y
CONFIG_SERIO_ARC_PS2=m
CONFIG_SERIO_APBPS2=m
# CONFIG_SERIO_OLPC_APSP is not set
CONFIG_SERIO_SUN4I_PS2=y
# CONFIG_SERIO_GPIO_PS2 is not set
# CONFIG_USERIO is not set
CONFIG_GAMEPORT=y
CONFIG_GAMEPORT_NS558=y
CONFIG_GAMEPORT_L4=y
# end of Hardware I/O ports
# end of Input device support

#
# Character devices
#
CONFIG_TTY=y
# CONFIG_VT is not set
# CONFIG_UNIX98_PTYS is not set
# CONFIG_LEGACY_PTYS is not set
CONFIG_LDISC_AUTOLOAD=y

#
# Serial drivers
#
CONFIG_SERIAL_EARLYCON=y
CONFIG_SERIAL_8250=m
CONFIG_SERIAL_8250_DEPRECATED_OPTIONS=y
CONFIG_SERIAL_8250_16550A_VARIANTS=y
CONFIG_SERIAL_8250_FINTEK=y
CONFIG_SERIAL_8250_DMA=y
CONFIG_SERIAL_8250_MEN_MCB=m
CONFIG_SERIAL_8250_NR_UARTS=4
CONFIG_SERIAL_8250_RUNTIME_UARTS=4
CONFIG_SERIAL_8250_EXTENDED=y
# CONFIG_SERIAL_8250_MANY_PORTS is not set
CONFIG_SERIAL_8250_ASPEED_VUART=m
# CONFIG_SERIAL_8250_SHARE_IRQ is not set
CONFIG_SERIAL_8250_DETECT_IRQ=y
# CONFIG_SERIAL_8250_RSA is not set
# CONFIG_SERIAL_8250_DW is not set
CONFIG_SERIAL_8250_RT288X=y
# CONFIG_SERIAL_8250_LPC18XX is not set
# CONFIG_SERIAL_8250_UNIPHIER is not set
CONFIG_SERIAL_8250_INGENIC=m
# CONFIG_SERIAL_8250_TEGRA is not set
CONFIG_SERIAL_OF_PLATFORM=m

#
# Non-8250 serial port support
#
CONFIG_SERIAL_ATMEL=y
CONFIG_SERIAL_ATMEL_CONSOLE=y
# CONFIG_SERIAL_ATMEL_PDC is not set
CONFIG_SERIAL_ATMEL_TTYAT=y
CONFIG_SERIAL_CLPS711X=y
# CONFIG_SERIAL_CLPS711X_CONSOLE is not set
# CONFIG_SERIAL_SAMSUNG is not set
# CONFIG_SERIAL_IMX is not set
CONFIG_SERIAL_UARTLITE=m
CONFIG_SERIAL_UARTLITE_NR_UARTS=1
CONFIG_SERIAL_SH_SCI=y
CONFIG_SERIAL_SH_SCI_NR_UARTS=2
# CONFIG_SERIAL_SH_SCI_CONSOLE is not set
# CONFIG_SERIAL_SH_SCI_EARLYCON is not set
# CONFIG_SERIAL_SH_SCI_DMA is not set
CONFIG_SERIAL_HS_LPC32XX=m
CONFIG_SERIAL_CORE=y
CONFIG_SERIAL_CORE_CONSOLE=y
CONFIG_SERIAL_QCOM_GENI=m
CONFIG_SERIAL_QCOM_GENI_CONSOLE=y
CONFIG_SERIAL_SIFIVE=y
# CONFIG_SERIAL_SIFIVE_CONSOLE is not set
CONFIG_SERIAL_LANTIQ=m
CONFIG_SERIAL_SCCNXP=m
CONFIG_SERIAL_SC16IS7XX=y
# CONFIG_SERIAL_SC16IS7XX_I2C is not set
CONFIG_SERIAL_TIMBERDALE=y
# CONFIG_SERIAL_BCM63XX is not set
CONFIG_SERIAL_ALTERA_JTAGUART=y
CONFIG_SERIAL_ALTERA_JTAGUART_CONSOLE=y
CONFIG_SERIAL_ALTERA_JTAGUART_CONSOLE_BYPASS=y
CONFIG_SERIAL_ALTERA_UART=m
CONFIG_SERIAL_ALTERA_UART_MAXPORTS=4
CONFIG_SERIAL_ALTERA_UART_BAUDRATE=115200
CONFIG_SERIAL_MXS_AUART=y
# CONFIG_SERIAL_MXS_AUART_CONSOLE is not set
CONFIG_SERIAL_XILINX_PS_UART=y
CONFIG_SERIAL_XILINX_PS_UART_CONSOLE=y
# CONFIG_SERIAL_MPS2_UART is not set
# CONFIG_SERIAL_ARC is not set
CONFIG_SERIAL_FSL_LPUART=m
CONFIG_SERIAL_FSL_LINFLEXUART=m
# CONFIG_SERIAL_CONEXANT_DIGICOLOR is not set
# CONFIG_SERIAL_ST_ASC is not set
CONFIG_SERIAL_MEN_Z135=m
CONFIG_SERIAL_SPRD=y
CONFIG_SERIAL_SPRD_CONSOLE=y
CONFIG_SERIAL_STM32=y
# CONFIG_SERIAL_STM32_CONSOLE is not set
# CONFIG_SERIAL_MVEBU_UART is not set
CONFIG_SERIAL_OWL=y
CONFIG_SERIAL_OWL_CONSOLE=y
CONFIG_SERIAL_RDA=y
CONFIG_SERIAL_RDA_CONSOLE=y
# CONFIG_SERIAL_MILBEAUT_USIO is not set
# end of Serial drivers

CONFIG_SERIAL_MCTRL_GPIO=y
CONFIG_SERIAL_NONSTANDARD=y
CONFIG_N_HDLC=y
# CONFIG_N_GSM is not set
CONFIG_NULL_TTY=y
# CONFIG_TRACE_ROUTER is not set
CONFIG_TRACE_SINK=m
# CONFIG_SERIAL_DEV_BUS is not set
CONFIG_TTY_PRINTK=m
CONFIG_TTY_PRINTK_LEVEL=6
CONFIG_PRINTER=m
CONFIG_LP_CONSOLE=y
CONFIG_PPDEV=m
# CONFIG_VIRTIO_CONSOLE is not set
CONFIG_IPMI_HANDLER=y
CONFIG_IPMI_DMI_DECODE=y
CONFIG_IPMI_PLAT_DATA=y
CONFIG_IPMI_PANIC_EVENT=y
# CONFIG_IPMI_PANIC_STRING is not set
# CONFIG_IPMI_DEVICE_INTERFACE is not set
CONFIG_IPMI_SI=y
CONFIG_IPMI_SSIF=m
CONFIG_IPMI_WATCHDOG=m
# CONFIG_IPMI_POWEROFF is not set
CONFIG_IPMI_KCS_BMC=y
CONFIG_ASPEED_KCS_IPMI_BMC=y
CONFIG_NPCM7XX_KCS_IPMI_BMC=y
# CONFIG_ASPEED_BT_IPMI_BMC is not set
CONFIG_IPMB_DEVICE_INTERFACE=y
CONFIG_HW_RANDOM=y
# CONFIG_HW_RANDOM_TIMERIOMEM is not set
CONFIG_HW_RANDOM_BA431=y
CONFIG_HW_RANDOM_VIA=m
CONFIG_HW_RANDOM_VIRTIO=y
# CONFIG_HW_RANDOM_IMX_RNGC is not set
# CONFIG_HW_RANDOM_STM32 is not set
# CONFIG_HW_RANDOM_MESON is not set
CONFIG_HW_RANDOM_MTK=m
# CONFIG_HW_RANDOM_EXYNOS is not set
CONFIG_HW_RANDOM_NPCM=y
CONFIG_HW_RANDOM_KEYSTONE=m
CONFIG_HW_RANDOM_CCTRNG=y
# CONFIG_MWAVE is not set
CONFIG_SCx200_GPIO=m
CONFIG_PC8736x_GPIO=y
CONFIG_NSC_GPIO=y
# CONFIG_DEVMEM is not set
CONFIG_DEVKMEM=y
CONFIG_NVRAM=y
CONFIG_HANGCHECK_TIMER=m
CONFIG_TCG_TPM=m
CONFIG_HW_RANDOM_TPM=y
CONFIG_TCG_TIS_CORE=m
CONFIG_TCG_TIS=m
CONFIG_TCG_TIS_I2C_ATMEL=m
CONFIG_TCG_TIS_I2C_INFINEON=m
CONFIG_TCG_TIS_I2C_NUVOTON=m
CONFIG_TCG_NSC=m
# CONFIG_TCG_ATMEL is not set
CONFIG_TCG_VTPM_PROXY=m
CONFIG_TCG_TIS_ST33ZP24=m
CONFIG_TCG_TIS_ST33ZP24_I2C=m
CONFIG_TELCLOCK=y
CONFIG_XILLYBUS=y
CONFIG_XILLYBUS_OF=m
# end of Character devices

CONFIG_RANDOM_TRUST_CPU=y
CONFIG_RANDOM_TRUST_BOOTLOADER=y

#
# I2C support
#
CONFIG_I2C=y
CONFIG_I2C_BOARDINFO=y
CONFIG_I2C_COMPAT=y
CONFIG_I2C_CHARDEV=m
CONFIG_I2C_MUX=y

#
# Multiplexer I2C Chip support
#
CONFIG_I2C_ARB_GPIO_CHALLENGE=y
CONFIG_I2C_MUX_GPIO=m
CONFIG_I2C_MUX_GPMUX=y
CONFIG_I2C_MUX_LTC4306=m
CONFIG_I2C_MUX_PCA9541=y
# CONFIG_I2C_MUX_PCA954x is not set
CONFIG_I2C_MUX_PINCTRL=y
# CONFIG_I2C_MUX_REG is not set
CONFIG_I2C_DEMUX_PINCTRL=y
# CONFIG_I2C_MUX_MLXCPLD is not set
# end of Multiplexer I2C Chip support

# CONFIG_I2C_HELPER_AUTO is not set
CONFIG_I2C_SMBUS=y

#
# I2C Algorithms
#
CONFIG_I2C_ALGOBIT=y
CONFIG_I2C_ALGOPCF=m
CONFIG_I2C_ALGOPCA=m
# end of I2C Algorithms

#
# I2C Hardware Bus support
#
# CONFIG_I2C_HIX5HD2 is not set

#
# I2C system bus drivers (mostly embedded / system-on-chip)
#
# CONFIG_I2C_ALTERA is not set
# CONFIG_I2C_ASPEED is not set
CONFIG_I2C_AT91=m
CONFIG_I2C_AT91_SLAVE_EXPERIMENTAL=m
# CONFIG_I2C_AXXIA is not set
CONFIG_I2C_BCM2835=y
CONFIG_I2C_BCM_IPROC=y
CONFIG_I2C_BCM_KONA=y
CONFIG_I2C_BRCMSTB=y
CONFIG_I2C_CBUS_GPIO=m
# CONFIG_I2C_DAVINCI is not set
# CONFIG_I2C_DESIGNWARE_PLATFORM is not set
CONFIG_I2C_DIGICOLOR=m
CONFIG_I2C_EFM32=m
CONFIG_I2C_EMEV2=m
# CONFIG_I2C_EXYNOS5 is not set
CONFIG_I2C_GPIO=m
# CONFIG_I2C_GPIO_FAULT_INJECTOR is not set
# CONFIG_I2C_HIGHLANDER is not set
# CONFIG_I2C_IMG is not set
# CONFIG_I2C_IMX_LPI2C is not set
# CONFIG_I2C_IOP3XX is not set
CONFIG_I2C_JZ4780=m
# CONFIG_I2C_LPC2K is not set
CONFIG_I2C_MESON=m
CONFIG_I2C_MT65XX=y
# CONFIG_I2C_MT7621 is not set
CONFIG_I2C_MV64XXX=m
CONFIG_I2C_MXS=y
CONFIG_I2C_NPCM7XX=m
CONFIG_I2C_OCORES=m
CONFIG_I2C_OMAP=m
# CONFIG_I2C_OWL is not set
CONFIG_I2C_PCA_PLATFORM=m
# CONFIG_I2C_PMCMSP is not set
CONFIG_I2C_PNX=m
CONFIG_I2C_PXA=m
CONFIG_I2C_QCOM_CCI=y
# CONFIG_I2C_QCOM_GENI is not set
# CONFIG_I2C_RIIC is not set
CONFIG_I2C_RK3X=m
# CONFIG_I2C_S3C2410 is not set
# CONFIG_I2C_SH_MOBILE is not set
# CONFIG_I2C_SIMTEC is not set
CONFIG_I2C_SIRF=y
CONFIG_I2C_SPRD=m
# CONFIG_I2C_ST is not set
CONFIG_I2C_STM32F4=m
CONFIG_I2C_STM32F7=y
CONFIG_I2C_STU300=m
CONFIG_I2C_SUN6I_P2WI=y
CONFIG_I2C_SYNQUACER=y
CONFIG_I2C_TEGRA_BPMP=y
CONFIG_I2C_UNIPHIER=y
CONFIG_I2C_UNIPHIER_F=y
CONFIG_I2C_VERSATILE=m
CONFIG_I2C_WMT=y
CONFIG_I2C_XILINX=m
CONFIG_I2C_XLR=m
# CONFIG_I2C_XLP9XX is not set
# CONFIG_I2C_RCAR is not set

#
# External I2C/SMBus adapter drivers
#
# CONFIG_I2C_DIOLAN_U2C is not set
# CONFIG_I2C_DLN2 is not set
CONFIG_I2C_PARPORT=m
# CONFIG_I2C_ROBOTFUZZ_OSIF is not set
# CONFIG_I2C_TAOS_EVM is not set
CONFIG_I2C_TINY_USB=m
CONFIG_I2C_VIPERBOARD=m

#
# Other I2C/SMBus bus drivers
#
CONFIG_I2C_MLXCPLD=m
CONFIG_I2C_CROS_EC_TUNNEL=m
# CONFIG_I2C_FSI is not set
# end of I2C Hardware Bus support

CONFIG_I2C_STUB=m
CONFIG_I2C_SLAVE=y
CONFIG_I2C_SLAVE_EEPROM=m
CONFIG_I2C_DEBUG_CORE=y
CONFIG_I2C_DEBUG_ALGO=y
# CONFIG_I2C_DEBUG_BUS is not set
# end of I2C support

# CONFIG_I3C is not set
# CONFIG_SPI is not set
CONFIG_SPMI=m
# CONFIG_SPMI_MSM_PMIC_ARB is not set
CONFIG_HSI=y
CONFIG_HSI_BOARDINFO=y

#
# HSI controllers
#

#
# HSI clients
#
# CONFIG_HSI_CHAR is not set
CONFIG_PPS=y
CONFIG_PPS_DEBUG=y
# CONFIG_NTP_PPS is not set

#
# PPS clients support
#
CONFIG_PPS_CLIENT_KTIMER=m
CONFIG_PPS_CLIENT_LDISC=y
CONFIG_PPS_CLIENT_PARPORT=m
CONFIG_PPS_CLIENT_GPIO=m

#
# PPS generators support
#

#
# PTP clock support
#
# CONFIG_PTP_1588_CLOCK is not set

#
# Enable PHYLIB and NETWORK_PHY_TIMESTAMPING to see the additional clocks.
#
CONFIG_PTP_1588_CLOCK_PCH=y
# end of PTP clock support

CONFIG_PINCTRL=y
CONFIG_GENERIC_PINCTRL_GROUPS=y
CONFIG_PINMUX=y
CONFIG_GENERIC_PINMUX_FUNCTIONS=y
CONFIG_PINCONF=y
CONFIG_GENERIC_PINCONF=y
# CONFIG_DEBUG_PINCTRL is not set
# CONFIG_PINCTRL_AT91PIO4 is not set
CONFIG_PINCTRL_AMD=m
CONFIG_PINCTRL_BM1880=y
# CONFIG_PINCTRL_DA850_PUPD is not set
CONFIG_PINCTRL_LPC18XX=y
CONFIG_PINCTRL_MCP23S08_I2C=y
CONFIG_PINCTRL_MCP23S08=y
CONFIG_PINCTRL_RZA1=y
CONFIG_PINCTRL_RZA2=y
# CONFIG_PINCTRL_RZN1 is not set
CONFIG_PINCTRL_SINGLE=y
CONFIG_PINCTRL_SX150X=y
CONFIG_PINCTRL_STMFX=y
CONFIG_PINCTRL_MAX77620=m
CONFIG_PINCTRL_INGENIC=y
CONFIG_PINCTRL_RK805=m
# CONFIG_PINCTRL_OCELOT is not set
CONFIG_PINCTRL_OWL=y
# CONFIG_PINCTRL_S700 is not set
# CONFIG_PINCTRL_S900 is not set
# CONFIG_PINCTRL_ASPEED_G4 is not set
# CONFIG_PINCTRL_ASPEED_G5 is not set
# CONFIG_PINCTRL_ASPEED_G6 is not set
# CONFIG_PINCTRL_BCM281XX is not set
CONFIG_PINCTRL_BCM2835=y
CONFIG_PINCTRL_IPROC_GPIO=y
# CONFIG_PINCTRL_CYGNUS_MUX is not set
# CONFIG_PINCTRL_NS is not set
# CONFIG_PINCTRL_NSP_GPIO is not set
# CONFIG_PINCTRL_NS2_MUX is not set
# CONFIG_PINCTRL_NSP_MUX is not set
CONFIG_PINCTRL_BERLIN=y
CONFIG_PINCTRL_AS370=y
CONFIG_PINCTRL_BERLIN_BG4CT=y
# CONFIG_PINCTRL_NPCM7XX is not set
CONFIG_PINCTRL_PXA=y
CONFIG_PINCTRL_PXA25X=y
CONFIG_PINCTRL_PXA27X=y
CONFIG_PINCTRL_MSM=y
# CONFIG_PINCTRL_APQ8064 is not set
CONFIG_PINCTRL_APQ8084=m
# CONFIG_PINCTRL_IPQ4019 is not set
CONFIG_PINCTRL_IPQ8064=m
CONFIG_PINCTRL_IPQ8074=y
# CONFIG_PINCTRL_IPQ6018 is not set
CONFIG_PINCTRL_MSM8660=m
CONFIG_PINCTRL_MSM8960=y
CONFIG_PINCTRL_MDM9615=y
# CONFIG_PINCTRL_MSM8X74 is not set
CONFIG_PINCTRL_MSM8916=m
# CONFIG_PINCTRL_MSM8976 is not set
CONFIG_PINCTRL_MSM8994=y
CONFIG_PINCTRL_MSM8996=y
CONFIG_PINCTRL_MSM8998=y
# CONFIG_PINCTRL_QCS404 is not set
CONFIG_PINCTRL_QCOM_SPMI_PMIC=m
# CONFIG_PINCTRL_QCOM_SSBI_PMIC is not set
CONFIG_PINCTRL_SC7180=m
CONFIG_PINCTRL_SDM660=y
CONFIG_PINCTRL_SDM845=m
CONFIG_PINCTRL_SM8150=m
CONFIG_PINCTRL_SM8250=y
CONFIG_PINCTRL_SAMSUNG=y
# CONFIG_PINCTRL_EXYNOS is not set
# CONFIG_PINCTRL_S3C24XX is not set
CONFIG_PINCTRL_S3C64XX=y
# CONFIG_PINCTRL_SH_PFC is not set
CONFIG_PINCTRL_SH_PFC_GPIO=y
CONFIG_PINCTRL_SH_FUNC_GPIO=y
CONFIG_PINCTRL_PFC_EMEV2=y
# CONFIG_PINCTRL_PFC_R8A73A4 is not set
CONFIG_PINCTRL_PFC_R8A7740=y
CONFIG_PINCTRL_PFC_R8A7742=y
CONFIG_PINCTRL_PFC_R8A7743=y
# CONFIG_PINCTRL_PFC_R8A7744 is not set
# CONFIG_PINCTRL_PFC_R8A7745 is not set
# CONFIG_PINCTRL_PFC_R8A77470 is not set
CONFIG_PINCTRL_PFC_R8A774A1=y
# CONFIG_PINCTRL_PFC_R8A774B1 is not set
# CONFIG_PINCTRL_PFC_R8A774C0 is not set
CONFIG_PINCTRL_PFC_R8A774E1=y
CONFIG_PINCTRL_PFC_R8A7778=y
# CONFIG_PINCTRL_PFC_R8A7779 is not set
CONFIG_PINCTRL_PFC_R8A7790=y
# CONFIG_PINCTRL_PFC_R8A7791 is not set
CONFIG_PINCTRL_PFC_R8A7792=y
# CONFIG_PINCTRL_PFC_R8A7793 is not set
# CONFIG_PINCTRL_PFC_R8A7794 is not set
# CONFIG_PINCTRL_PFC_R8A77950 is not set
# CONFIG_PINCTRL_PFC_R8A77951 is not set
# CONFIG_PINCTRL_PFC_R8A77960 is not set
# CONFIG_PINCTRL_PFC_R8A77961 is not set
CONFIG_PINCTRL_PFC_R8A77965=y
# CONFIG_PINCTRL_PFC_R8A77970 is not set
CONFIG_PINCTRL_PFC_R8A77980=y
# CONFIG_PINCTRL_PFC_R8A77990 is not set
CONFIG_PINCTRL_PFC_R8A77995=y
CONFIG_PINCTRL_PFC_SH7203=y
# CONFIG_PINCTRL_PFC_SH7264 is not set
# CONFIG_PINCTRL_PFC_SH7269 is not set
# CONFIG_PINCTRL_PFC_SH73A0 is not set
# CONFIG_PINCTRL_PFC_SH7720 is not set
CONFIG_PINCTRL_PFC_SH7722=y
# CONFIG_PINCTRL_PFC_SH7723 is not set
CONFIG_PINCTRL_PFC_SH7724=y
CONFIG_PINCTRL_PFC_SH7734=y
# CONFIG_PINCTRL_PFC_SH7757 is not set
# CONFIG_PINCTRL_PFC_SH7785 is not set
CONFIG_PINCTRL_PFC_SH7786=y
# CONFIG_PINCTRL_PFC_SHX3 is not set
CONFIG_PINCTRL_SPRD=y
CONFIG_PINCTRL_SPRD_SC9860=y
CONFIG_PINCTRL_STM32=y
# CONFIG_PINCTRL_STM32F429 is not set
CONFIG_PINCTRL_STM32F469=y
CONFIG_PINCTRL_STM32F746=y
CONFIG_PINCTRL_STM32F769=y
# CONFIG_PINCTRL_STM32H743 is not set
CONFIG_PINCTRL_STM32MP157=y
CONFIG_PINCTRL_TI_IODELAY=y
# CONFIG_PINCTRL_UNIPHIER is not set

#
# MediaTek pinctrl drivers
#
CONFIG_EINT_MTK=y
CONFIG_PINCTRL_MTK=y
CONFIG_PINCTRL_MTK_V2=y
CONFIG_PINCTRL_MTK_MOORE=y
CONFIG_PINCTRL_MTK_PARIS=y
CONFIG_PINCTRL_MT2701=y
# CONFIG_PINCTRL_MT7623 is not set
CONFIG_PINCTRL_MT7629=y
CONFIG_PINCTRL_MT8135=y
CONFIG_PINCTRL_MT8127=y
# CONFIG_PINCTRL_MT2712 is not set
CONFIG_PINCTRL_MT6765=m
# CONFIG_PINCTRL_MT6797 is not set
# CONFIG_PINCTRL_MT7622 is not set
CONFIG_PINCTRL_MT8173=y
CONFIG_PINCTRL_MT8183=y
CONFIG_PINCTRL_MT8516=y
# CONFIG_PINCTRL_MT6397 is not set
# end of MediaTek pinctrl drivers

# CONFIG_PINCTRL_EQUILIBRIUM is not set
CONFIG_GPIOLIB=y
CONFIG_GPIOLIB_FASTPATH_LIMIT=512
CONFIG_OF_GPIO=y
CONFIG_GPIOLIB_IRQCHIP=y
# CONFIG_DEBUG_GPIO is not set
# CONFIG_GPIO_SYSFS is not set
CONFIG_GPIO_GENERIC=y
CONFIG_GPIO_MAX730X=m

#
# Memory mapped GPIO drivers
#
CONFIG_GPIO_74XX_MMIO=y
CONFIG_GPIO_ALTERA=y
CONFIG_GPIO_ASPEED=m
CONFIG_GPIO_ASPEED_SGPIO=y
CONFIG_GPIO_ATH79=m
CONFIG_GPIO_RASPBERRYPI_EXP=m
CONFIG_GPIO_BCM_KONA=y
CONFIG_GPIO_BCM_XGS_IPROC=m
CONFIG_GPIO_BRCMSTB=y
CONFIG_GPIO_CADENCE=y
# CONFIG_GPIO_CLPS711X is not set
CONFIG_GPIO_DWAPB=y
CONFIG_GPIO_EIC_SPRD=m
CONFIG_GPIO_EM=m
CONFIG_GPIO_FTGPIO010=y
# CONFIG_GPIO_GENERIC_PLATFORM is not set
CONFIG_GPIO_GRGPIO=m
# CONFIG_GPIO_HLWD is not set
# CONFIG_GPIO_IOP is not set
CONFIG_GPIO_LOGICVC=m
CONFIG_GPIO_LPC18XX=y
CONFIG_GPIO_LPC32XX=m
CONFIG_GPIO_MB86S7X=y
CONFIG_GPIO_MENZ127=m
CONFIG_GPIO_MPC8XXX=y
# CONFIG_GPIO_MT7621 is not set
CONFIG_GPIO_MXC=y
CONFIG_GPIO_MXS=y
# CONFIG_GPIO_PMIC_EIC_SPRD is not set
# CONFIG_GPIO_PXA is not set
CONFIG_GPIO_RCAR=y
CONFIG_GPIO_RDA=y
CONFIG_GPIO_SAMA5D2_PIOBU=m
CONFIG_GPIO_SIFIVE=y
CONFIG_GPIO_SIOX=m
CONFIG_GPIO_SNPS_CREG=y
# CONFIG_GPIO_SPRD is not set
CONFIG_GPIO_STP_XWAY=y
CONFIG_GPIO_SYSCON=y
# CONFIG_GPIO_TEGRA is not set
CONFIG_GPIO_TEGRA186=y
CONFIG_GPIO_TS4800=m
CONFIG_GPIO_UNIPHIER=y
CONFIG_GPIO_XGENE_SB=m
CONFIG_GPIO_XILINX=y
CONFIG_GPIO_XLP=y
# CONFIG_GPIO_ZX is not set
CONFIG_GPIO_AMD_FCH=m
# end of Memory mapped GPIO drivers

#
# Port-mapped I/O GPIO drivers
#
CONFIG_GPIO_104_DIO_48E=y
# CONFIG_GPIO_104_IDIO_16 is not set
CONFIG_GPIO_104_IDI_48=y
CONFIG_GPIO_F7188X=m
# CONFIG_GPIO_GPIO_MM is not set
CONFIG_GPIO_IT87=m
CONFIG_GPIO_SCH311X=y
# CONFIG_GPIO_TS5500 is not set
# CONFIG_GPIO_WINBOND is not set
CONFIG_GPIO_WS16C48=y
# end of Port-mapped I/O GPIO drivers

#
# I2C GPIO expanders
#
CONFIG_GPIO_ADP5588=m
# CONFIG_GPIO_ADNP is not set
# CONFIG_GPIO_GW_PLD is not set
CONFIG_GPIO_MAX7300=m
# CONFIG_GPIO_MAX732X is not set
CONFIG_GPIO_PCA953X=m
CONFIG_GPIO_PCA953X_IRQ=y
# CONFIG_GPIO_PCA9570 is not set
# CONFIG_GPIO_PCF857X is not set
CONFIG_GPIO_TPIC2810=y
CONFIG_GPIO_TS4900=m
# end of I2C GPIO expanders

#
# MFD GPIO expanders
#
# CONFIG_GPIO_ARIZONA is not set
CONFIG_GPIO_BD70528=y
# CONFIG_GPIO_DA9052 is not set
CONFIG_GPIO_DA9055=m
# CONFIG_GPIO_DLN2 is not set
CONFIG_GPIO_LP3943=m
# CONFIG_GPIO_LP87565 is not set
CONFIG_GPIO_MAX77620=m
# CONFIG_GPIO_MAX77650 is not set
CONFIG_GPIO_TPS65086=m
# CONFIG_GPIO_TPS65912 is not set
CONFIG_GPIO_TQMX86=m
CONFIG_GPIO_TWL4030=y
CONFIG_GPIO_TWL6040=m
CONFIG_GPIO_WM8350=y
CONFIG_GPIO_WM8994=m
# end of MFD GPIO expanders

#
# USB GPIO expanders
#
CONFIG_GPIO_VIPERBOARD=m
# end of USB GPIO expanders

# CONFIG_GPIO_AGGREGATOR is not set
# CONFIG_GPIO_MOCKUP is not set
# CONFIG_W1 is not set
# CONFIG_POWER_AVS is not set
# CONFIG_POWER_RESET is not set
CONFIG_POWER_SUPPLY=y
# CONFIG_POWER_SUPPLY_DEBUG is not set
# CONFIG_PDA_POWER is not set
CONFIG_WM8350_POWER=y
CONFIG_TEST_POWER=m
CONFIG_BATTERY_88PM860X=m
CONFIG_CHARGER_ADP5061=y
# CONFIG_BATTERY_ACT8945A is not set
# CONFIG_BATTERY_CW2015 is not set
# CONFIG_BATTERY_DS2780 is not set
# CONFIG_BATTERY_DS2781 is not set
CONFIG_BATTERY_DS2782=m
# CONFIG_BATTERY_SBS is not set
CONFIG_CHARGER_SBS=y
CONFIG_MANAGER_SBS=y
# CONFIG_BATTERY_BQ27XXX is not set
# CONFIG_BATTERY_DA9052 is not set
# CONFIG_BATTERY_DA9150 is not set
CONFIG_BATTERY_MAX17040=m
CONFIG_BATTERY_MAX17042=y
CONFIG_CHARGER_88PM860X=m
CONFIG_CHARGER_PCF50633=m
# CONFIG_CHARGER_ISP1704 is not set
CONFIG_CHARGER_MAX8903=y
CONFIG_CHARGER_LP8727=m
# CONFIG_CHARGER_GPIO is not set
CONFIG_CHARGER_MANAGER=m
CONFIG_CHARGER_LT3651=m
CONFIG_CHARGER_MAX14577=m
# CONFIG_CHARGER_DETECTOR_MAX14656 is not set
# CONFIG_CHARGER_MAX77650 is not set
CONFIG_CHARGER_MAX77693=m
CONFIG_CHARGER_QCOM_SMBB=y
# CONFIG_CHARGER_BQ2415X is not set
CONFIG_CHARGER_BQ24190=m
# CONFIG_CHARGER_BQ24257 is not set
CONFIG_CHARGER_BQ24735=y
CONFIG_CHARGER_BQ25890=m
# CONFIG_CHARGER_SMB347 is not set
CONFIG_CHARGER_TPS65090=m
CONFIG_CHARGER_TPS65217=m
# CONFIG_BATTERY_GAUGE_LTC2941 is not set
CONFIG_BATTERY_GOLDFISH=y
CONFIG_BATTERY_RT5033=m
CONFIG_CHARGER_RT9455=m
CONFIG_CHARGER_CROS_USBPD=m
# CONFIG_CHARGER_SC2731 is not set
# CONFIG_CHARGER_UCS1002 is not set
# CONFIG_CHARGER_BD70528 is not set
CONFIG_CHARGER_BD99954=m
CONFIG_HWMON=m
CONFIG_HWMON_VID=m
# CONFIG_HWMON_DEBUG_CHIP is not set

#
# Native drivers
#
CONFIG_SENSORS_ABITUGURU=m
CONFIG_SENSORS_ABITUGURU3=m
CONFIG_SENSORS_AD7414=m
CONFIG_SENSORS_AD7418=m
CONFIG_SENSORS_ADM1021=m
CONFIG_SENSORS_ADM1025=m
# CONFIG_SENSORS_ADM1026 is not set
CONFIG_SENSORS_ADM1029=m
CONFIG_SENSORS_ADM1031=m
CONFIG_SENSORS_ADM1177=m
# CONFIG_SENSORS_ADM9240 is not set
# CONFIG_SENSORS_ADT7410 is not set
# CONFIG_SENSORS_ADT7411 is not set
CONFIG_SENSORS_ADT7462=m
# CONFIG_SENSORS_ADT7470 is not set
# CONFIG_SENSORS_ADT7475 is not set
CONFIG_SENSORS_AS370=m
CONFIG_SENSORS_ASC7621=m
CONFIG_SENSORS_AXI_FAN_CONTROL=m
CONFIG_SENSORS_AMD_ENERGY=m
# CONFIG_SENSORS_APPLESMC is not set
# CONFIG_SENSORS_ASB100 is not set
# CONFIG_SENSORS_ASPEED is not set
CONFIG_SENSORS_ATXP1=m
CONFIG_SENSORS_BT1_PVT=m
# CONFIG_SENSORS_BT1_PVT_ALARMS is not set
CONFIG_SENSORS_CORSAIR_CPRO=m
# CONFIG_SENSORS_DS620 is not set
# CONFIG_SENSORS_DS1621 is not set
CONFIG_SENSORS_DELL_SMM=m
CONFIG_SENSORS_DA9052_ADC=m
CONFIG_SENSORS_DA9055=m
CONFIG_SENSORS_SPARX5=m
# CONFIG_SENSORS_F71805F is not set
# CONFIG_SENSORS_F71882FG is not set
CONFIG_SENSORS_F75375S=m
CONFIG_SENSORS_GSC=m
# CONFIG_SENSORS_FSCHMD is not set
CONFIG_SENSORS_FTSTEUTATES=m
# CONFIG_SENSORS_GL518SM is not set
CONFIG_SENSORS_GL520SM=m
CONFIG_SENSORS_G760A=m
CONFIG_SENSORS_G762=m
# CONFIG_SENSORS_GPIO_FAN is not set
# CONFIG_SENSORS_HIH6130 is not set
CONFIG_SENSORS_IBMAEM=m
# CONFIG_SENSORS_IBMPEX is not set
CONFIG_SENSORS_CORETEMP=m
# CONFIG_SENSORS_IT87 is not set
CONFIG_SENSORS_JC42=m
CONFIG_SENSORS_POWR1220=m
CONFIG_SENSORS_LINEAGE=m
# CONFIG_SENSORS_LTC2945 is not set
CONFIG_SENSORS_LTC2947=m
CONFIG_SENSORS_LTC2947_I2C=m
CONFIG_SENSORS_LTC2990=m
CONFIG_SENSORS_LTC4151=m
CONFIG_SENSORS_LTC4215=m
CONFIG_SENSORS_LTC4222=m
CONFIG_SENSORS_LTC4245=m
CONFIG_SENSORS_LTC4260=m
CONFIG_SENSORS_LTC4261=m
# CONFIG_SENSORS_MAX16065 is not set
# CONFIG_SENSORS_MAX1619 is not set
CONFIG_SENSORS_MAX1668=m
# CONFIG_SENSORS_MAX197 is not set
# CONFIG_SENSORS_MAX31730 is not set
CONFIG_SENSORS_MAX6621=m
CONFIG_SENSORS_MAX6639=m
CONFIG_SENSORS_MAX6642=m
CONFIG_SENSORS_MAX6650=m
# CONFIG_SENSORS_MAX6697 is not set
CONFIG_SENSORS_MAX31790=m
CONFIG_SENSORS_MCP3021=m
CONFIG_SENSORS_TC654=m
# CONFIG_SENSORS_LM63 is not set
CONFIG_SENSORS_LM73=m
CONFIG_SENSORS_LM75=m
CONFIG_SENSORS_LM77=m
# CONFIG_SENSORS_LM78 is not set
CONFIG_SENSORS_LM80=m
CONFIG_SENSORS_LM83=m
# CONFIG_SENSORS_LM85 is not set
CONFIG_SENSORS_LM87=m
CONFIG_SENSORS_LM90=m
CONFIG_SENSORS_LM92=m
CONFIG_SENSORS_LM93=m
CONFIG_SENSORS_LM95234=m
# CONFIG_SENSORS_LM95241 is not set
CONFIG_SENSORS_LM95245=m
CONFIG_SENSORS_PC87360=m
# CONFIG_SENSORS_PC87427 is not set
CONFIG_SENSORS_NTC_THERMISTOR=m
CONFIG_SENSORS_NCT6683=m
# CONFIG_SENSORS_NCT6775 is not set
# CONFIG_SENSORS_NCT7802 is not set
# CONFIG_SENSORS_NCT7904 is not set
CONFIG_SENSORS_NPCM7XX=m
CONFIG_SENSORS_NSA320=m
CONFIG_SENSORS_OCC_P8_I2C=m
CONFIG_SENSORS_OCC=m
# CONFIG_SENSORS_PCF8591 is not set
# CONFIG_PMBUS is not set
CONFIG_SENSORS_PWM_FAN=m
# CONFIG_SENSORS_RASPBERRYPI_HWMON is not set
CONFIG_SENSORS_SHT15=m
# CONFIG_SENSORS_SHT21 is not set
# CONFIG_SENSORS_SHT3x is not set
# CONFIG_SENSORS_SHTC1 is not set
# CONFIG_SENSORS_DME1737 is not set
CONFIG_SENSORS_EMC1403=m
CONFIG_SENSORS_EMC2103=m
CONFIG_SENSORS_EMC6W201=m
# CONFIG_SENSORS_SMSC47M1 is not set
# CONFIG_SENSORS_SMSC47M192 is not set
CONFIG_SENSORS_SMSC47B397=m
CONFIG_SENSORS_SCH56XX_COMMON=m
# CONFIG_SENSORS_SCH5627 is not set
CONFIG_SENSORS_SCH5636=m
# CONFIG_SENSORS_STTS751 is not set
CONFIG_SENSORS_SMM665=m
CONFIG_SENSORS_ADC128D818=m
CONFIG_SENSORS_ADS7828=m
CONFIG_SENSORS_AMC6821=m
CONFIG_SENSORS_INA209=m
CONFIG_SENSORS_INA2XX=m
CONFIG_SENSORS_INA3221=m
CONFIG_SENSORS_TC74=m
# CONFIG_SENSORS_THMC50 is not set
CONFIG_SENSORS_TMP102=m
CONFIG_SENSORS_TMP103=m
CONFIG_SENSORS_TMP108=m
# CONFIG_SENSORS_TMP401 is not set
CONFIG_SENSORS_TMP421=m
CONFIG_SENSORS_TMP513=m
CONFIG_SENSORS_VIA_CPUTEMP=m
# CONFIG_SENSORS_VT1211 is not set
# CONFIG_SENSORS_W83773G is not set
CONFIG_SENSORS_W83781D=m
CONFIG_SENSORS_W83791D=m
CONFIG_SENSORS_W83792D=m
CONFIG_SENSORS_W83793=m
CONFIG_SENSORS_W83795=m
# CONFIG_SENSORS_W83795_FANCTRL is not set
CONFIG_SENSORS_W83L785TS=m
CONFIG_SENSORS_W83L786NG=m
CONFIG_SENSORS_W83627HF=m
CONFIG_SENSORS_W83627EHF=m
# CONFIG_SENSORS_WM8350 is not set
CONFIG_THERMAL=y
CONFIG_THERMAL_NETLINK=y
# CONFIG_THERMAL_STATISTICS is not set
CONFIG_THERMAL_EMERGENCY_POWEROFF_DELAY_MS=0
CONFIG_THERMAL_OF=y
CONFIG_THERMAL_WRITABLE_TRIPS=y
CONFIG_THERMAL_DEFAULT_GOV_STEP_WISE=y
# CONFIG_THERMAL_DEFAULT_GOV_FAIR_SHARE is not set
# CONFIG_THERMAL_DEFAULT_GOV_USER_SPACE is not set
CONFIG_THERMAL_GOV_FAIR_SHARE=y
CONFIG_THERMAL_GOV_STEP_WISE=y
# CONFIG_THERMAL_GOV_BANG_BANG is not set
CONFIG_THERMAL_GOV_USER_SPACE=y
CONFIG_CPU_THERMAL=y
CONFIG_DEVFREQ_THERMAL=y
CONFIG_THERMAL_EMULATION=y
CONFIG_THERMAL_MMIO=m
# CONFIG_HISI_THERMAL is not set
# CONFIG_IMX_THERMAL is not set
CONFIG_IMX8MM_THERMAL=y
CONFIG_K3_THERMAL=m
CONFIG_MAX77620_THERMAL=y
CONFIG_QORIQ_THERMAL=m
CONFIG_SPEAR_THERMAL=y
# CONFIG_ROCKCHIP_THERMAL is not set
CONFIG_RCAR_THERMAL=y
CONFIG_RCAR_GEN3_THERMAL=y
CONFIG_KIRKWOOD_THERMAL=m
CONFIG_DOVE_THERMAL=m
# CONFIG_ARMADA_THERMAL is not set
# CONFIG_DA9062_THERMAL is not set
CONFIG_MTK_THERMAL=y

#
# Intel thermal drivers
#
# CONFIG_INTEL_POWERCLAMP is not set
CONFIG_X86_PKG_TEMP_THERMAL=y

#
# ACPI INT340X thermal drivers
#
# end of ACPI INT340X thermal drivers
# end of Intel thermal drivers

#
# Broadcom thermal drivers
#
# CONFIG_BCM2711_THERMAL is not set
CONFIG_BCM2835_THERMAL=m
# CONFIG_BRCMSTB_THERMAL is not set
CONFIG_BCM_NS_THERMAL=y
CONFIG_BCM_SR_THERMAL=m
# end of Broadcom thermal drivers

#
# Texas Instruments thermal drivers
#
# CONFIG_TI_SOC_THERMAL is not set
# end of Texas Instruments thermal drivers

#
# Samsung thermal drivers
#
CONFIG_EXYNOS_THERMAL=m
# end of Samsung thermal drivers

CONFIG_TANGO_THERMAL=m

#
# Qualcomm thermal drivers
#
# end of Qualcomm thermal drivers

CONFIG_ZX2967_THERMAL=y
CONFIG_UNIPHIER_THERMAL=m
CONFIG_SPRD_THERMAL=m
CONFIG_WATCHDOG=y
CONFIG_WATCHDOG_CORE=y
# CONFIG_WATCHDOG_NOWAYOUT is not set
CONFIG_WATCHDOG_HANDLE_BOOT_ENABLED=y
CONFIG_WATCHDOG_OPEN_TIMEOUT=0
# CONFIG_WATCHDOG_SYSFS is not set

#
# Watchdog Pretimeout Governors
#
CONFIG_WATCHDOG_PRETIMEOUT_GOV=y
CONFIG_WATCHDOG_PRETIMEOUT_GOV_SEL=m
# CONFIG_WATCHDOG_PRETIMEOUT_GOV_NOOP is not set
CONFIG_WATCHDOG_PRETIMEOUT_GOV_PANIC=m
CONFIG_WATCHDOG_PRETIMEOUT_DEFAULT_GOV_PANIC=y

#
# Watchdog Device Drivers
#
CONFIG_SOFT_WATCHDOG=y
CONFIG_SOFT_WATCHDOG_PRETIMEOUT=y
CONFIG_BD70528_WATCHDOG=y
CONFIG_DA9052_WATCHDOG=m
# CONFIG_DA9055_WATCHDOG is not set
CONFIG_DA9063_WATCHDOG=m
# CONFIG_DA9062_WATCHDOG is not set
# CONFIG_GPIO_WATCHDOG is not set
# CONFIG_MENF21BMC_WATCHDOG is not set
CONFIG_MENZ069_WATCHDOG=m
# CONFIG_TANGOX_WATCHDOG is not set
# CONFIG_WM8350_WATCHDOG is not set
# CONFIG_XILINX_WATCHDOG is not set
# CONFIG_ZIIRAVE_WATCHDOG is not set
CONFIG_ARMADA_37XX_WATCHDOG=m
CONFIG_ASM9260_WATCHDOG=y
# CONFIG_AT91RM9200_WATCHDOG is not set
CONFIG_AT91SAM9X_WATCHDOG=y
CONFIG_SAMA5D4_WATCHDOG=m
# CONFIG_CADENCE_WATCHDOG is not set
CONFIG_FTWDT010_WATCHDOG=m
CONFIG_S3C2410_WATCHDOG=y
CONFIG_DW_WATCHDOG=y
# CONFIG_EP93XX_WATCHDOG is not set
CONFIG_OMAP_WATCHDOG=m
# CONFIG_PNX4008_WATCHDOG is not set
CONFIG_DAVINCI_WATCHDOG=y
CONFIG_K3_RTI_WATCHDOG=y
CONFIG_RN5T618_WATCHDOG=y
CONFIG_SUNXI_WATCHDOG=y
CONFIG_NPCM7XX_WATCHDOG=m
CONFIG_TWL4030_WATCHDOG=m
CONFIG_STMP3XXX_RTC_WATCHDOG=y
# CONFIG_TS4800_WATCHDOG is not set
# CONFIG_TS72XX_WATCHDOG is not set
CONFIG_MAX63XX_WATCHDOG=m
# CONFIG_MAX77620_WATCHDOG is not set
# CONFIG_IMX2_WDT is not set
# CONFIG_IMX7ULP_WDT is not set
CONFIG_RETU_WATCHDOG=m
CONFIG_MOXART_WDT=m
CONFIG_SIRFSOC_WATCHDOG=y
CONFIG_ST_LPC_WATCHDOG=m
# CONFIG_TEGRA_WATCHDOG is not set
CONFIG_QCOM_WDT=m
# CONFIG_MESON_GXBB_WATCHDOG is not set
CONFIG_MESON_WATCHDOG=y
# CONFIG_MEDIATEK_WATCHDOG is not set
CONFIG_DIGICOLOR_WATCHDOG=m
CONFIG_LPC18XX_WATCHDOG=m
CONFIG_ATLAS7_WATCHDOG=m
# CONFIG_RENESAS_WDT is not set
# CONFIG_RENESAS_RZAWDT is not set
CONFIG_ASPEED_WATCHDOG=y
CONFIG_UNIPHIER_WATCHDOG=y
CONFIG_RTD119X_WATCHDOG=y
# CONFIG_SPRD_WATCHDOG is not set
CONFIG_PM8916_WATCHDOG=m
# CONFIG_ACQUIRE_WDT is not set
# CONFIG_ADVANTECH_WDT is not set
# CONFIG_EBC_C384_WDT is not set
CONFIG_F71808E_WDT=m
# CONFIG_SC520_WDT is not set
CONFIG_SBC_FITPC2_WATCHDOG=m
# CONFIG_EUROTECH_WDT is not set
CONFIG_IB700_WDT=y
CONFIG_IBMASR=m
CONFIG_WAFER_WDT=y
CONFIG_IT8712F_WDT=y
CONFIG_IT87_WDT=y
CONFIG_SC1200_WDT=m
CONFIG_PC87413_WDT=y
CONFIG_60XX_WDT=y
CONFIG_SBC8360_WDT=y
CONFIG_SBC7240_WDT=y
# CONFIG_CPU5_WDT is not set
# CONFIG_SMSC_SCH311X_WDT is not set
CONFIG_SMSC37B787_WDT=y
CONFIG_TQMX86_WDT=y
# CONFIG_W83627HF_WDT is not set
# CONFIG_W83877F_WDT is not set
CONFIG_W83977F_WDT=m
# CONFIG_MACHZ_WDT is not set
# CONFIG_SBC_EPX_C3_WATCHDOG is not set
CONFIG_BCM47XX_WDT=m
CONFIG_BCM2835_WDT=m
CONFIG_BCM_KONA_WDT=m
CONFIG_BCM_KONA_WDT_DEBUG=y
CONFIG_BCM7038_WDT=m
CONFIG_IMGPDC_WDT=y
CONFIG_MPC5200_WDT=y
# CONFIG_MV64X60_WDT is not set
CONFIG_MEN_A21_WDT=m
CONFIG_UML_WATCHDOG=m

#
# USB-based Watchdog Cards
#
# CONFIG_USBPCWATCHDOG is not set
CONFIG_SSB_POSSIBLE=y
CONFIG_SSB=y
# CONFIG_SSB_DRIVER_GPIO is not set
CONFIG_BCMA_POSSIBLE=y
# CONFIG_BCMA is not set

#
# Multifunction device drivers
#
CONFIG_MFD_CORE=y
CONFIG_MFD_ACT8945A=m
CONFIG_MFD_SUN4I_GPADC=m
CONFIG_MFD_AS3711=y
# CONFIG_MFD_AS3722 is not set
# CONFIG_PMIC_ADP5520 is not set
# CONFIG_MFD_AAT2870_CORE is not set
CONFIG_MFD_AT91_USART=y
CONFIG_MFD_ATMEL_FLEXCOM=m
CONFIG_MFD_ATMEL_HLCDC=m
CONFIG_MFD_ATMEL_SMC=y
CONFIG_MFD_BCM590XX=m
# CONFIG_MFD_BD9571MWV is not set
# CONFIG_MFD_AXP20X_I2C is not set
CONFIG_MFD_CROS_EC_DEV=y
# CONFIG_MFD_MADERA is not set
# CONFIG_PMIC_DA903X is not set
CONFIG_PMIC_DA9052=y
CONFIG_MFD_DA9052_I2C=y
CONFIG_MFD_DA9055=y
# CONFIG_MFD_DA9062 is not set
CONFIG_MFD_DA9063=y
CONFIG_MFD_DA9150=m
CONFIG_MFD_DLN2=m
CONFIG_MFD_EXYNOS_LPASS=m
CONFIG_MFD_GATEWORKS_GSC=m
# CONFIG_MFD_MC13XXX_I2C is not set
# CONFIG_MFD_MP2629 is not set
CONFIG_MFD_MXS_LRADC=m
CONFIG_MFD_MX25_TSADC=y
CONFIG_MFD_HI6421_PMIC=m
CONFIG_MFD_HI655X_PMIC=y
# CONFIG_HTC_PASIC3 is not set
CONFIG_HTC_I2CPLD=y
# CONFIG_MFD_IQS62X is not set
# CONFIG_MFD_KEMPLD is not set
# CONFIG_MFD_88PM800 is not set
# CONFIG_MFD_88PM805 is not set
CONFIG_MFD_88PM860X=y
CONFIG_MFD_MAX14577=y
CONFIG_MFD_MAX77620=y
CONFIG_MFD_MAX77650=y
# CONFIG_MFD_MAX77686 is not set
CONFIG_MFD_MAX77693=m
CONFIG_MFD_MAX77843=y
# CONFIG_MFD_MAX8907 is not set
# CONFIG_MFD_MAX8925 is not set
# CONFIG_MFD_MAX8997 is not set
# CONFIG_MFD_MAX8998 is not set
# CONFIG_MFD_MT6360 is not set
# CONFIG_MFD_MT6397 is not set
# CONFIG_MFD_MENF21BMC is not set
CONFIG_MFD_VIPERBOARD=m
CONFIG_MFD_RETU=m
CONFIG_MFD_PCF50633=m
# CONFIG_PCF50633_ADC is not set
CONFIG_PCF50633_GPIO=m
CONFIG_MFD_PM8XXX=y
CONFIG_MFD_SPMI_PMIC=m
CONFIG_MFD_RT5033=m
# CONFIG_MFD_RC5T583 is not set
CONFIG_MFD_RK808=m
CONFIG_MFD_RN5T618=m
CONFIG_MFD_SEC_CORE=m
CONFIG_MFD_SI476X_CORE=m
# CONFIG_MFD_SM501 is not set
CONFIG_MFD_SKY81452=y
# CONFIG_ABX500_CORE is not set
# CONFIG_MFD_STMPE is not set
# CONFIG_MFD_SUN6I_PRCM is not set
CONFIG_MFD_SYSCON=y
CONFIG_MFD_TI_AM335X_TSCADC=m
CONFIG_MFD_LP3943=m
# CONFIG_MFD_LP8788 is not set
CONFIG_MFD_TI_LMU=m
# CONFIG_MFD_OMAP_USB_HOST is not set
# CONFIG_MFD_PALMAS is not set
CONFIG_TPS6105X=y
CONFIG_TPS65010=y
# CONFIG_TPS6507X is not set
CONFIG_MFD_TPS65086=m
CONFIG_MFD_TPS65090=y
CONFIG_MFD_TPS65217=m
# CONFIG_MFD_TI_LP873X is not set
CONFIG_MFD_TI_LP87565=m
# CONFIG_MFD_TPS65218 is not set
# CONFIG_MFD_TPS6586X is not set
# CONFIG_MFD_TPS65910 is not set
CONFIG_MFD_TPS65912=y
CONFIG_MFD_TPS65912_I2C=y
# CONFIG_MFD_TPS80031 is not set
CONFIG_TWL4030_CORE=y
# CONFIG_MFD_TWL4030_AUDIO is not set
CONFIG_TWL6040_CORE=y
# CONFIG_MFD_WL1273_CORE is not set
CONFIG_MFD_LM3533=y
# CONFIG_MFD_TC3589X is not set
CONFIG_MFD_TQMX86=y
# CONFIG_MFD_LOCHNAGAR is not set
CONFIG_MFD_ARIZONA=y
CONFIG_MFD_ARIZONA_I2C=m
# CONFIG_MFD_CS47L24 is not set
CONFIG_MFD_WM5102=y
CONFIG_MFD_WM5110=y
CONFIG_MFD_WM8997=y
CONFIG_MFD_WM8998=y
CONFIG_MFD_WM8400=y
# CONFIG_MFD_WM831X_I2C is not set
CONFIG_MFD_WM8350=y
CONFIG_MFD_WM8350_I2C=y
CONFIG_MFD_WM8994=y
# CONFIG_MFD_STW481X is not set
CONFIG_MFD_ROHM_BD718XX=y
CONFIG_MFD_ROHM_BD70528=y
# CONFIG_MFD_ROHM_BD71828 is not set
# CONFIG_MFD_STM32_LPTIMER is not set
CONFIG_MFD_STM32_TIMERS=y
# CONFIG_MFD_STPMIC1 is not set
CONFIG_MFD_STMFX=y
# CONFIG_MFD_WCD934X is not set
# CONFIG_MFD_KHADAS_MCU is not set
# end of Multifunction device drivers

CONFIG_REGULATOR=y
# CONFIG_REGULATOR_DEBUG is not set
CONFIG_REGULATOR_FIXED_VOLTAGE=y
# CONFIG_REGULATOR_VIRTUAL_CONSUMER is not set
CONFIG_REGULATOR_USERSPACE_CONSUMER=y
CONFIG_REGULATOR_88PG86X=m
CONFIG_REGULATOR_88PM8607=m
CONFIG_REGULATOR_ACT8865=y
CONFIG_REGULATOR_ACT8945A=m
CONFIG_REGULATOR_AD5398=m
# CONFIG_REGULATOR_ANATOP is not set
# CONFIG_REGULATOR_AS3711 is not set
CONFIG_REGULATOR_BCM590XX=m
# CONFIG_REGULATOR_BD70528 is not set
# CONFIG_REGULATOR_BD718XX is not set
CONFIG_REGULATOR_CROS_EC=y
CONFIG_REGULATOR_DA9052=m
CONFIG_REGULATOR_DA9055=y
CONFIG_REGULATOR_DA9063=y
CONFIG_REGULATOR_DA9210=m
CONFIG_REGULATOR_DA9211=m
# CONFIG_REGULATOR_FAN53555 is not set
# CONFIG_REGULATOR_FAN53880 is not set
CONFIG_REGULATOR_GPIO=y
# CONFIG_REGULATOR_HI6421 is not set
# CONFIG_REGULATOR_HI6421V530 is not set
CONFIG_REGULATOR_HI655X=m
CONFIG_REGULATOR_ISL9305=y
CONFIG_REGULATOR_ISL6271A=y
CONFIG_REGULATOR_LM363X=m
CONFIG_REGULATOR_LP3971=m
CONFIG_REGULATOR_LP3972=y
# CONFIG_REGULATOR_LP872X is not set
# CONFIG_REGULATOR_LP8755 is not set
# CONFIG_REGULATOR_LP87565 is not set
# CONFIG_REGULATOR_LTC3589 is not set
CONFIG_REGULATOR_LTC3676=m
# CONFIG_REGULATOR_MAX14577 is not set
CONFIG_REGULATOR_MAX1586=m
CONFIG_REGULATOR_MAX77620=y
# CONFIG_REGULATOR_MAX77650 is not set
# CONFIG_REGULATOR_MAX8649 is not set
CONFIG_REGULATOR_MAX8660=y
# CONFIG_REGULATOR_MAX8952 is not set
# CONFIG_REGULATOR_MAX8973 is not set
CONFIG_REGULATOR_MAX77693=y
CONFIG_REGULATOR_MAX77826=y
# CONFIG_REGULATOR_MCP16502 is not set
CONFIG_REGULATOR_MP5416=y
CONFIG_REGULATOR_MP8859=m
CONFIG_REGULATOR_MP886X=y
# CONFIG_REGULATOR_MPQ7920 is not set
# CONFIG_REGULATOR_MT6311 is not set
# CONFIG_REGULATOR_MT6380 is not set
CONFIG_REGULATOR_PBIAS=y
CONFIG_REGULATOR_PCA9450=y
# CONFIG_REGULATOR_PCF50633 is not set
# CONFIG_REGULATOR_PFUZE100 is not set
CONFIG_REGULATOR_PV88060=m
CONFIG_REGULATOR_PV88080=y
CONFIG_REGULATOR_PV88090=m
CONFIG_REGULATOR_PWM=y
# CONFIG_REGULATOR_QCOM_RPMH is not set
CONFIG_REGULATOR_QCOM_SMD_RPM=y
# CONFIG_REGULATOR_QCOM_SPMI is not set
CONFIG_REGULATOR_QCOM_USB_VBUS=m
CONFIG_REGULATOR_RK808=m
# CONFIG_REGULATOR_RN5T618 is not set
CONFIG_REGULATOR_RT5033=m
CONFIG_REGULATOR_S2MPA01=m
# CONFIG_REGULATOR_S2MPS11 is not set
CONFIG_REGULATOR_S5M8767=m
CONFIG_REGULATOR_SC2731=y
CONFIG_REGULATOR_SKY81452=y
CONFIG_REGULATOR_SLG51000=m
CONFIG_REGULATOR_STM32_BOOSTER=y
CONFIG_REGULATOR_STM32_VREFBUF=m
# CONFIG_REGULATOR_STM32_PWR is not set
# CONFIG_REGULATOR_STW481X_VMMC is not set
CONFIG_REGULATOR_SY8106A=m
CONFIG_REGULATOR_SY8824X=y
CONFIG_REGULATOR_SY8827N=y
CONFIG_REGULATOR_TPS51632=m
CONFIG_REGULATOR_TPS6105X=m
# CONFIG_REGULATOR_TPS62360 is not set
CONFIG_REGULATOR_TPS65023=y
CONFIG_REGULATOR_TPS6507X=m
CONFIG_REGULATOR_TPS65086=m
# CONFIG_REGULATOR_TPS65090 is not set
CONFIG_REGULATOR_TPS65132=y
# CONFIG_REGULATOR_TPS65217 is not set
CONFIG_REGULATOR_TPS65912=y
CONFIG_REGULATOR_TWL4030=m
CONFIG_REGULATOR_UNIPHIER=m
CONFIG_REGULATOR_VCTRL=y
# CONFIG_REGULATOR_WM8350 is not set
CONFIG_REGULATOR_WM8400=m
CONFIG_REGULATOR_WM8994=m
CONFIG_REGULATOR_QCOM_LABIBB=y
# CONFIG_RC_CORE is not set
CONFIG_CEC_CORE=y
CONFIG_CEC_NOTIFIER=y
CONFIG_MEDIA_CEC_SUPPORT=y
CONFIG_CEC_CH7322=y
CONFIG_CEC_CROS_EC=y
# CONFIG_CEC_MESON_AO is not set
CONFIG_CEC_MESON_G12A_AO=y
# CONFIG_CEC_GPIO is not set
# CONFIG_CEC_SAMSUNG_S5P is not set
# CONFIG_CEC_STI is not set
# CONFIG_CEC_STM32 is not set
CONFIG_CEC_TEGRA=m
CONFIG_USB_PULSE8_CEC=m
CONFIG_USB_RAINSHADOW_CEC=m
CONFIG_MEDIA_SUPPORT=m
CONFIG_MEDIA_SUPPORT_FILTER=y
# CONFIG_MEDIA_SUBDRV_AUTOSELECT is not set

#
# Media device types
#
# CONFIG_MEDIA_CAMERA_SUPPORT is not set
# CONFIG_MEDIA_ANALOG_TV_SUPPORT is not set
CONFIG_MEDIA_DIGITAL_TV_SUPPORT=y
CONFIG_MEDIA_RADIO_SUPPORT=y
# CONFIG_MEDIA_SDR_SUPPORT is not set
CONFIG_MEDIA_PLATFORM_SUPPORT=y
CONFIG_MEDIA_TEST_SUPPORT=y
# end of Media device types

CONFIG_VIDEO_DEV=m
CONFIG_MEDIA_CONTROLLER=y
CONFIG_DVB_CORE=m

#
# Video4Linux options
#
CONFIG_VIDEO_V4L2=m
CONFIG_VIDEO_V4L2_I2C=y
CONFIG_VIDEO_V4L2_SUBDEV_API=y
CONFIG_VIDEO_ADV_DEBUG=y
CONFIG_VIDEO_FIXED_MINOR_RANGES=y
CONFIG_V4L2_JPEG_HELPER=m
CONFIG_V4L2_MEM2MEM_DEV=m
CONFIG_V4L2_FLASH_LED_CLASS=m
CONFIG_V4L2_FWNODE=m
CONFIG_VIDEOBUF_GEN=m
CONFIG_VIDEOBUF_DMA_CONTIG=m
# end of Video4Linux options

#
# Media controller options
#
# CONFIG_MEDIA_CONTROLLER_DVB is not set
# end of Media controller options

#
# Digital TV options
#
CONFIG_DVB_MMAP=y
CONFIG_DVB_NET=y
CONFIG_DVB_MAX_ADAPTERS=16
CONFIG_DVB_DYNAMIC_MINORS=y
CONFIG_DVB_DEMUX_SECTION_LOSS_LOG=y
# CONFIG_DVB_ULE_DEBUG is not set
# end of Digital TV options

#
# Media drivers
#

#
# Drivers filtered as selected at 'Filter media drivers'
#
# CONFIG_MEDIA_USB_SUPPORT is not set
# CONFIG_RADIO_ADAPTERS is not set
CONFIG_VIDEOBUF2_CORE=m
CONFIG_VIDEOBUF2_V4L2=m
CONFIG_VIDEOBUF2_MEMOPS=m
CONFIG_VIDEOBUF2_DMA_CONTIG=m
CONFIG_VIDEOBUF2_VMALLOC=m
CONFIG_VIDEOBUF2_DMA_SG=m
CONFIG_V4L_PLATFORM_DRIVERS=y
CONFIG_VIDEO_MMP_CAMERA=m
CONFIG_VIDEO_CADENCE=y
CONFIG_VIDEO_CADENCE_CSI2RX=m
CONFIG_VIDEO_CADENCE_CSI2TX=m
CONFIG_VIDEO_DAVINCI_VPIF_DISPLAY=m
# CONFIG_VIDEO_DAVINCI_VPIF_CAPTURE is not set
CONFIG_VIDEO_DM6446_CCDC=m
CONFIG_VIDEO_DM355_CCDC=m
CONFIG_VIDEO_DM365_ISIF=m
CONFIG_VIDEO_DAVINCI_VPBE_DISPLAY=m
CONFIG_VIDEO_OMAP2_VOUT_VRFB=y
CONFIG_VIDEO_OMAP2_VOUT=m
CONFIG_VIDEO_ASPEED=m
# CONFIG_VIDEO_SH_VOU is not set
CONFIG_VIDEO_VIU=m
# CONFIG_VIDEO_MUX is not set
CONFIG_VIDEO_OMAP3=m
# CONFIG_VIDEO_OMAP3_DEBUG is not set
# CONFIG_VIDEO_PXA27x is not set
CONFIG_VIDEO_QCOM_CAMSS=m
CONFIG_VIDEO_S3C_CAMIF=m
CONFIG_VIDEO_STM32_DCMI=m
CONFIG_VIDEO_RENESAS_CEU=m
# CONFIG_VIDEO_SAMSUNG_EXYNOS4_IS is not set
# CONFIG_VIDEO_AM437X_VPFE is not set
# CONFIG_VIDEO_XILINX is not set
CONFIG_VIDEO_RCAR_CSI2=m
CONFIG_VIDEO_RCAR_VIN=m
# CONFIG_VIDEO_ATMEL_ISC is not set
CONFIG_VIDEO_ATMEL_ISI=m
CONFIG_VIDEO_SUN4I_CSI=m
CONFIG_VIDEO_SUN6I_CSI=m
CONFIG_VIDEO_TI_CAL=m
CONFIG_V4L_MEM2MEM_DRIVERS=y
CONFIG_VIDEO_CODA=m
CONFIG_VIDEO_IMX_VDOA=m
# CONFIG_VIDEO_IMX_PXP is not set
CONFIG_VIDEO_MEDIATEK_JPEG=m
CONFIG_VIDEO_MEDIATEK_VPU=m
# CONFIG_VIDEO_MEDIATEK_MDP is not set
CONFIG_VIDEO_MEDIATEK_VCODEC=m
# CONFIG_VIDEO_MEM2MEM_DEINTERLACE is not set
CONFIG_VIDEO_SAMSUNG_S5P_G2D=m
CONFIG_VIDEO_SAMSUNG_S5P_JPEG=m
CONFIG_VIDEO_SAMSUNG_S5P_MFC=m
CONFIG_VIDEO_MX2_EMMAPRP=m
# CONFIG_VIDEO_SAMSUNG_EXYNOS_GSC is not set
CONFIG_VIDEO_STI_BDISP=m
# CONFIG_VIDEO_STI_HVA is not set
CONFIG_VIDEO_STI_DELTA=m
CONFIG_VIDEO_STI_DELTA_MJPEG=y
CONFIG_VIDEO_STI_DELTA_DRIVER=m
CONFIG_VIDEO_RENESAS_FDP1=m
CONFIG_VIDEO_RENESAS_JPU=m
CONFIG_VIDEO_RENESAS_FCP=m
# CONFIG_VIDEO_RENESAS_VSP1 is not set
CONFIG_VIDEO_ROCKCHIP_RGA=m
CONFIG_VIDEO_TI_VPE=m
CONFIG_VIDEO_TI_VPE_DEBUG=y
# CONFIG_VIDEO_QCOM_VENUS is not set
# CONFIG_VIDEO_SUN8I_DEINTERLACE is not set
# CONFIG_VIDEO_SUN8I_ROTATE is not set
CONFIG_VIDEO_TI_VPDMA=m
CONFIG_VIDEO_TI_SC=m
CONFIG_VIDEO_TI_CSC=m
# CONFIG_DVB_PLATFORM_DRIVERS is not set
# CONFIG_V4L_TEST_DRIVERS is not set
# end of Media drivers

#
# Media ancillary drivers
#
CONFIG_MEDIA_ATTACH=y

#
# Audio decoders, processors and mixers
#
CONFIG_VIDEO_TVAUDIO=m
# CONFIG_VIDEO_TDA7432 is not set
CONFIG_VIDEO_TDA9840=m
CONFIG_VIDEO_TEA6415C=m
# CONFIG_VIDEO_TEA6420 is not set
CONFIG_VIDEO_MSP3400=m
# CONFIG_VIDEO_CS3308 is not set
CONFIG_VIDEO_CS5345=m
CONFIG_VIDEO_CS53L32A=m
CONFIG_VIDEO_TLV320AIC23B=m
CONFIG_VIDEO_UDA1342=m
# CONFIG_VIDEO_WM8775 is not set
CONFIG_VIDEO_WM8739=m
CONFIG_VIDEO_VP27SMPX=m
CONFIG_VIDEO_SONY_BTF_MPX=m
# end of Audio decoders, processors and mixers

#
# RDS decoders
#
CONFIG_VIDEO_SAA6588=m
# end of RDS decoders

#
# Video decoders
#
# CONFIG_VIDEO_ADV7180 is not set
CONFIG_VIDEO_ADV7183=m
CONFIG_VIDEO_ADV748X=m
# CONFIG_VIDEO_ADV7604 is not set
# CONFIG_VIDEO_ADV7842 is not set
# CONFIG_VIDEO_BT819 is not set
CONFIG_VIDEO_BT856=m
# CONFIG_VIDEO_BT866 is not set
CONFIG_VIDEO_KS0127=m
# CONFIG_VIDEO_ML86V7667 is not set
# CONFIG_VIDEO_SAA7110 is not set
# CONFIG_VIDEO_SAA711X is not set
CONFIG_VIDEO_TC358743=m
CONFIG_VIDEO_TC358743_CEC=y
# CONFIG_VIDEO_TVP514X is not set
# CONFIG_VIDEO_TVP5150 is not set
# CONFIG_VIDEO_TVP7002 is not set
CONFIG_VIDEO_TW2804=m
# CONFIG_VIDEO_TW9903 is not set
CONFIG_VIDEO_TW9906=m
CONFIG_VIDEO_TW9910=m
# CONFIG_VIDEO_VPX3220 is not set
# CONFIG_VIDEO_MAX9286 is not set

#
# Video and audio decoders
#
CONFIG_VIDEO_SAA717X=m
# CONFIG_VIDEO_CX25840 is not set
# end of Video decoders

#
# Video encoders
#
CONFIG_VIDEO_SAA7127=m
CONFIG_VIDEO_SAA7185=m
# CONFIG_VIDEO_ADV7170 is not set
CONFIG_VIDEO_ADV7175=m
# CONFIG_VIDEO_ADV7343 is not set
# CONFIG_VIDEO_ADV7393 is not set
CONFIG_VIDEO_ADV7511=m
CONFIG_VIDEO_ADV7511_CEC=y
CONFIG_VIDEO_AD9389B=m
CONFIG_VIDEO_AK881X=m
CONFIG_VIDEO_THS8200=m
# end of Video encoders

#
# Video improvement chips
#
CONFIG_VIDEO_UPD64031A=m
CONFIG_VIDEO_UPD64083=m
# end of Video improvement chips

#
# Audio/Video compression chips
#
CONFIG_VIDEO_SAA6752HS=m
# end of Audio/Video compression chips

#
# SDR tuner chips
#
# end of SDR tuner chips

#
# Miscellaneous helper chips
#
CONFIG_VIDEO_THS7303=m
# CONFIG_VIDEO_M52790 is not set
# CONFIG_VIDEO_I2C is not set
CONFIG_VIDEO_ST_MIPID02=m
# end of Miscellaneous helper chips

CONFIG_VIDEO_OV7670=m

#
# SPI helper chips
#
# end of SPI helper chips

CONFIG_MEDIA_TUNER=m

#
# Customize TV tuners
#
CONFIG_MEDIA_TUNER_SIMPLE=m
# CONFIG_MEDIA_TUNER_TDA18250 is not set
CONFIG_MEDIA_TUNER_TDA8290=m
CONFIG_MEDIA_TUNER_TDA827X=m
CONFIG_MEDIA_TUNER_TDA18271=m
CONFIG_MEDIA_TUNER_TDA9887=m
CONFIG_MEDIA_TUNER_TEA5761=m
CONFIG_MEDIA_TUNER_TEA5767=m
# CONFIG_MEDIA_TUNER_MT20XX is not set
CONFIG_MEDIA_TUNER_MT2060=m
CONFIG_MEDIA_TUNER_MT2063=m
CONFIG_MEDIA_TUNER_MT2266=m
# CONFIG_MEDIA_TUNER_MT2131 is not set
CONFIG_MEDIA_TUNER_QT1010=m
# CONFIG_MEDIA_TUNER_XC2028 is not set
CONFIG_MEDIA_TUNER_XC5000=m
CONFIG_MEDIA_TUNER_XC4000=m
CONFIG_MEDIA_TUNER_MXL5005S=m
CONFIG_MEDIA_TUNER_MXL5007T=m
CONFIG_MEDIA_TUNER_MC44S803=m
CONFIG_MEDIA_TUNER_MAX2165=m
CONFIG_MEDIA_TUNER_TDA18218=m
# CONFIG_MEDIA_TUNER_FC0011 is not set
CONFIG_MEDIA_TUNER_FC0012=m
CONFIG_MEDIA_TUNER_FC0013=m
CONFIG_MEDIA_TUNER_TDA18212=m
# CONFIG_MEDIA_TUNER_E4000 is not set
CONFIG_MEDIA_TUNER_FC2580=m
CONFIG_MEDIA_TUNER_M88RS6000T=m
CONFIG_MEDIA_TUNER_TUA9001=m
CONFIG_MEDIA_TUNER_SI2157=m
# CONFIG_MEDIA_TUNER_IT913X is not set
CONFIG_MEDIA_TUNER_R820T=m
CONFIG_MEDIA_TUNER_MXL301RF=m
# CONFIG_MEDIA_TUNER_QM1D1C0042 is not set
CONFIG_MEDIA_TUNER_QM1D1B0004=m
# end of Customize TV tuners

#
# Customise DVB Frontends
#

#
# Multistandard (satellite) frontends
#
CONFIG_DVB_STB0899=m
CONFIG_DVB_STB6100=m
# CONFIG_DVB_STV090x is not set
CONFIG_DVB_STV0910=m
CONFIG_DVB_STV6110x=m
CONFIG_DVB_STV6111=m
CONFIG_DVB_MXL5XX=m
CONFIG_DVB_M88DS3103=m

#
# Multistandard (cable + terrestrial) frontends
#
CONFIG_DVB_DRXK=m
# CONFIG_DVB_TDA18271C2DD is not set
CONFIG_DVB_SI2165=m
CONFIG_DVB_MN88472=m
# CONFIG_DVB_MN88473 is not set

#
# DVB-S (satellite) frontends
#
# CONFIG_DVB_CX24110 is not set
CONFIG_DVB_CX24123=m
CONFIG_DVB_MT312=m
CONFIG_DVB_ZL10036=m
# CONFIG_DVB_ZL10039 is not set
CONFIG_DVB_S5H1420=m
# CONFIG_DVB_STV0288 is not set
# CONFIG_DVB_STB6000 is not set
CONFIG_DVB_STV0299=m
CONFIG_DVB_STV6110=m
CONFIG_DVB_STV0900=m
CONFIG_DVB_TDA8083=m
# CONFIG_DVB_TDA10086 is not set
# CONFIG_DVB_TDA8261 is not set
# CONFIG_DVB_VES1X93 is not set
CONFIG_DVB_TUNER_ITD1000=m
# CONFIG_DVB_TUNER_CX24113 is not set
CONFIG_DVB_TDA826X=m
# CONFIG_DVB_TUA6100 is not set
CONFIG_DVB_CX24116=m
CONFIG_DVB_CX24117=m
# CONFIG_DVB_CX24120 is not set
CONFIG_DVB_SI21XX=m
CONFIG_DVB_TS2020=m
CONFIG_DVB_DS3000=m
CONFIG_DVB_MB86A16=m
CONFIG_DVB_TDA10071=m

#
# DVB-T (terrestrial) frontends
#
CONFIG_DVB_SP8870=m
CONFIG_DVB_SP887X=m
CONFIG_DVB_CX22700=m
# CONFIG_DVB_CX22702 is not set
CONFIG_DVB_S5H1432=m
CONFIG_DVB_DRXD=m
# CONFIG_DVB_L64781 is not set
# CONFIG_DVB_TDA1004X is not set
CONFIG_DVB_NXT6000=m
# CONFIG_DVB_MT352 is not set
CONFIG_DVB_ZL10353=m
CONFIG_DVB_DIB3000MB=m
CONFIG_DVB_DIB3000MC=m
CONFIG_DVB_DIB7000M=m
CONFIG_DVB_DIB7000P=m
CONFIG_DVB_DIB9000=m
CONFIG_DVB_TDA10048=m
CONFIG_DVB_AF9013=m
# CONFIG_DVB_EC100 is not set
# CONFIG_DVB_STV0367 is not set
CONFIG_DVB_CXD2820R=m
# CONFIG_DVB_CXD2841ER is not set
# CONFIG_DVB_RTL2830 is not set
CONFIG_DVB_RTL2832=m
# CONFIG_DVB_SI2168 is not set
# CONFIG_DVB_ZD1301_DEMOD is not set

#
# DVB-C (cable) frontends
#
# CONFIG_DVB_VES1820 is not set
CONFIG_DVB_TDA10021=m
CONFIG_DVB_TDA10023=m
# CONFIG_DVB_STV0297 is not set

#
# ATSC (North American/Korean Terrestrial/Cable DTV) frontends
#
CONFIG_DVB_NXT200X=m
CONFIG_DVB_OR51211=m
CONFIG_DVB_OR51132=m
CONFIG_DVB_BCM3510=m
# CONFIG_DVB_LGDT330X is not set
CONFIG_DVB_LGDT3305=m
CONFIG_DVB_LGDT3306A=m
CONFIG_DVB_LG2160=m
# CONFIG_DVB_S5H1409 is not set
CONFIG_DVB_AU8522=m
CONFIG_DVB_AU8522_DTV=m
# CONFIG_DVB_AU8522_V4L is not set
# CONFIG_DVB_S5H1411 is not set

#
# ISDB-T (terrestrial) frontends
#
# CONFIG_DVB_S921 is not set
# CONFIG_DVB_DIB8000 is not set
CONFIG_DVB_MB86A20S=m

#
# ISDB-S (satellite) & ISDB-T (terrestrial) frontends
#
CONFIG_DVB_TC90522=m
CONFIG_DVB_MN88443X=m

#
# Digital terrestrial only tuners/PLL
#
CONFIG_DVB_PLL=m
CONFIG_DVB_TUNER_DIB0070=m
CONFIG_DVB_TUNER_DIB0090=m

#
# SEC control devices for DVB-S
#
CONFIG_DVB_DRX39XYJ=m
CONFIG_DVB_LNBH25=m
CONFIG_DVB_LNBH29=m
CONFIG_DVB_LNBP21=m
CONFIG_DVB_LNBP22=m
CONFIG_DVB_ISL6405=m
CONFIG_DVB_ISL6421=m
CONFIG_DVB_ISL6423=m
CONFIG_DVB_A8293=m
CONFIG_DVB_LGS8GL5=m
CONFIG_DVB_LGS8GXX=m
# CONFIG_DVB_ATBM8830 is not set
CONFIG_DVB_TDA665x=m
CONFIG_DVB_IX2505V=m
CONFIG_DVB_M88RS2000=m
CONFIG_DVB_AF9033=m
# CONFIG_DVB_HORUS3A is not set
CONFIG_DVB_ASCOT2E=m
CONFIG_DVB_HELENE=m

#
# Common Interface (EN50221) controller drivers
#
CONFIG_DVB_CXD2099=m
CONFIG_DVB_SP2=m
# end of Customise DVB Frontends

#
# Tools to develop new frontends
#
# CONFIG_DVB_DUMMY_FE is not set
# end of Media ancillary drivers

#
# Graphics support
#
CONFIG_IMX_IPUV3_CORE=m
CONFIG_DRM=m
CONFIG_DRM_MIPI_DSI=y
CONFIG_DRM_DP_AUX_CHARDEV=y
# CONFIG_DRM_DEBUG_SELFTEST is not set
CONFIG_DRM_KMS_HELPER=m
CONFIG_DRM_KMS_FB_HELPER=y
CONFIG_DRM_DEBUG_DP_MST_TOPOLOGY_REFS=y
# CONFIG_DRM_FBDEV_EMULATION is not set
# CONFIG_DRM_LOAD_EDID_FIRMWARE is not set
# CONFIG_DRM_DP_CEC is not set
CONFIG_DRM_GEM_CMA_HELPER=y
CONFIG_DRM_KMS_CMA_HELPER=y
CONFIG_DRM_GEM_SHMEM_HELPER=y
CONFIG_DRM_VM=y
CONFIG_DRM_SCHED=m

#
# I2C encoder or helper chips
#
CONFIG_DRM_I2C_CH7006=m
CONFIG_DRM_I2C_SIL164=m
CONFIG_DRM_I2C_NXP_TDA998X=m
CONFIG_DRM_I2C_NXP_TDA9950=m
# end of I2C encoder or helper chips

#
# ARM devices
#
CONFIG_DRM_HDLCD=m
# CONFIG_DRM_HDLCD_SHOW_UNDERRUN is not set
CONFIG_DRM_MALI_DISPLAY=m
# CONFIG_DRM_KOMEDA is not set
# end of ARM devices

CONFIG_DRM_VGEM=m
# CONFIG_DRM_VKMS is not set
CONFIG_DRM_EXYNOS=m

#
# CRTCs
#
CONFIG_DRM_EXYNOS_FIMD=y
CONFIG_DRM_EXYNOS5433_DECON=y
# CONFIG_DRM_EXYNOS7_DECON is not set
CONFIG_DRM_EXYNOS_MIXER=y
# CONFIG_DRM_EXYNOS_VIDI is not set

#
# Encoders and Bridges
#
# CONFIG_DRM_EXYNOS_DPI is not set
CONFIG_DRM_EXYNOS_DSI=y
# CONFIG_DRM_EXYNOS_DP is not set
# CONFIG_DRM_EXYNOS_HDMI is not set
# CONFIG_DRM_EXYNOS_MIC is not set

#
# Sub-drivers
#
# CONFIG_DRM_EXYNOS_G2D is not set
CONFIG_DRM_EXYNOS_IPP=y
# CONFIG_DRM_EXYNOS_FIMC is not set
CONFIG_DRM_EXYNOS_ROTATOR=y
# CONFIG_DRM_EXYNOS_SCALER is not set
# CONFIG_DRM_EXYNOS_GSC is not set
CONFIG_DRM_UDL=m
# CONFIG_DRM_RCAR_DW_HDMI is not set
CONFIG_DRM_RCAR_LVDS=m
# CONFIG_DRM_VIRTIO_GPU is not set
CONFIG_DRM_PANEL=y

#
# Display Panels
#
CONFIG_DRM_PANEL_ARM_VERSATILE=m
# CONFIG_DRM_PANEL_ASUS_Z00T_TM5P5_NT35596 is not set
CONFIG_DRM_PANEL_BOE_HIMAX8279D=m
CONFIG_DRM_PANEL_BOE_TV101WUM_NL6=m
CONFIG_DRM_PANEL_LVDS=m
CONFIG_DRM_PANEL_SIMPLE=m
# CONFIG_DRM_PANEL_ELIDA_KD35T133 is not set
CONFIG_DRM_PANEL_FEIXIN_K101_IM2BA02=m
# CONFIG_DRM_PANEL_FEIYANG_FY07024DI26A30D is not set
# CONFIG_DRM_PANEL_ILITEK_ILI9881C is not set
CONFIG_DRM_PANEL_INNOLUX_P079ZCA=m
CONFIG_DRM_PANEL_JDI_LT070ME05000=m
# CONFIG_DRM_PANEL_KINGDISPLAY_KD097D04 is not set
CONFIG_DRM_PANEL_LEADTEK_LTK050H3146W=m
CONFIG_DRM_PANEL_LEADTEK_LTK500HD1829=m
CONFIG_DRM_PANEL_NOVATEK_NT35510=m
CONFIG_DRM_PANEL_OLIMEX_LCD_OLINUXINO=m
CONFIG_DRM_PANEL_ORISETECH_OTM8009A=m
CONFIG_DRM_PANEL_OSD_OSD101T2587_53TS=m
# CONFIG_DRM_PANEL_PANASONIC_VVX10F034N00 is not set
# CONFIG_DRM_PANEL_RASPBERRYPI_TOUCHSCREEN is not set
CONFIG_DRM_PANEL_RAYDIUM_RM67191=m
# CONFIG_DRM_PANEL_RAYDIUM_RM68200 is not set
# CONFIG_DRM_PANEL_RONBO_RB070D30 is not set
# CONFIG_DRM_PANEL_SAMSUNG_S6D16D0 is not set
CONFIG_DRM_PANEL_SAMSUNG_S6E3HA2=m
CONFIG_DRM_PANEL_SAMSUNG_S6E63J0X03=m
CONFIG_DRM_PANEL_SAMSUNG_S6E88A0_AMS452EF01=m
CONFIG_DRM_PANEL_SAMSUNG_S6E8AA0=m
CONFIG_DRM_PANEL_SEIKO_43WVF1G=m
CONFIG_DRM_PANEL_SHARP_LQ101R1SX01=m
CONFIG_DRM_PANEL_SHARP_LS037V7DW01=m
CONFIG_DRM_PANEL_SHARP_LS043T1LE01=m
CONFIG_DRM_PANEL_SITRONIX_ST7701=m
# CONFIG_DRM_PANEL_SITRONIX_ST7703 is not set
# CONFIG_DRM_PANEL_SONY_ACX424AKP is not set
# CONFIG_DRM_PANEL_TRULY_NT35597_WQXGA is not set
CONFIG_DRM_PANEL_VISIONOX_RM69299=m
CONFIG_DRM_PANEL_XINPENG_XPP055C272=m
# end of Display Panels

CONFIG_DRM_BRIDGE=y
CONFIG_DRM_PANEL_BRIDGE=y

#
# Display Interface Bridges
#
CONFIG_DRM_CDNS_DSI=m
# CONFIG_DRM_CHRONTEL_CH7033 is not set
# CONFIG_DRM_DISPLAY_CONNECTOR is not set
CONFIG_DRM_LVDS_CODEC=m
CONFIG_DRM_MEGACHIPS_STDPXXXX_GE_B850V3_FW=m
CONFIG_DRM_NWL_MIPI_DSI=m
# CONFIG_DRM_NXP_PTN3460 is not set
# CONFIG_DRM_PARADE_PS8622 is not set
CONFIG_DRM_PARADE_PS8640=m
CONFIG_DRM_SIL_SII8620=m
# CONFIG_DRM_SII902X is not set
# CONFIG_DRM_SII9234 is not set
CONFIG_DRM_SIMPLE_BRIDGE=m
CONFIG_DRM_THINE_THC63LVD1024=m
CONFIG_DRM_TOSHIBA_TC358764=m
CONFIG_DRM_TOSHIBA_TC358767=m
CONFIG_DRM_TOSHIBA_TC358768=m
CONFIG_DRM_TI_TFP410=m
# CONFIG_DRM_TI_SN65DSI86 is not set
CONFIG_DRM_TI_TPD12S015=m
# CONFIG_DRM_ANALOGIX_ANX6345 is not set
# CONFIG_DRM_ANALOGIX_ANX78XX is not set
# CONFIG_DRM_I2C_ADV7511 is not set
# end of Display Interface Bridges

# CONFIG_DRM_IMX is not set
CONFIG_DRM_INGENIC=m
# CONFIG_DRM_INGENIC_IPU is not set
CONFIG_DRM_V3D=m
CONFIG_DRM_ETNAVIV=m
# CONFIG_DRM_ETNAVIV_THERMAL is not set
CONFIG_DRM_ARCPGU=m
CONFIG_DRM_MXS=y
CONFIG_DRM_MXSFB=m
# CONFIG_DRM_GM12U320 is not set
CONFIG_DRM_PL111=m
CONFIG_DRM_TVE200=m
CONFIG_DRM_LIMA=m
CONFIG_DRM_PANFROST=m
CONFIG_DRM_ASPEED_GFX=m
CONFIG_DRM_MCDE=m
CONFIG_DRM_TIDSS=m
CONFIG_DRM_LEGACY=y
CONFIG_DRM_PANEL_ORIENTATION_QUIRKS=m

#
# Frame buffer Devices
#
CONFIG_FB_CMDLINE=y
CONFIG_FB_NOTIFY=y
CONFIG_FB=m
CONFIG_FIRMWARE_EDID=y
CONFIG_FB_CFB_FILLRECT=m
CONFIG_FB_CFB_COPYAREA=m
CONFIG_FB_CFB_IMAGEBLIT=m
CONFIG_FB_CFB_REV_PIXELS_IN_BYTE=y
CONFIG_FB_SYS_FILLRECT=m
CONFIG_FB_SYS_COPYAREA=m
CONFIG_FB_SYS_IMAGEBLIT=m
# CONFIG_FB_FOREIGN_ENDIAN is not set
CONFIG_FB_SYS_FOPS=m
CONFIG_FB_DEFERRED_IO=y
CONFIG_FB_HECUBA=m
CONFIG_FB_BACKLIGHT=m
CONFIG_FB_MODE_HELPERS=y
CONFIG_FB_TILEBLITTING=y

#
# Frame buffer hardware drivers
#
CONFIG_FB_CLPS711X=m
# CONFIG_FB_IMX is not set
# CONFIG_FB_ARC is not set
CONFIG_FB_VGA16=m
CONFIG_FB_N411=m
CONFIG_FB_HGA=m
CONFIG_FB_PVR2=m
CONFIG_FB_OPENCORES=m
# CONFIG_FB_S1D13XXX is not set
# CONFIG_FB_ATMEL is not set
CONFIG_FB_PXA168=m
# CONFIG_FB_W100 is not set
# CONFIG_FB_SH_MOBILE_LCDC is not set
# CONFIG_FB_TMIO is not set
CONFIG_FB_S3C=m
CONFIG_FB_S3C_DEBUG_REGWRITE=y
CONFIG_FB_SMSCUFX=m
CONFIG_FB_UDL=m
# CONFIG_FB_IBM_GXT4500 is not set
CONFIG_FB_GOLDFISH=m
CONFIG_FB_DA8XX=m
CONFIG_FB_VIRTUAL=m
CONFIG_FB_METRONOME=m
CONFIG_FB_BROADSHEET=m
CONFIG_FB_SSD1307=m
# CONFIG_FB_OMAP2 is not set
CONFIG_MMP_DISP=y
# CONFIG_MMP_DISP_CONTROLLER is not set
# CONFIG_MMP_FB is not set
# end of Frame buffer Devices

#
# Backlight & LCD device support
#
CONFIG_LCD_CLASS_DEVICE=y
# CONFIG_LCD_PLATFORM is not set
CONFIG_BACKLIGHT_CLASS_DEVICE=y
# CONFIG_BACKLIGHT_GENERIC is not set
CONFIG_BACKLIGHT_LM3533=m
CONFIG_BACKLIGHT_PWM=m
CONFIG_BACKLIGHT_DA9052=m
CONFIG_BACKLIGHT_QCOM_WLED=y
CONFIG_BACKLIGHT_SAHARA=y
# CONFIG_BACKLIGHT_ADP8860 is not set
# CONFIG_BACKLIGHT_ADP8870 is not set
CONFIG_BACKLIGHT_88PM860X=y
# CONFIG_BACKLIGHT_PCF50633 is not set
CONFIG_BACKLIGHT_LM3630A=m
CONFIG_BACKLIGHT_LM3639=y
CONFIG_BACKLIGHT_LP855X=m
# CONFIG_BACKLIGHT_PANDORA is not set
CONFIG_BACKLIGHT_SKY81452=m
# CONFIG_BACKLIGHT_TPS65217 is not set
# CONFIG_BACKLIGHT_AS3711 is not set
# CONFIG_BACKLIGHT_GPIO is not set
CONFIG_BACKLIGHT_LV5207LP=y
# CONFIG_BACKLIGHT_BD6107 is not set
CONFIG_BACKLIGHT_ARCXCNN=y
CONFIG_BACKLIGHT_LED=y
# end of Backlight & LCD device support

CONFIG_VGASTATE=m
CONFIG_VIDEOMODE_HELPERS=y
CONFIG_HDMI=y
# CONFIG_LOGO is not set
# end of Graphics support

CONFIG_SOUND=m
CONFIG_SOUND_OSS_CORE=y
CONFIG_SOUND_OSS_CORE_PRECLAIM=y
CONFIG_SND=m
CONFIG_SND_TIMER=m
CONFIG_SND_PCM=m
CONFIG_SND_HWDEP=m
CONFIG_SND_RAWMIDI=m
CONFIG_SND_OSSEMUL=y
CONFIG_SND_MIXER_OSS=m
# CONFIG_SND_PCM_OSS is not set
CONFIG_SND_PCM_TIMER=y
CONFIG_SND_HRTIMER=m
CONFIG_SND_DYNAMIC_MINORS=y
CONFIG_SND_MAX_CARDS=32
# CONFIG_SND_SUPPORT_OLD_API is not set
CONFIG_SND_PROC_FS=y
# CONFIG_SND_VERBOSE_PROCFS is not set
# CONFIG_SND_VERBOSE_PRINTK is not set
# CONFIG_SND_DEBUG is not set
CONFIG_SND_DMA_SGBUF=y
# CONFIG_SND_SEQUENCER is not set
CONFIG_SND_MPU401_UART=m
CONFIG_SND_OPL3_LIB=m
CONFIG_SND_OPL4_LIB=m
# CONFIG_SND_DRIVERS is not set
CONFIG_SND_WSS_LIB=m
CONFIG_SND_SB_COMMON=m
CONFIG_SND_SB8_DSP=m
CONFIG_SND_SB16_DSP=m
CONFIG_SND_ISA=y
# CONFIG_SND_ADLIB is not set
CONFIG_SND_AD1848=m
# CONFIG_SND_AZT1605 is not set
# CONFIG_SND_AZT2316 is not set
CONFIG_SND_CMI8328=m
CONFIG_SND_CMI8330=m
CONFIG_SND_CS4231=m
CONFIG_SND_CS4236=m
# CONFIG_SND_ES1688 is not set
# CONFIG_SND_ES18XX is not set
CONFIG_SND_SC6000=m
# CONFIG_SND_GUSCLASSIC is not set
CONFIG_SND_GUSEXTREME=m
CONFIG_SND_GUSMAX=m
# CONFIG_SND_JAZZ16 is not set
# CONFIG_SND_OPL3SA2 is not set
CONFIG_SND_OPTI92X_AD1848=m
CONFIG_SND_OPTI92X_CS4231=m
# CONFIG_SND_OPTI93X is not set
# CONFIG_SND_MIRO is not set
CONFIG_SND_SB8=m
CONFIG_SND_SB16=m
# CONFIG_SND_SBAWE is not set
# CONFIG_SND_SB16_CSP is not set
# CONFIG_SND_SSCAPE is not set
# CONFIG_SND_WAVEFRONT is not set
# CONFIG_SND_MSND_PINNACLE is not set
CONFIG_SND_MSND_CLASSIC=m

#
# HD-Audio
#
# end of HD-Audio

CONFIG_SND_HDA_PREALLOC_SIZE=2048
CONFIG_SND_USB=y
CONFIG_SND_USB_AUDIO=m
CONFIG_SND_USB_AUDIO_USE_MEDIA_CONTROLLER=y
# CONFIG_SND_USB_UA101 is not set
CONFIG_SND_USB_USX2Y=m
CONFIG_SND_USB_CAIAQ=m
# CONFIG_SND_USB_CAIAQ_INPUT is not set
CONFIG_SND_USB_US122L=m
# CONFIG_SND_USB_6FIRE is not set
CONFIG_SND_USB_HIFACE=m
# CONFIG_SND_BCD2000 is not set
CONFIG_SND_USB_LINE6=m
CONFIG_SND_USB_POD=m
CONFIG_SND_USB_PODHD=m
CONFIG_SND_USB_TONEPORT=m
# CONFIG_SND_USB_VARIAX is not set
# CONFIG_SND_SOC is not set
# CONFIG_SND_X86 is not set

#
# HID support
#
CONFIG_HID=m
CONFIG_HID_BATTERY_STRENGTH=y
# CONFIG_HIDRAW is not set
CONFIG_UHID=m
# CONFIG_HID_GENERIC is not set

#
# Special HID drivers
#
CONFIG_HID_A4TECH=m
CONFIG_HID_ACCUTOUCH=m
# CONFIG_HID_ACRUX is not set
CONFIG_HID_APPLE=m
CONFIG_HID_APPLEIR=m
CONFIG_HID_ASUS=m
CONFIG_HID_AUREAL=m
CONFIG_HID_BELKIN=m
# CONFIG_HID_BETOP_FF is not set
CONFIG_HID_BIGBEN_FF=m
# CONFIG_HID_CHERRY is not set
CONFIG_HID_CHICONY=m
CONFIG_HID_CORSAIR=m
# CONFIG_HID_COUGAR is not set
CONFIG_HID_MACALLY=m
CONFIG_HID_PRODIKEYS=m
CONFIG_HID_CMEDIA=m
CONFIG_HID_CREATIVE_SB0540=m
CONFIG_HID_CYPRESS=m
CONFIG_HID_DRAGONRISE=m
# CONFIG_DRAGONRISE_FF is not set
CONFIG_HID_EMS_FF=m
# CONFIG_HID_ELAN is not set
CONFIG_HID_ELECOM=m
CONFIG_HID_ELO=m
CONFIG_HID_EZKEY=m
CONFIG_HID_GEMBIRD=m
CONFIG_HID_GFRM=m
# CONFIG_HID_GLORIOUS is not set
CONFIG_HID_HOLTEK=m
CONFIG_HOLTEK_FF=y
# CONFIG_HID_GOOGLE_HAMMER is not set
CONFIG_HID_GT683R=m
CONFIG_HID_KEYTOUCH=m
CONFIG_HID_KYE=m
CONFIG_HID_UCLOGIC=m
# CONFIG_HID_WALTOP is not set
CONFIG_HID_VIEWSONIC=m
# CONFIG_HID_GYRATION is not set
# CONFIG_HID_ICADE is not set
# CONFIG_HID_ITE is not set
CONFIG_HID_JABRA=m
# CONFIG_HID_TWINHAN is not set
CONFIG_HID_KENSINGTON=m
CONFIG_HID_LCPOWER=m
CONFIG_HID_LED=m
CONFIG_HID_LENOVO=m
CONFIG_HID_LOGITECH=m
CONFIG_HID_LOGITECH_HIDPP=m
CONFIG_LOGITECH_FF=y
# CONFIG_LOGIRUMBLEPAD2_FF is not set
CONFIG_LOGIG940_FF=y
# CONFIG_LOGIWHEELS_FF is not set
CONFIG_HID_MAGICMOUSE=m
CONFIG_HID_MALTRON=m
# CONFIG_HID_MAYFLASH is not set
# CONFIG_HID_REDRAGON is not set
CONFIG_HID_MICROSOFT=m
CONFIG_HID_MONTEREY=m
CONFIG_HID_MULTITOUCH=m
CONFIG_HID_NTI=m
# CONFIG_HID_NTRIG is not set
CONFIG_HID_ORTEK=m
CONFIG_HID_PANTHERLORD=m
CONFIG_PANTHERLORD_FF=y
CONFIG_HID_PENMOUNT=m
# CONFIG_HID_PETALYNX is not set
# CONFIG_HID_PICOLCD is not set
CONFIG_HID_PLANTRONICS=m
CONFIG_HID_PRIMAX=m
# CONFIG_HID_RETRODE is not set
CONFIG_HID_ROCCAT=m
# CONFIG_HID_SAITEK is not set
CONFIG_HID_SAMSUNG=m
CONFIG_HID_SONY=m
# CONFIG_SONY_FF is not set
# CONFIG_HID_SPEEDLINK is not set
CONFIG_HID_STEAM=m
CONFIG_HID_STEELSERIES=m
CONFIG_HID_SUNPLUS=m
CONFIG_HID_RMI=m
# CONFIG_HID_GREENASIA is not set
CONFIG_HID_SMARTJOYPLUS=m
# CONFIG_SMARTJOYPLUS_FF is not set
CONFIG_HID_TIVO=m
CONFIG_HID_TOPSEED=m
# CONFIG_HID_THINGM is not set
CONFIG_HID_THRUSTMASTER=m
# CONFIG_THRUSTMASTER_FF is not set
# CONFIG_HID_UDRAW_PS3 is not set
# CONFIG_HID_U2FZERO is not set
CONFIG_HID_WACOM=m
CONFIG_HID_WIIMOTE=m
CONFIG_HID_XINMO=m
CONFIG_HID_ZEROPLUS=m
# CONFIG_ZEROPLUS_FF is not set
CONFIG_HID_ZYDACRON=m
# CONFIG_HID_SENSOR_HUB is not set
CONFIG_HID_ALPS=m
# CONFIG_HID_MCP2221 is not set
# end of Special HID drivers

#
# USB HID support
#
CONFIG_USB_HID=m
# CONFIG_HID_PID is not set
CONFIG_USB_HIDDEV=y

#
# USB HID Boot Protocol drivers
#
CONFIG_USB_KBD=m
CONFIG_USB_MOUSE=m
# end of USB HID Boot Protocol drivers
# end of USB HID support

#
# I2C HID support
#
# CONFIG_I2C_HID is not set
# end of I2C HID support
# end of HID support

CONFIG_USB_OHCI_LITTLE_ENDIAN=y
CONFIG_USB_SUPPORT=y
CONFIG_USB_COMMON=y
# CONFIG_USB_LED_TRIG is not set
# CONFIG_USB_ULPI_BUS is not set
# CONFIG_USB_CONN_GPIO is not set
CONFIG_USB_ARCH_HAS_HCD=y
CONFIG_USB=m
# CONFIG_USB_ANNOUNCE_NEW_DEVICES is not set

#
# Miscellaneous USB options
#
# CONFIG_USB_DEFAULT_PERSIST is not set
# CONFIG_USB_DYNAMIC_MINORS is not set
# CONFIG_USB_OTG is not set
CONFIG_USB_OTG_PRODUCTLIST=y
CONFIG_USB_OTG_DISABLE_EXTERNAL_HUB=y
CONFIG_USB_LEDS_TRIGGER_USBPORT=m
CONFIG_USB_AUTOSUSPEND_DELAY=2
CONFIG_USB_MON=m

#
# USB Host Controller Drivers
#
# CONFIG_USB_C67X00_HCD is not set
# CONFIG_USB_XHCI_HCD is not set
CONFIG_USB_BRCMSTB=m
# CONFIG_USB_EHCI_HCD is not set
CONFIG_USB_OXU210HP_HCD=m
CONFIG_USB_ISP116X_HCD=m
CONFIG_USB_ISP1362_HCD=m
CONFIG_USB_FOTG210_HCD=m
CONFIG_USB_OHCI_HCD=m
CONFIG_USB_OHCI_HCD_SPEAR=m
CONFIG_USB_OHCI_HCD_STI=m
# CONFIG_USB_OHCI_HCD_S3C2410 is not set
# CONFIG_USB_OHCI_HCD_LPC32XX is not set
CONFIG_USB_OHCI_HCD_AT91=m
CONFIG_USB_OHCI_HCD_OMAP3=m
CONFIG_USB_OHCI_HCD_DAVINCI=m
CONFIG_USB_OHCI_HCD_SSB=y
CONFIG_USB_OHCI_SH=y
CONFIG_USB_OHCI_EXYNOS=m
# CONFIG_USB_CNS3XXX_OHCI is not set
CONFIG_USB_OHCI_HCD_PLATFORM=m
CONFIG_USB_U132_HCD=m
# CONFIG_USB_SL811_HCD is not set
CONFIG_USB_R8A66597_HCD=m
CONFIG_USB_HCD_SSB=m
CONFIG_USB_HCD_TEST_MODE=y

#
# USB Device Class drivers
#
CONFIG_USB_ACM=m
# CONFIG_USB_PRINTER is not set
CONFIG_USB_WDM=m
CONFIG_USB_TMC=m

#
# NOTE: USB_STORAGE depends on SCSI but BLK_DEV_SD may
#

#
# also be needed; see USB_STORAGE Help for more info
#

#
# USB Imaging devices
#
CONFIG_USB_MDC800=m
CONFIG_USBIP_CORE=m
CONFIG_USBIP_VHCI_HCD=m
CONFIG_USBIP_VHCI_HC_PORTS=8
CONFIG_USBIP_VHCI_NR_HCS=1
# CONFIG_USBIP_HOST is not set
# CONFIG_USBIP_DEBUG is not set
CONFIG_USB_CDNS3=m
# CONFIG_USB_CDNS3_HOST is not set
CONFIG_USB_CDNS3_TI=m
CONFIG_USB_CDNS3_IMX=m
CONFIG_USB_MTU3=m
CONFIG_USB_MTU3_HOST=y
CONFIG_USB_MTU3_DEBUG=y
CONFIG_USB_MUSB_HDRC=m
CONFIG_USB_MUSB_HOST=y

#
# Platform Glue Layer
#
CONFIG_USB_MUSB_DSPS=m
CONFIG_USB_MUSB_UX500=m

#
# MUSB DMA mode
#
# CONFIG_MUSB_PIO_ONLY is not set
CONFIG_USB_UX500_DMA=y
CONFIG_USB_DWC3=m
CONFIG_USB_DWC3_HOST=y

#
# Platform Glue Driver Support
#
CONFIG_USB_DWC3_OMAP=m
# CONFIG_USB_DWC3_EXYNOS is not set
CONFIG_USB_DWC3_KEYSTONE=m
# CONFIG_USB_DWC3_MESON_G12A is not set
# CONFIG_USB_DWC3_OF_SIMPLE is not set
CONFIG_USB_DWC3_ST=m
CONFIG_USB_DWC3_QCOM=m
CONFIG_USB_DWC2=m
CONFIG_USB_DWC2_HOST=y

#
# Gadget/Dual-role mode requires USB Gadget support to be enabled
#
CONFIG_USB_DWC2_DEBUG=y
CONFIG_USB_DWC2_VERBOSE=y
CONFIG_USB_DWC2_TRACK_MISSED_SOFS=y
CONFIG_USB_DWC2_DEBUG_PERIODIC=y
# CONFIG_USB_ISP1760 is not set

#
# USB port drivers
#
CONFIG_USB_USS720=m
CONFIG_USB_SERIAL=m
# CONFIG_USB_SERIAL_GENERIC is not set
CONFIG_USB_SERIAL_SIMPLE=m
# CONFIG_USB_SERIAL_AIRCABLE is not set
CONFIG_USB_SERIAL_ARK3116=m
CONFIG_USB_SERIAL_BELKIN=m
CONFIG_USB_SERIAL_CH341=m
CONFIG_USB_SERIAL_WHITEHEAT=m
CONFIG_USB_SERIAL_DIGI_ACCELEPORT=m
CONFIG_USB_SERIAL_CP210X=m
CONFIG_USB_SERIAL_CYPRESS_M8=m
CONFIG_USB_SERIAL_EMPEG=m
CONFIG_USB_SERIAL_FTDI_SIO=m
CONFIG_USB_SERIAL_VISOR=m
# CONFIG_USB_SERIAL_IPAQ is not set
# CONFIG_USB_SERIAL_IR is not set
CONFIG_USB_SERIAL_EDGEPORT=m
CONFIG_USB_SERIAL_EDGEPORT_TI=m
CONFIG_USB_SERIAL_F81232=m
# CONFIG_USB_SERIAL_F8153X is not set
# CONFIG_USB_SERIAL_GARMIN is not set
# CONFIG_USB_SERIAL_IPW is not set
# CONFIG_USB_SERIAL_IUU is not set
CONFIG_USB_SERIAL_KEYSPAN_PDA=m
# CONFIG_USB_SERIAL_KEYSPAN is not set
CONFIG_USB_SERIAL_KLSI=m
CONFIG_USB_SERIAL_KOBIL_SCT=m
CONFIG_USB_SERIAL_MCT_U232=m
CONFIG_USB_SERIAL_METRO=m
CONFIG_USB_SERIAL_MOS7720=m
# CONFIG_USB_SERIAL_MOS7715_PARPORT is not set
# CONFIG_USB_SERIAL_MOS7840 is not set
CONFIG_USB_SERIAL_MXUPORT=m
CONFIG_USB_SERIAL_NAVMAN=m
CONFIG_USB_SERIAL_PL2303=m
CONFIG_USB_SERIAL_OTI6858=m
# CONFIG_USB_SERIAL_QCAUX is not set
CONFIG_USB_SERIAL_QUALCOMM=m
# CONFIG_USB_SERIAL_SPCP8X5 is not set
# CONFIG_USB_SERIAL_SAFE is not set
CONFIG_USB_SERIAL_SIERRAWIRELESS=m
CONFIG_USB_SERIAL_SYMBOL=m
CONFIG_USB_SERIAL_TI=m
CONFIG_USB_SERIAL_CYBERJACK=m
CONFIG_USB_SERIAL_XIRCOM=m
CONFIG_USB_SERIAL_WWAN=m
CONFIG_USB_SERIAL_OPTION=m
CONFIG_USB_SERIAL_OMNINET=m
CONFIG_USB_SERIAL_OPTICON=m
CONFIG_USB_SERIAL_XSENS_MT=m
CONFIG_USB_SERIAL_WISHBONE=m
CONFIG_USB_SERIAL_SSU100=m
CONFIG_USB_SERIAL_QT2=m
CONFIG_USB_SERIAL_UPD78F0730=m
CONFIG_USB_SERIAL_DEBUG=m

#
# USB Miscellaneous drivers
#
# CONFIG_USB_EMI62 is not set
CONFIG_USB_EMI26=m
# CONFIG_USB_ADUTUX is not set
# CONFIG_USB_SEVSEG is not set
# CONFIG_USB_LEGOTOWER is not set
# CONFIG_USB_LCD is not set
CONFIG_USB_CYPRESS_CY7C63=m
# CONFIG_USB_CYTHERM is not set
# CONFIG_USB_IDMOUSE is not set
CONFIG_USB_FTDI_ELAN=m
CONFIG_USB_APPLEDISPLAY=m
CONFIG_APPLE_MFI_FASTCHARGE=m
CONFIG_USB_SISUSBVGA=m
CONFIG_USB_LD=m
CONFIG_USB_TRANCEVIBRATOR=m
CONFIG_USB_IOWARRIOR=m
CONFIG_USB_TEST=m
# CONFIG_USB_EHSET_TEST_FIXTURE is not set
# CONFIG_USB_ISIGHTFW is not set
CONFIG_USB_YUREX=m
CONFIG_USB_EZUSB_FX2=m
# CONFIG_USB_HUB_USB251XB is not set
CONFIG_USB_HSIC_USB3503=m
CONFIG_USB_HSIC_USB4604=m
CONFIG_USB_LINK_LAYER_TEST=m
# CONFIG_USB_CHAOSKEY is not set

#
# USB Physical Layer drivers
#
CONFIG_USB_PHY=y
# CONFIG_NOP_USB_XCEIV is not set
CONFIG_USB_GPIO_VBUS=y
CONFIG_TAHVO_USB=m
CONFIG_TAHVO_USB_HOST_BY_DEFAULT=y
CONFIG_USB_ISP1301=m
# CONFIG_USB_TEGRA_PHY is not set
# CONFIG_USB_ULPI is not set
CONFIG_JZ4770_PHY=y
# end of USB Physical Layer drivers

# CONFIG_USB_GADGET is not set
CONFIG_TYPEC=y
CONFIG_TYPEC_TCPM=m
CONFIG_TYPEC_TCPCI=m
CONFIG_TYPEC_RT1711H=m
CONFIG_TYPEC_FUSB302=m
CONFIG_TYPEC_UCSI=m
# CONFIG_UCSI_CCG is not set
CONFIG_TYPEC_HD3SS3220=m
CONFIG_TYPEC_TPS6598X=m

#
# USB Type-C Multiplexer/DeMultiplexer Switch support
#
# CONFIG_TYPEC_MUX_PI3USB30532 is not set
# end of USB Type-C Multiplexer/DeMultiplexer Switch support

#
# USB Type-C Alternate Mode drivers
#
CONFIG_TYPEC_DP_ALTMODE=m
CONFIG_TYPEC_NVIDIA_ALTMODE=m
# end of USB Type-C Alternate Mode drivers

CONFIG_USB_ROLE_SWITCH=m
# CONFIG_MMC is not set
CONFIG_MEMSTICK=m
CONFIG_MEMSTICK_DEBUG=y

#
# MemoryStick drivers
#
# CONFIG_MEMSTICK_UNSAFE_RESUME is not set

#
# MemoryStick Host Controller Drivers
#
CONFIG_NEW_LEDS=y
CONFIG_LEDS_CLASS=y
CONFIG_LEDS_CLASS_FLASH=y
CONFIG_LEDS_BRIGHTNESS_HW_CHANGED=y

#
# LED drivers
#
# CONFIG_LEDS_88PM860X is not set
# CONFIG_LEDS_AAT1290 is not set
CONFIG_LEDS_AN30259A=y
CONFIG_LEDS_APU=m
CONFIG_LEDS_ARIEL=m
CONFIG_LEDS_AS3645A=m
CONFIG_LEDS_AW2013=y
# CONFIG_LEDS_BCM6328 is not set
CONFIG_LEDS_BCM6358=m
CONFIG_LEDS_LM3530=y
CONFIG_LEDS_LM3532=y
# CONFIG_LEDS_LM3533 is not set
# CONFIG_LEDS_LM3642 is not set
# CONFIG_LEDS_LM3692X is not set
# CONFIG_LEDS_LM3601X is not set
# CONFIG_LEDS_NET48XX is not set
CONFIG_LEDS_WRAP=m
CONFIG_LEDS_PCA9532=m
CONFIG_LEDS_PCA9532_GPIO=y
CONFIG_LEDS_GPIO=m
CONFIG_LEDS_LP3944=m
# CONFIG_LEDS_LP3952 is not set
CONFIG_LEDS_LP55XX_COMMON=y
CONFIG_LEDS_LP5521=m
# CONFIG_LEDS_LP5523 is not set
CONFIG_LEDS_LP5562=y
CONFIG_LEDS_LP8501=y
CONFIG_LEDS_LP8860=y
CONFIG_LEDS_PCA955X=m
# CONFIG_LEDS_PCA955X_GPIO is not set
CONFIG_LEDS_PCA963X=y
CONFIG_LEDS_WM8350=y
# CONFIG_LEDS_DA9052 is not set
# CONFIG_LEDS_PWM is not set
CONFIG_LEDS_REGULATOR=m
# CONFIG_LEDS_BD2802 is not set
CONFIG_LEDS_LT3593=m
# CONFIG_LEDS_TCA6507 is not set
# CONFIG_LEDS_TLC591XX is not set
CONFIG_LEDS_MAX77650=m
# CONFIG_LEDS_MAX77693 is not set
CONFIG_LEDS_LM355x=m
CONFIG_LEDS_OT200=m
CONFIG_LEDS_KTD2692=m
# CONFIG_LEDS_IS31FL319X is not set
CONFIG_LEDS_IS31FL32XX=y

#
# LED driver for blink(1) USB RGB LED is under Special HID drivers (HID_THINGM)
#
CONFIG_LEDS_BLINKM=m
CONFIG_LEDS_SYSCON=y
# CONFIG_LEDS_PM8058 is not set
CONFIG_LEDS_MLXCPLD=m
# CONFIG_LEDS_MLXREG is not set
CONFIG_LEDS_USER=m
CONFIG_LEDS_TI_LMU_COMMON=m
# CONFIG_LEDS_LM3697 is not set
CONFIG_LEDS_LM36274=m
CONFIG_LEDS_TPS6105X=y
# CONFIG_LEDS_SGM3140 is not set

#
# LED Triggers
#
CONFIG_LEDS_TRIGGERS=y
CONFIG_LEDS_TRIGGER_TIMER=m
CONFIG_LEDS_TRIGGER_ONESHOT=m
# CONFIG_LEDS_TRIGGER_MTD is not set
CONFIG_LEDS_TRIGGER_HEARTBEAT=y
CONFIG_LEDS_TRIGGER_BACKLIGHT=y
# CONFIG_LEDS_TRIGGER_CPU is not set
CONFIG_LEDS_TRIGGER_ACTIVITY=m
CONFIG_LEDS_TRIGGER_GPIO=y
CONFIG_LEDS_TRIGGER_DEFAULT_ON=m

#
# iptables trigger is under Netfilter config (LED target)
#
CONFIG_LEDS_TRIGGER_TRANSIENT=y
# CONFIG_LEDS_TRIGGER_CAMERA is not set
# CONFIG_LEDS_TRIGGER_PANIC is not set
# CONFIG_LEDS_TRIGGER_NETDEV is not set
CONFIG_LEDS_TRIGGER_PATTERN=m
CONFIG_LEDS_TRIGGER_AUDIO=y
CONFIG_ACCESSIBILITY=y
CONFIG_INFINIBAND=y
CONFIG_INFINIBAND_USER_MAD=y
CONFIG_INFINIBAND_USER_ACCESS=y
CONFIG_INFINIBAND_USER_MEM=y
# CONFIG_INFINIBAND_ON_DEMAND_PAGING is not set
CONFIG_INFINIBAND_ADDR_TRANS=y
# CONFIG_RDMA_SIW is not set
CONFIG_INFINIBAND_RTRS=y
CONFIG_INFINIBAND_RTRS_CLIENT=y
# CONFIG_INFINIBAND_RTRS_SERVER is not set
CONFIG_EDAC_ATOMIC_SCRUB=y
CONFIG_EDAC_SUPPORT=y
CONFIG_EDAC=y
CONFIG_EDAC_LEGACY_SYSFS=y
CONFIG_EDAC_DEBUG=y
CONFIG_EDAC_XGENE=y
CONFIG_RTC_LIB=y
CONFIG_RTC_MC146818_LIB=y
# CONFIG_RTC_CLASS is not set
CONFIG_DMADEVICES=y
CONFIG_DMADEVICES_DEBUG=y
# CONFIG_DMADEVICES_VDEBUG is not set

#
# DMA Devices
#
CONFIG_ASYNC_TX_ENABLE_CHANNEL_SWITCH=y
CONFIG_DMA_ENGINE=y
CONFIG_DMA_VIRTUAL_CHANNELS=y
CONFIG_DMA_OF=y
# CONFIG_ALTERA_MSGDMA is not set
# CONFIG_AXI_DMAC is not set
# CONFIG_COH901318 is not set
CONFIG_DMA_JZ4780=m
# CONFIG_DMA_SA11X0 is not set
CONFIG_DMA_SUN6I=y
CONFIG_DW_AXI_DMAC=y
# CONFIG_EP93XX_DMA is not set
# CONFIG_FSL_EDMA is not set
# CONFIG_IMG_MDC_DMA is not set
# CONFIG_INTEL_IDMA64 is not set
CONFIG_INTEL_IOP_ADMA=m
CONFIG_K3_DMA=y
# CONFIG_MCF_EDMA is not set
CONFIG_MILBEAUT_HDMAC=y
CONFIG_MILBEAUT_XDMAC=y
# CONFIG_MMP_PDMA is not set
CONFIG_MMP_TDMA=y
# CONFIG_MV_XOR is not set
# CONFIG_MXS_DMA is not set
# CONFIG_NBPFAXI_DMA is not set
CONFIG_STM32_DMA=y
CONFIG_STM32_DMAMUX=y
# CONFIG_STM32_MDMA is not set
CONFIG_SPRD_DMA=m
CONFIG_S3C24XX_DMAC=y
CONFIG_TEGRA20_APB_DMA=y
# CONFIG_TEGRA210_ADMA is not set
# CONFIG_TIMB_DMA is not set
CONFIG_UNIPHIER_MDMAC=m
CONFIG_UNIPHIER_XDMAC=y
# CONFIG_XGENE_DMA is not set
CONFIG_ZX_DMA=m
CONFIG_MTK_HSDMA=y
CONFIG_MTK_CQDMA=y
CONFIG_QCOM_HIDMA_MGMT=y
CONFIG_QCOM_HIDMA=m
# CONFIG_DW_DMAC is not set
CONFIG_SF_PDMA=m
CONFIG_RENESAS_DMA=y
CONFIG_SH_DMAE_BASE=y
CONFIG_SH_DMAE=m
CONFIG_RCAR_DMAC=y
CONFIG_RENESAS_USB_DMAC=m
CONFIG_TI_EDMA=y
CONFIG_DMA_OMAP=y
CONFIG_TI_DMA_CROSSBAR=y

#
# DMA Clients
#
# CONFIG_ASYNC_TX_DMA is not set
CONFIG_DMATEST=y
CONFIG_DMA_ENGINE_RAID=y

#
# DMABUF options
#
CONFIG_SYNC_FILE=y
# CONFIG_SW_SYNC is not set
CONFIG_UDMABUF=y
# CONFIG_DMABUF_MOVE_NOTIFY is not set
CONFIG_DMABUF_SELFTESTS=y
# CONFIG_DMABUF_HEAPS is not set
# end of DMABUF options

CONFIG_AUXDISPLAY=y
CONFIG_HD44780=m
CONFIG_IMG_ASCII_LCD=m
# CONFIG_HT16K33 is not set
CONFIG_PARPORT_PANEL=m
CONFIG_PANEL_PARPORT=0
CONFIG_PANEL_PROFILE=5
# CONFIG_PANEL_CHANGE_MESSAGE is not set
# CONFIG_CHARLCD_BL_OFF is not set
CONFIG_CHARLCD_BL_ON=y
# CONFIG_CHARLCD_BL_FLASH is not set
CONFIG_PANEL=m
CONFIG_CHARLCD=m
CONFIG_UIO=m
CONFIG_UIO_PDRV_GENIRQ=m
CONFIG_UIO_DMEM_GENIRQ=m
CONFIG_UIO_PRUSS=m
CONFIG_VFIO_IOMMU_TYPE1=m
CONFIG_VFIO=m
# CONFIG_VFIO_NOIOMMU is not set
CONFIG_VFIO_MDEV=m
CONFIG_VFIO_MDEV_DEVICE=m
CONFIG_VIRT_DRIVERS=y
CONFIG_VIRTIO=y
CONFIG_VIRTIO_MENU=y
# CONFIG_VIRTIO_BALLOON is not set
# CONFIG_VIRTIO_INPUT is not set
CONFIG_VIRTIO_MMIO=m
# CONFIG_VIRTIO_MMIO_CMDLINE_DEVICES is not set
# CONFIG_VDPA is not set
CONFIG_VHOST_IOTLB=y
CONFIG_VHOST_RING=m
CONFIG_VHOST=y
CONFIG_VHOST_MENU=y
CONFIG_VHOST_NET=y
# CONFIG_VHOST_VSOCK is not set
CONFIG_VHOST_CROSS_ENDIAN_LEGACY=y

#
# Microsoft Hyper-V guest support
#
# end of Microsoft Hyper-V guest support

CONFIG_GREYBUS=m
# CONFIG_GREYBUS_ES2 is not set
# CONFIG_STAGING is not set
CONFIG_X86_PLATFORM_DEVICES=y
# CONFIG_DCDBAS is not set
CONFIG_DELL_SMBIOS=m
CONFIG_DELL_RBU=m
# CONFIG_SENSORS_HDAPS is not set
CONFIG_INTEL_ATOMISP2_LED=m
CONFIG_XO1_RFKILL=y
# CONFIG_SAMSUNG_LAPTOP is not set
# CONFIG_MLX_PLATFORM is not set
CONFIG_INTEL_PUNIT_IPC=y
CONFIG_MFD_CROS_EC=y
CONFIG_CHROME_PLATFORMS=y
CONFIG_CHROMEOS_LAPTOP=m
CONFIG_CHROMEOS_PSTORE=m
CONFIG_CROS_EC=y
# CONFIG_CROS_EC_I2C is not set
CONFIG_CROS_EC_RPMSG=m
CONFIG_CROS_EC_PROTO=y
CONFIG_CROS_EC_CHARDEV=m
# CONFIG_CROS_EC_LIGHTBAR is not set
CONFIG_CROS_EC_VBC=m
# CONFIG_CROS_EC_DEBUGFS is not set
CONFIG_CROS_EC_SENSORHUB=m
CONFIG_CROS_EC_SYSFS=m
CONFIG_CROS_EC_TYPEC=m
# CONFIG_CROS_USBPD_LOGGER is not set
CONFIG_CROS_USBPD_NOTIFY=m
# CONFIG_MELLANOX_PLATFORM is not set
# CONFIG_OLPC_XO175 is not set
CONFIG_HAVE_CLK=y
CONFIG_CLKDEV_LOOKUP=y
CONFIG_HAVE_CLK_PREPARE=y
CONFIG_COMMON_CLK=y

#
# Clock driver for ARM Reference designs
#
# CONFIG_ICST is not set
CONFIG_CLK_SP810=y
# end of Clock driver for ARM Reference designs

CONFIG_COMMON_CLK_MAX77686=m
CONFIG_COMMON_CLK_MAX9485=m
# CONFIG_COMMON_CLK_RK808 is not set
CONFIG_COMMON_CLK_HI655X=y
CONFIG_COMMON_CLK_SCMI=m
# CONFIG_COMMON_CLK_SCPI is not set
# CONFIG_COMMON_CLK_SI5341 is not set
CONFIG_COMMON_CLK_SI5351=m
CONFIG_COMMON_CLK_SI514=y
# CONFIG_COMMON_CLK_SI544 is not set
CONFIG_COMMON_CLK_SI570=m
CONFIG_COMMON_CLK_BM1880=y
CONFIG_COMMON_CLK_CDCE706=y
CONFIG_COMMON_CLK_CDCE925=m
# CONFIG_COMMON_CLK_CS2000_CP is not set
CONFIG_COMMON_CLK_FSL_SAI=y
# CONFIG_COMMON_CLK_GEMINI is not set
# CONFIG_COMMON_CLK_ASPEED is not set
CONFIG_COMMON_CLK_S2MPS11=m
CONFIG_CLK_TWL6040=y
# CONFIG_COMMON_CLK_AXI_CLKGEN is not set
# CONFIG_CLK_QORIQ is not set
CONFIG_CLK_LS1028A_PLLDIG=m
CONFIG_COMMON_CLK_XGENE=y
CONFIG_COMMON_CLK_PWM=y
CONFIG_COMMON_CLK_OXNAS=y
CONFIG_COMMON_CLK_VC5=y
CONFIG_COMMON_CLK_MMP2_AUDIO=y
CONFIG_COMMON_CLK_BD718XX=y
CONFIG_COMMON_CLK_FIXED_MMIO=y
# CONFIG_CLK_ACTIONS is not set
# CONFIG_CLK_BAIKAL_T1 is not set
CONFIG_CLK_BCM2711_DVP=m
CONFIG_CLK_BCM2835=y
CONFIG_CLK_BCM_63XX=y
# CONFIG_CLK_BCM_63XX_GATE is not set
# CONFIG_CLK_BCM_KONA is not set
CONFIG_COMMON_CLK_IPROC=y
# CONFIG_CLK_BCM_CYGNUS is not set
# CONFIG_CLK_BCM_HR2 is not set
# CONFIG_CLK_BCM_NSP is not set
CONFIG_CLK_BCM_NS2=y
# CONFIG_CLK_BCM_SR is not set
CONFIG_CLK_RASPBERRYPI=m
# CONFIG_COMMON_CLK_HI3516CV300 is not set
# CONFIG_COMMON_CLK_HI3519 is not set
CONFIG_COMMON_CLK_HI3660=y
# CONFIG_COMMON_CLK_HI3670 is not set
CONFIG_COMMON_CLK_HI3798CV200=y
CONFIG_COMMON_CLK_HI6220=y
CONFIG_RESET_HISI=y
CONFIG_COMMON_CLK_BOSTON=y
CONFIG_MXC_CLK=m
CONFIG_CLK_IMX8MM=m
CONFIG_CLK_IMX8MN=m
# CONFIG_CLK_IMX8MP is not set
CONFIG_CLK_IMX8MQ=m

#
# Ingenic SoCs drivers
#
CONFIG_INGENIC_CGU_COMMON=y
CONFIG_INGENIC_CGU_JZ4740=y
# CONFIG_INGENIC_CGU_JZ4725B is not set
# CONFIG_INGENIC_CGU_JZ4770 is not set
# CONFIG_INGENIC_CGU_JZ4780 is not set
# CONFIG_INGENIC_CGU_X1000 is not set
# CONFIG_INGENIC_CGU_X1830 is not set
CONFIG_INGENIC_TCU_CLK=y
# end of Ingenic SoCs drivers

CONFIG_COMMON_CLK_KEYSTONE=m
CONFIG_TI_SYSCON_CLK=y

#
# Clock driver for MediaTek SoC
#
CONFIG_COMMON_CLK_MEDIATEK=y
CONFIG_COMMON_CLK_MT2701=y
# CONFIG_COMMON_CLK_MT2701_MMSYS is not set
# CONFIG_COMMON_CLK_MT2701_IMGSYS is not set
# CONFIG_COMMON_CLK_MT2701_VDECSYS is not set
# CONFIG_COMMON_CLK_MT2701_HIFSYS is not set
CONFIG_COMMON_CLK_MT2701_ETHSYS=y
CONFIG_COMMON_CLK_MT2701_BDPSYS=y
CONFIG_COMMON_CLK_MT2701_AUDSYS=y
# CONFIG_COMMON_CLK_MT2701_G3DSYS is not set
# CONFIG_COMMON_CLK_MT2712 is not set
# CONFIG_COMMON_CLK_MT6765 is not set
CONFIG_COMMON_CLK_MT6779=y
CONFIG_COMMON_CLK_MT6779_MMSYS=y
CONFIG_COMMON_CLK_MT6779_IMGSYS=y
# CONFIG_COMMON_CLK_MT6779_IPESYS is not set
CONFIG_COMMON_CLK_MT6779_CAMSYS=y
# CONFIG_COMMON_CLK_MT6779_VDECSYS is not set
CONFIG_COMMON_CLK_MT6779_VENCSYS=y
# CONFIG_COMMON_CLK_MT6779_MFGCFG is not set
CONFIG_COMMON_CLK_MT6779_AUDSYS=y
# CONFIG_COMMON_CLK_MT6797 is not set
# CONFIG_COMMON_CLK_MT7622 is not set
# CONFIG_COMMON_CLK_MT7629 is not set
CONFIG_COMMON_CLK_MT8135=y
CONFIG_COMMON_CLK_MT8173=y
# CONFIG_COMMON_CLK_MT8173_MMSYS is not set
# CONFIG_COMMON_CLK_MT8183 is not set
# CONFIG_COMMON_CLK_MT8516 is not set
# end of Clock driver for MediaTek SoC

CONFIG_QCOM_GDSC=y
CONFIG_COMMON_CLK_QCOM=m
# CONFIG_QCOM_A53PLL is not set
# CONFIG_QCOM_CLK_APCS_MSM8916 is not set
# CONFIG_QCOM_CLK_SMD_RPM is not set
# CONFIG_QCOM_CLK_RPMH is not set
CONFIG_APQ_GCC_8084=m
CONFIG_APQ_MMCC_8084=m
CONFIG_IPQ_APSS_PLL=m
CONFIG_IPQ_APSS_6018=m
CONFIG_IPQ_GCC_4019=m
CONFIG_IPQ_GCC_6018=m
CONFIG_IPQ_GCC_806X=m
CONFIG_IPQ_LCC_806X=m
CONFIG_IPQ_GCC_8074=m
CONFIG_MSM_GCC_8660=m
CONFIG_MSM_GCC_8916=m
CONFIG_MSM_GCC_8939=m
CONFIG_MSM_GCC_8960=m
CONFIG_MSM_LCC_8960=m
CONFIG_MDM_GCC_9615=m
# CONFIG_MDM_LCC_9615 is not set
CONFIG_MSM_MMCC_8960=m
CONFIG_MSM_GCC_8974=m
CONFIG_MSM_MMCC_8974=m
CONFIG_MSM_GCC_8994=m
CONFIG_MSM_GCC_8996=m
CONFIG_MSM_MMCC_8996=m
# CONFIG_MSM_GCC_8998 is not set
# CONFIG_MSM_GPUCC_8998 is not set
# CONFIG_MSM_MMCC_8998 is not set
CONFIG_QCS_GCC_404=m
CONFIG_SC_DISPCC_7180=m
CONFIG_SC_GCC_7180=m
CONFIG_SC_GPUCC_7180=m
CONFIG_SC_MSS_7180=m
CONFIG_SC_VIDEOCC_7180=m
# CONFIG_SDM_CAMCC_845 is not set
CONFIG_SDM_GCC_660=m
CONFIG_QCS_TURING_404=m
# CONFIG_QCS_Q6SSTOP_404 is not set
CONFIG_SDM_GCC_845=m
CONFIG_SDM_GPUCC_845=m
CONFIG_SDM_VIDEOCC_845=m
CONFIG_SDM_DISPCC_845=m
# CONFIG_SDM_LPASSCC_845 is not set
CONFIG_SM_GCC_8150=m
# CONFIG_SM_GCC_8250 is not set
CONFIG_SPMI_PMIC_CLKDIV=m
# CONFIG_QCOM_HFPLL is not set
CONFIG_KPSS_XCC=m
CONFIG_CLK_RENESAS=y
CONFIG_CLK_EMEV2=y
CONFIG_CLK_RZA1=y
CONFIG_CLK_R7S9210=y
# CONFIG_CLK_R8A73A4 is not set
CONFIG_CLK_R8A7740=y
# CONFIG_CLK_R8A7742 is not set
# CONFIG_CLK_R8A7743 is not set
CONFIG_CLK_R8A7745=y
# CONFIG_CLK_R8A77470 is not set
# CONFIG_CLK_R8A774A1 is not set
CONFIG_CLK_R8A774B1=y
CONFIG_CLK_R8A774C0=y
CONFIG_CLK_R8A7778=y
# CONFIG_CLK_R8A7779 is not set
# CONFIG_CLK_R8A7790 is not set
# CONFIG_CLK_R8A7791 is not set
# CONFIG_CLK_R8A7792 is not set
# CONFIG_CLK_R8A7794 is not set
# CONFIG_CLK_R8A7795 is not set
# CONFIG_CLK_R8A77960 is not set
CONFIG_CLK_R8A77961=y
# CONFIG_CLK_R8A77965 is not set
CONFIG_CLK_R8A77970=y
# CONFIG_CLK_R8A77980 is not set
CONFIG_CLK_R8A77990=y
# CONFIG_CLK_R8A77995 is not set
CONFIG_CLK_R9A06G032=y
CONFIG_CLK_SH73A0=y
CONFIG_CLK_RCAR_GEN2_CPG=y
CONFIG_CLK_RCAR_GEN3_CPG=y
# CONFIG_CLK_RCAR_USB2_CLOCK_SEL is not set
CONFIG_CLK_RENESAS_CPG_MSSR=y
CONFIG_CLK_RENESAS_CPG_MSTP=y
CONFIG_CLK_RENESAS_DIV6=y
CONFIG_COMMON_CLK_SAMSUNG=y
# CONFIG_EXYNOS_ARM64_COMMON_CLK is not set
CONFIG_EXYNOS_AUDSS_CLK_CON=m
CONFIG_S3C2410_COMMON_CLK=y
CONFIG_S3C2412_COMMON_CLK=y
CONFIG_S3C2443_COMMON_CLK=y
# CONFIG_CLK_SIFIVE is not set
# CONFIG_SPRD_COMMON_CLK is not set
# CONFIG_CLK_SUNXI is not set
# CONFIG_SUNXI_CCU is not set
CONFIG_COMMON_CLK_TI_ADPLL=y
CONFIG_CLK_UNIPHIER=y
# CONFIG_CLK_LGM_CGU is not set
CONFIG_HWSPINLOCK=y
# CONFIG_HWSPINLOCK_OMAP is not set
# CONFIG_HWSPINLOCK_QCOM is not set
CONFIG_HWSPINLOCK_SIRF=y
CONFIG_HWSPINLOCK_SPRD=y
CONFIG_HWSPINLOCK_STM32=m
# CONFIG_HSEM_U8500 is not set

#
# Clock Source drivers
#
CONFIG_TIMER_OF=y
CONFIG_TIMER_PROBE=y
CONFIG_CLKSRC_I8253=y
CONFIG_CLKEVT_I8253=y
CONFIG_I8253_LOCK=y
CONFIG_CLKBLD_I8253=y
CONFIG_CLKSRC_MMIO=y
# CONFIG_BCM2835_TIMER is not set
# CONFIG_BCM_KONA_TIMER is not set
CONFIG_DAVINCI_TIMER=y
# CONFIG_DIGICOLOR_TIMER is not set
# CONFIG_DW_APB_TIMER is not set
CONFIG_FTTMR010_TIMER=y
CONFIG_IXP4XX_TIMER=y
CONFIG_MESON6_TIMER=y
CONFIG_OWL_TIMER=y
CONFIG_RDA_TIMER=y
CONFIG_SUN4I_TIMER=y
# CONFIG_SUN5I_HSTIMER is not set
# CONFIG_TEGRA_TIMER is not set
CONFIG_VT8500_TIMER=y
# CONFIG_NPCM7XX_TIMER is not set
CONFIG_CADENCE_TTC_TIMER=y
CONFIG_ASM9260_TIMER=y
# CONFIG_CLKSRC_DBX500_PRCMU is not set
# CONFIG_CLPS711X_TIMER is not set
# CONFIG_ATLAS7_TIMER is not set
CONFIG_MXS_TIMER=y
CONFIG_PRIMA2_TIMER=y
# CONFIG_NSPIRE_TIMER is not set
CONFIG_INTEGRATOR_AP_TIMER=y
# CONFIG_CLKSRC_PISTACHIO is not set
CONFIG_CLKSRC_STM32_LP=y
# CONFIG_ARMV7M_SYSTICK is not set
CONFIG_ATMEL_PIT=y
CONFIG_ATMEL_ST=y
CONFIG_CLKSRC_SAMSUNG_PWM=y
CONFIG_FSL_FTM_TIMER=y
CONFIG_OXNAS_RPS_TIMER=y
CONFIG_MTK_TIMER=y
# CONFIG_SPRD_TIMER is not set
CONFIG_CLKSRC_JCORE_PIT=y
CONFIG_SH_TIMER_CMT=y
# CONFIG_SH_TIMER_MTU2 is not set
CONFIG_RENESAS_OSTM=y
# CONFIG_SH_TIMER_TMU is not set
# CONFIG_EM_TIMER_STI is not set
# CONFIG_CLKSRC_PXA is not set
CONFIG_H8300_TMR8=y
CONFIG_H8300_TMR16=y
CONFIG_H8300_TPU=y
# CONFIG_TIMER_IMX_SYS_CTR is not set
CONFIG_CLKSRC_ST_LPC=y
CONFIG_ATCPIT100_TIMER=y
CONFIG_INGENIC_TIMER=y
CONFIG_INGENIC_OST=y
CONFIG_MICROCHIP_PIT64B=y
# end of Clock Source drivers

# CONFIG_MAILBOX is not set
CONFIG_IOMMU_API=y
CONFIG_IOMMU_SUPPORT=y

#
# Generic IOMMU Pagetable Support
#
CONFIG_IOMMU_IO_PGTABLE=y
CONFIG_IOMMU_IO_PGTABLE_LPAE=y
CONFIG_IOMMU_IO_PGTABLE_LPAE_SELFTEST=y
# CONFIG_IOMMU_IO_PGTABLE_ARMV7S is not set
# end of Generic IOMMU Pagetable Support

CONFIG_IOMMU_DEBUGFS=y
CONFIG_IOMMU_DEFAULT_PASSTHROUGH=y
CONFIG_OF_IOMMU=y
# CONFIG_OMAP_IOMMU is not set
# CONFIG_ROCKCHIP_IOMMU is not set
CONFIG_SUN50I_IOMMU=y
# CONFIG_EXYNOS_IOMMU is not set
CONFIG_IPMMU_VMSA=y
# CONFIG_ARM_SMMU is not set
# CONFIG_S390_CCW_IOMMU is not set
# CONFIG_S390_AP_IOMMU is not set
# CONFIG_MTK_IOMMU is not set
CONFIG_QCOM_IOMMU=y

#
# Remoteproc drivers
#
CONFIG_REMOTEPROC=y
CONFIG_INGENIC_VPU_RPROC=y
# end of Remoteproc drivers

#
# Rpmsg drivers
#
CONFIG_RPMSG=y
# CONFIG_RPMSG_CHAR is not set
CONFIG_RPMSG_VIRTIO=y
# end of Rpmsg drivers

CONFIG_SOUNDWIRE=m

#
# SoundWire Devices
#

#
# SOC (System On Chip) specific Drivers
#
CONFIG_OWL_PM_DOMAINS_HELPER=y
CONFIG_OWL_PM_DOMAINS=y

#
# Amlogic SoC drivers
#
CONFIG_MESON_CANVAS=y
# CONFIG_MESON_CLK_MEASURE is not set
# CONFIG_MESON_GX_SOCINFO is not set
CONFIG_MESON_GX_PM_DOMAINS=y
# CONFIG_MESON_EE_PM_DOMAINS is not set
# CONFIG_MESON_MX_SOCINFO is not set
# end of Amlogic SoC drivers

#
# Aspeed SoC drivers
#
CONFIG_SOC_ASPEED=y
# CONFIG_ASPEED_LPC_CTRL is not set
# CONFIG_ASPEED_LPC_SNOOP is not set
CONFIG_ASPEED_P2A_CTRL=y
# end of Aspeed SoC drivers

# CONFIG_AT91_SOC_ID is not set
CONFIG_AT91_SOC_SFR=y

#
# Broadcom SoC drivers
#
CONFIG_BCM2835_POWER=y
CONFIG_SOC_BRCMSTB=y
# end of Broadcom SoC drivers

#
# NXP/Freescale QorIQ SoC drivers
#
# CONFIG_QUICC_ENGINE is not set
CONFIG_FSL_MC_DPIO=m
CONFIG_DPAA2_CONSOLE=m
# end of NXP/Freescale QorIQ SoC drivers

#
# i.MX SoC drivers
#
# CONFIG_IMX_GPCV2_PM_DOMAINS is not set
CONFIG_SOC_IMX8M=y
# end of i.MX SoC drivers

#
# IXP4xx SoC drivers
#
# CONFIG_IXP4XX_QMGR is not set
CONFIG_IXP4XX_NPE=y
# end of IXP4xx SoC drivers

#
# MediaTek SoC drivers
#
# CONFIG_MTK_CMDQ is not set
CONFIG_MTK_INFRACFG=y
CONFIG_MTK_PMIC_WRAP=y
CONFIG_MTK_SCPSYS=y
CONFIG_MTK_MMSYS=y
# end of MediaTek SoC drivers

#
# Qualcomm SoC drivers
#
CONFIG_QCOM_COMMAND_DB=y
CONFIG_QCOM_GENI_SE=m
CONFIG_QCOM_GSBI=y
CONFIG_QCOM_LLCC=y
CONFIG_QCOM_QMI_HELPERS=y
CONFIG_QCOM_RPMH=y
# CONFIG_QCOM_RPMHPD is not set
# CONFIG_QCOM_RPMPD is not set
# CONFIG_QCOM_SMEM is not set
CONFIG_QCOM_SMD_RPM=y
CONFIG_QCOM_WCNSS_CTRL=m
# CONFIG_QCOM_APR is not set
# end of Qualcomm SoC drivers

# CONFIG_SOC_RENESAS is not set
CONFIG_ROCKCHIP_GRF=y
# CONFIG_ROCKCHIP_PM_DOMAINS is not set
# CONFIG_SOC_SAMSUNG is not set
CONFIG_SOC_TEGRA20_VOLTAGE_COUPLER=y
CONFIG_SOC_TEGRA30_VOLTAGE_COUPLER=y
CONFIG_SOC_TI=y
# CONFIG_UX500_SOC_ID is not set

#
# Xilinx SoC drivers
#
CONFIG_XILINX_VCU=y
# end of Xilinx SoC drivers

CONFIG_SOC_ZTE=y
# CONFIG_ZX2967_PM_DOMAINS is not set
# end of SOC (System On Chip) specific Drivers

CONFIG_PM_DEVFREQ=y

#
# DEVFREQ Governors
#
CONFIG_DEVFREQ_GOV_SIMPLE_ONDEMAND=y
CONFIG_DEVFREQ_GOV_PERFORMANCE=y
# CONFIG_DEVFREQ_GOV_POWERSAVE is not set
CONFIG_DEVFREQ_GOV_USERSPACE=y
# CONFIG_DEVFREQ_GOV_PASSIVE is not set

#
# DEVFREQ Drivers
#
# CONFIG_ARM_EXYNOS_BUS_DEVFREQ is not set
CONFIG_ARM_IMX_BUS_DEVFREQ=m
CONFIG_ARM_TEGRA_DEVFREQ=y
# CONFIG_ARM_TEGRA20_DEVFREQ is not set
CONFIG_PM_DEVFREQ_EVENT=y
# CONFIG_DEVFREQ_EVENT_EXYNOS_NOCP is not set
CONFIG_DEVFREQ_EVENT_EXYNOS_PPMU=m
# CONFIG_DEVFREQ_EVENT_ROCKCHIP_DFI is not set
CONFIG_EXTCON=y

#
# Extcon Device Drivers
#
# CONFIG_EXTCON_FSA9480 is not set
CONFIG_EXTCON_GPIO=y
CONFIG_EXTCON_MAX14577=m
CONFIG_EXTCON_MAX3355=y
CONFIG_EXTCON_MAX77693=m
CONFIG_EXTCON_MAX77843=m
CONFIG_EXTCON_PTN5150=m
# CONFIG_EXTCON_QCOM_SPMI_MISC is not set
CONFIG_EXTCON_RT8973A=y
CONFIG_EXTCON_SM5502=y
# CONFIG_EXTCON_USB_GPIO is not set
CONFIG_EXTCON_USBC_CROS_EC=m
# CONFIG_MEMORY is not set
# CONFIG_IIO is not set
CONFIG_PWM=y
CONFIG_PWM_SYSFS=y
CONFIG_PWM_DEBUG=y
CONFIG_PWM_ATMEL=y
# CONFIG_PWM_ATMEL_HLCDC_PWM is not set
CONFIG_PWM_BCM_IPROC=m
CONFIG_PWM_BCM_KONA=m
CONFIG_PWM_BCM2835=m
CONFIG_PWM_BERLIN=m
CONFIG_PWM_BRCMSTB=y
# CONFIG_PWM_CLPS711X is not set
CONFIG_PWM_CROS_EC=m
CONFIG_PWM_EP93XX=m
CONFIG_PWM_FSL_FTM=m
# CONFIG_PWM_HIBVT is not set
# CONFIG_PWM_IMG is not set
CONFIG_PWM_IMX1=y
CONFIG_PWM_IMX27=m
# CONFIG_PWM_IMX_TPM is not set
# CONFIG_PWM_IQS620A is not set
CONFIG_PWM_LP3943=m
CONFIG_PWM_LPC18XX_SCT=m
CONFIG_PWM_LPC32XX=y
CONFIG_PWM_MESON=m
# CONFIG_PWM_MTK_DISP is not set
CONFIG_PWM_MEDIATEK=m
CONFIG_PWM_MXS=y
CONFIG_PWM_OMAP_DMTIMER=y
CONFIG_PWM_PCA9685=y
CONFIG_PWM_PXA=m
CONFIG_PWM_RCAR=m
CONFIG_PWM_RENESAS_TPU=y
# CONFIG_PWM_ROCKCHIP is not set
CONFIG_PWM_SAMSUNG=m
CONFIG_PWM_SIFIVE=m
# CONFIG_PWM_SPEAR is not set
CONFIG_PWM_SPRD=m
CONFIG_PWM_STI=y
CONFIG_PWM_STM32=y
# CONFIG_PWM_STM32_LP is not set
CONFIG_PWM_SUN4I=m
CONFIG_PWM_TEGRA=y
CONFIG_PWM_TIECAP=y
CONFIG_PWM_TIEHRPWM=y
# CONFIG_PWM_TWL is not set
CONFIG_PWM_TWL_LED=m
CONFIG_PWM_VT8500=y
CONFIG_PWM_ZX=m

#
# IRQ chip support
#
CONFIG_IRQCHIP=y
CONFIG_AL_FIC=y
CONFIG_JCORE_AIC=y
CONFIG_RENESAS_INTC_IRQPIN=y
# CONFIG_RENESAS_IRQC is not set
CONFIG_RENESAS_RZA1_IRQC=y
CONFIG_TS4800_IRQ=m
# CONFIG_INGENIC_TCU_IRQ is not set
# CONFIG_RENESAS_H8S_INTC is not set
# CONFIG_EZNPS_GIC is not set
CONFIG_IRQ_UNIPHIER_AIDET=y
# CONFIG_IMX_IRQSTEER is not set
CONFIG_IMX_INTMUX=y
# CONFIG_EXYNOS_IRQ_COMBINER is not set
# CONFIG_LOONGSON_PCH_PIC is not set
# end of IRQ chip support

# CONFIG_IPACK_BUS is not set
CONFIG_RESET_CONTROLLER=y
CONFIG_RESET_ATH79=y
# CONFIG_RESET_AXS10X is not set
# CONFIG_RESET_BERLIN is not set
# CONFIG_RESET_BRCMSTB is not set
# CONFIG_RESET_BRCMSTB_RESCAL is not set
# CONFIG_RESET_HSDK is not set
# CONFIG_RESET_IMX7 is not set
CONFIG_RESET_INTEL_GW=y
CONFIG_RESET_LANTIQ=y
CONFIG_RESET_LPC18XX=y
CONFIG_RESET_MESON=y
CONFIG_RESET_MESON_AUDIO_ARB=m
CONFIG_RESET_NPCM=y
# CONFIG_RESET_PISTACHIO is not set
# CONFIG_RESET_QCOM_AOSS is not set
# CONFIG_RESET_QCOM_PDC is not set
# CONFIG_RESET_SCMI is not set
CONFIG_RESET_SIMPLE=y
# CONFIG_RESET_STM32MP157 is not set
CONFIG_RESET_SOCFPGA=y
CONFIG_RESET_SUNXI=y
CONFIG_RESET_TI_SYSCON=m
# CONFIG_RESET_UNIPHIER is not set
# CONFIG_RESET_UNIPHIER_GLUE is not set
# CONFIG_RESET_ZYNQ is not set
CONFIG_COMMON_RESET_HI3660=y
# CONFIG_COMMON_RESET_HI6220 is not set

#
# PHY Subsystem
#
CONFIG_GENERIC_PHY=y
CONFIG_GENERIC_PHY_MIPI_DPHY=y
# CONFIG_PHY_LPC18XX_USB_OTG is not set
CONFIG_PHY_XGENE=y
# CONFIG_PHY_SUN4I_USB is not set
CONFIG_PHY_SUN6I_MIPI_DPHY=y
CONFIG_PHY_SUN9I_USB=y
CONFIG_PHY_SUN50I_USB3=m
CONFIG_PHY_MESON8B_USB2=y
CONFIG_PHY_MESON_GXL_USB2=m
# CONFIG_PHY_MESON_G12A_USB2 is not set
CONFIG_PHY_MESON_G12A_USB3_PCIE=y
CONFIG_PHY_MESON_AXG_PCIE=y
CONFIG_PHY_MESON_AXG_MIPI_PCIE_ANALOG=y
# CONFIG_PHY_CYGNUS_PCIE is not set
# CONFIG_PHY_BCM_SR_USB is not set
# CONFIG_BCM_KONA_USB2_PHY is not set
# CONFIG_PHY_BCM_NS_USB2 is not set
CONFIG_PHY_NS2_USB_DRD=y
CONFIG_PHY_BRCM_SATA=m
# CONFIG_PHY_BRCM_USB is not set
CONFIG_PHY_BCM_SR_PCIE=m
CONFIG_PHY_CADENCE_TORRENT=m
# CONFIG_PHY_CADENCE_DPHY is not set
# CONFIG_PHY_CADENCE_SIERRA is not set
# CONFIG_PHY_CADENCE_SALVO is not set
CONFIG_PHY_FSL_IMX8MQ_USB=m
CONFIG_PHY_MIXEL_MIPI_DPHY=m
# CONFIG_PHY_HI6220_USB is not set
CONFIG_PHY_HI3660_USB=m
CONFIG_PHY_HISTB_COMBPHY=y
CONFIG_PHY_HISI_INNO_USB2=y
# CONFIG_PHY_LANTIQ_VRX200_PCIE is not set
CONFIG_PHY_LANTIQ_RCU_USB2=y
CONFIG_ARMADA375_USBCLUSTER_PHY=y
CONFIG_PHY_BERLIN_SATA=m
# CONFIG_PHY_BERLIN_USB is not set
# CONFIG_PHY_MVEBU_A3700_UTMI is not set
CONFIG_PHY_MVEBU_A38X_COMPHY=m
CONFIG_PHY_PXA_28NM_HSIC=m
CONFIG_PHY_PXA_28NM_USB2=m
# CONFIG_PHY_PXA_USB is not set
# CONFIG_PHY_MMP3_USB is not set
CONFIG_PHY_MTK_TPHY=y
CONFIG_PHY_MTK_UFS=y
CONFIG_PHY_MTK_XSPHY=y
CONFIG_PHY_MAPPHONE_MDM6600=y
CONFIG_PHY_OCELOT_SERDES=m
CONFIG_PHY_ATH79_USB=m
CONFIG_PHY_QCOM_IPQ4019_USB=y
# CONFIG_PHY_QCOM_PCIE2 is not set
# CONFIG_PHY_QCOM_QMP is not set
# CONFIG_PHY_QCOM_QUSB2 is not set
# CONFIG_PHY_QCOM_USB_SNPS_FEMTO_V2 is not set
CONFIG_PHY_QCOM_USB_HS_28NM=y
CONFIG_PHY_QCOM_USB_SS=y
CONFIG_PHY_RALINK_USB=m
# CONFIG_PHY_RCAR_GEN3_USB3 is not set
# CONFIG_PHY_ROCKCHIP_INNO_HDMI is not set
CONFIG_PHY_ROCKCHIP_INNO_USB2=y
CONFIG_PHY_ROCKCHIP_INNO_DSIDPHY=m
# CONFIG_PHY_ROCKCHIP_PCIE is not set
CONFIG_PHY_ROCKCHIP_TYPEC=m
# CONFIG_PHY_EXYNOS_DP_VIDEO is not set
CONFIG_PHY_EXYNOS_MIPI_VIDEO=y
CONFIG_PHY_EXYNOS_PCIE=y
CONFIG_PHY_SAMSUNG_UFS=y
# CONFIG_PHY_SAMSUNG_USB2 is not set
CONFIG_PHY_UNIPHIER_USB2=m
# CONFIG_PHY_UNIPHIER_USB3 is not set
CONFIG_PHY_UNIPHIER_PCIE=m
# CONFIG_PHY_ST_SPEAR1310_MIPHY is not set
# CONFIG_PHY_ST_SPEAR1340_MIPHY is not set
CONFIG_PHY_STIH407_USB=m
# CONFIG_PHY_STM32_USBPHYC is not set
# CONFIG_PHY_TEGRA194_P2U is not set
CONFIG_PHY_DA8XX_USB=y
CONFIG_PHY_DM816X_USB=y
# CONFIG_PHY_AM654_SERDES is not set
# CONFIG_PHY_J721E_WIZ is not set
CONFIG_OMAP_CONTROL_PHY=m
# CONFIG_TI_PIPE3 is not set
CONFIG_PHY_INTEL_COMBO=y
# CONFIG_PHY_INTEL_EMMC is not set
CONFIG_PHY_XILINX_ZYNQMP=y
# end of PHY Subsystem

# CONFIG_POWERCAP is not set
CONFIG_MCB=m
CONFIG_MCB_LPC=m

#
# Performance monitor support
#
# end of Performance monitor support

CONFIG_RAS=y

#
# Android
#
CONFIG_ANDROID=y
CONFIG_ANDROID_BINDER_IPC=y
# CONFIG_ANDROID_BINDERFS is not set
CONFIG_ANDROID_BINDER_DEVICES="binder,hwbinder,vndbinder"
CONFIG_ANDROID_BINDER_IPC_SELFTEST=y
# end of Android

CONFIG_DAX=y
# CONFIG_NVMEM is not set

#
# HW tracing support
#
# CONFIG_STM is not set
CONFIG_INTEL_TH=m
CONFIG_INTEL_TH_GTH=m
CONFIG_INTEL_TH_MSU=m
# CONFIG_INTEL_TH_PTI is not set
# CONFIG_INTEL_TH_DEBUG is not set
# end of HW tracing support

CONFIG_FPGA=y
CONFIG_FPGA_MGR_SOCFPGA=y
CONFIG_FPGA_MGR_SOCFPGA_A10=y
CONFIG_ALTERA_PR_IP_CORE=y
CONFIG_ALTERA_PR_IP_CORE_PLAT=y
# CONFIG_FPGA_MGR_ZYNQ_FPGA is not set
CONFIG_FPGA_BRIDGE=y
# CONFIG_ALTERA_FREEZE_BRIDGE is not set
CONFIG_XILINX_PR_DECOUPLER=y
# CONFIG_FPGA_REGION is not set
# CONFIG_FPGA_DFL is not set
# CONFIG_FPGA_MGR_ZYNQMP_FPGA is not set
CONFIG_FSI=m
# CONFIG_FSI_NEW_DEV_NODE is not set
CONFIG_FSI_MASTER_GPIO=m
CONFIG_FSI_MASTER_HUB=m
# CONFIG_FSI_MASTER_AST_CF is not set
# CONFIG_FSI_MASTER_ASPEED is not set
# CONFIG_FSI_SCOM is not set
CONFIG_FSI_SBEFIFO=m
# CONFIG_FSI_OCC is not set
CONFIG_TEE=y

#
# TEE drivers
#
# end of TEE drivers

CONFIG_MULTIPLEXER=y

#
# Multiplexer drivers
#
# CONFIG_MUX_ADG792A is not set
CONFIG_MUX_GPIO=m
CONFIG_MUX_MMIO=m
# end of Multiplexer drivers

CONFIG_PM_OPP=y
CONFIG_SIOX=m
# CONFIG_SIOX_BUS_GPIO is not set
CONFIG_SLIMBUS=y
# CONFIG_SLIM_QCOM_CTRL is not set
CONFIG_SLIM_QCOM_NGD_CTRL=y
# CONFIG_INTERCONNECT is not set
# CONFIG_COUNTER is not set
# end of Device Drivers

#
# File systems
#
CONFIG_DCACHE_WORD_ACCESS=y
CONFIG_VALIDATE_FS_PARSER=y
CONFIG_FSINFO=y
CONFIG_FS_POSIX_ACL=y
CONFIG_EXPORTFS=y
# CONFIG_EXPORTFS_BLOCK_OPS is not set
# CONFIG_FILE_LOCKING is not set
# CONFIG_FS_ENCRYPTION is not set
CONFIG_FS_VERITY=y
CONFIG_FS_VERITY_DEBUG=y
CONFIG_FS_VERITY_BUILTIN_SIGNATURES=y
CONFIG_FSNOTIFY=y
CONFIG_DNOTIFY=y
CONFIG_INOTIFY_USER=y
CONFIG_FANOTIFY=y
# CONFIG_FANOTIFY_ACCESS_PERMISSIONS is not set
# CONFIG_MOUNT_NOTIFICATIONS is not set
# CONFIG_SB_NOTIFICATIONS is not set
# CONFIG_QUOTA is not set
CONFIG_AUTOFS4_FS=y
CONFIG_AUTOFS_FS=y
# CONFIG_FUSE_FS is not set
CONFIG_OVERLAY_FS=y
CONFIG_OVERLAY_FS_REDIRECT_DIR=y
# CONFIG_OVERLAY_FS_REDIRECT_ALWAYS_FOLLOW is not set
# CONFIG_OVERLAY_FS_INDEX is not set
CONFIG_OVERLAY_FS_METACOPY=y

#
# Caches
#
# CONFIG_FSCACHE is not set
# end of Caches

#
# Pseudo filesystems
#
CONFIG_PROC_FS=y
CONFIG_PROC_KCORE=y
CONFIG_PROC_SYSCTL=y
# CONFIG_PROC_PAGE_MONITOR is not set
CONFIG_PROC_CHILDREN=y
CONFIG_PROC_PID_ARCH_STATUS=y
CONFIG_PROC_CPU_RESCTRL=y
CONFIG_KERNFS=y
CONFIG_SYSFS=y
CONFIG_TMPFS=y
CONFIG_TMPFS_POSIX_ACL=y
CONFIG_TMPFS_XATTR=y
CONFIG_HUGETLBFS=y
CONFIG_HUGETLB_PAGE=y
CONFIG_MEMFD_CREATE=y
# CONFIG_CONFIGFS_FS is not set
# end of Pseudo filesystems

CONFIG_MISC_FILESYSTEMS=y
CONFIG_ORANGEFS_FS=m
CONFIG_ECRYPT_FS=m
# CONFIG_ECRYPT_FS_MESSAGING is not set
# CONFIG_JFFS2_FS is not set
CONFIG_UBIFS_FS=m
# CONFIG_UBIFS_FS_ADVANCED_COMPR is not set
CONFIG_UBIFS_FS_LZO=y
CONFIG_UBIFS_FS_ZLIB=y
CONFIG_UBIFS_FS_ZSTD=y
# CONFIG_UBIFS_ATIME_SUPPORT is not set
CONFIG_UBIFS_FS_XATTR=y
CONFIG_UBIFS_FS_SECURITY=y
CONFIG_UBIFS_FS_AUTHENTICATION=y
CONFIG_CRAMFS=m
CONFIG_CRAMFS_MTD=y
CONFIG_ROMFS_FS=m
CONFIG_ROMFS_BACKED_BY_MTD=y
CONFIG_ROMFS_ON_MTD=y
# CONFIG_PSTORE is not set
CONFIG_NETWORK_FILESYSTEMS=y
CONFIG_CEPH_FS=y
# CONFIG_CEPH_FS_POSIX_ACL is not set
CONFIG_CEPH_FS_SECURITY_LABEL=y
# CONFIG_CIFS is not set
CONFIG_CODA_FS=m
CONFIG_AFS_FS=m
# CONFIG_AFS_DEBUG is not set
# CONFIG_AFS_DEBUG_CURSOR is not set
CONFIG_NLS=m
CONFIG_NLS_DEFAULT="iso8859-1"
CONFIG_NLS_CODEPAGE_437=m
CONFIG_NLS_CODEPAGE_737=m
CONFIG_NLS_CODEPAGE_775=m
CONFIG_NLS_CODEPAGE_850=m
# CONFIG_NLS_CODEPAGE_852 is not set
CONFIG_NLS_CODEPAGE_855=m
CONFIG_NLS_CODEPAGE_857=m
# CONFIG_NLS_CODEPAGE_860 is not set
# CONFIG_NLS_CODEPAGE_861 is not set
CONFIG_NLS_CODEPAGE_862=m
# CONFIG_NLS_CODEPAGE_863 is not set
CONFIG_NLS_CODEPAGE_864=m
CONFIG_NLS_CODEPAGE_865=m
# CONFIG_NLS_CODEPAGE_866 is not set
# CONFIG_NLS_CODEPAGE_869 is not set
CONFIG_NLS_CODEPAGE_936=m
CONFIG_NLS_CODEPAGE_950=m
CONFIG_NLS_CODEPAGE_932=m
# CONFIG_NLS_CODEPAGE_949 is not set
CONFIG_NLS_CODEPAGE_874=m
CONFIG_NLS_ISO8859_8=m
# CONFIG_NLS_CODEPAGE_1250 is not set
CONFIG_NLS_CODEPAGE_1251=m
CONFIG_NLS_ASCII=m
CONFIG_NLS_ISO8859_1=m
# CONFIG_NLS_ISO8859_2 is not set
CONFIG_NLS_ISO8859_3=m
# CONFIG_NLS_ISO8859_4 is not set
CONFIG_NLS_ISO8859_5=m
# CONFIG_NLS_ISO8859_6 is not set
CONFIG_NLS_ISO8859_7=m
CONFIG_NLS_ISO8859_9=m
# CONFIG_NLS_ISO8859_13 is not set
# CONFIG_NLS_ISO8859_14 is not set
# CONFIG_NLS_ISO8859_15 is not set
# CONFIG_NLS_KOI8_R is not set
CONFIG_NLS_KOI8_U=m
CONFIG_NLS_MAC_ROMAN=m
CONFIG_NLS_MAC_CELTIC=m
# CONFIG_NLS_MAC_CENTEURO is not set
CONFIG_NLS_MAC_CROATIAN=m
CONFIG_NLS_MAC_CYRILLIC=m
CONFIG_NLS_MAC_GAELIC=m
CONFIG_NLS_MAC_GREEK=m
# CONFIG_NLS_MAC_ICELAND is not set
# CONFIG_NLS_MAC_INUIT is not set
# CONFIG_NLS_MAC_ROMANIAN is not set
CONFIG_NLS_MAC_TURKISH=m
# CONFIG_NLS_UTF8 is not set
CONFIG_UNICODE=y
CONFIG_UNICODE_NORMALIZATION_SELFTEST=y
# end of File systems

#
# Security options
#
CONFIG_KEYS=y
CONFIG_KEYS_REQUEST_CACHE=y
CONFIG_PERSISTENT_KEYRINGS=y
CONFIG_TRUSTED_KEYS=m
# CONFIG_ENCRYPTED_KEYS is not set
# CONFIG_KEY_DH_OPERATIONS is not set
CONFIG_KEY_NOTIFICATIONS=y
# CONFIG_SECURITY_DMESG_RESTRICT is not set
CONFIG_SECURITY=y
CONFIG_SECURITYFS=y
CONFIG_SECURITY_NETWORK=y
CONFIG_PAGE_TABLE_ISOLATION=y
# CONFIG_SECURITY_INFINIBAND is not set
CONFIG_SECURITY_NETWORK_XFRM=y
CONFIG_SECURITY_PATH=y
# CONFIG_FORTIFY_SOURCE is not set
CONFIG_STATIC_USERMODEHELPER=y
CONFIG_STATIC_USERMODEHELPER_PATH="/sbin/usermode-helper"
# CONFIG_SECURITY_SMACK is not set
CONFIG_SECURITY_TOMOYO=y
CONFIG_SECURITY_TOMOYO_MAX_ACCEPT_ENTRY=2048
CONFIG_SECURITY_TOMOYO_MAX_AUDIT_LOG=1024
# CONFIG_SECURITY_TOMOYO_OMIT_USERSPACE_LOADER is not set
CONFIG_SECURITY_TOMOYO_POLICY_LOADER="/sbin/tomoyo-init"
CONFIG_SECURITY_TOMOYO_ACTIVATION_TRIGGER="/sbin/init"
# CONFIG_SECURITY_TOMOYO_INSECURE_BUILTIN_SETTING is not set
# CONFIG_SECURITY_APPARMOR is not set
CONFIG_SECURITY_YAMA=y
# CONFIG_SECURITY_SAFESETID is not set
CONFIG_SECURITY_LOCKDOWN_LSM=y
# CONFIG_SECURITY_LOCKDOWN_LSM_EARLY is not set
# CONFIG_LOCK_DOWN_KERNEL_FORCE_NONE is not set
# CONFIG_LOCK_DOWN_KERNEL_FORCE_INTEGRITY is not set
CONFIG_LOCK_DOWN_KERNEL_FORCE_CONFIDENTIALITY=y
CONFIG_INTEGRITY=y
# CONFIG_INTEGRITY_SIGNATURE is not set
# CONFIG_IMA is not set
# CONFIG_EVM is not set
CONFIG_DEFAULT_SECURITY_TOMOYO=y
# CONFIG_DEFAULT_SECURITY_DAC is not set
CONFIG_LSM="lockdown,yama,loadpin,safesetid,integrity,tomoyo,bpf"

#
# Kernel hardening options
#

#
# Memory initialization
#
CONFIG_INIT_STACK_NONE=y
CONFIG_INIT_ON_ALLOC_DEFAULT_ON=y
# CONFIG_INIT_ON_FREE_DEFAULT_ON is not set
# end of Memory initialization
# end of Kernel hardening options
# end of Security options

CONFIG_CRYPTO=y

#
# Crypto core or helper
#
CONFIG_CRYPTO_FIPS=y
CONFIG_CRYPTO_ALGAPI=y
CONFIG_CRYPTO_ALGAPI2=y
CONFIG_CRYPTO_AEAD=y
CONFIG_CRYPTO_AEAD2=y
CONFIG_CRYPTO_SKCIPHER=y
CONFIG_CRYPTO_SKCIPHER2=y
CONFIG_CRYPTO_HASH=y
CONFIG_CRYPTO_HASH2=y
CONFIG_CRYPTO_RNG=y
CONFIG_CRYPTO_RNG2=y
CONFIG_CRYPTO_RNG_DEFAULT=y
CONFIG_CRYPTO_AKCIPHER2=y
CONFIG_CRYPTO_AKCIPHER=y
CONFIG_CRYPTO_KPP2=y
CONFIG_CRYPTO_KPP=y
CONFIG_CRYPTO_ACOMP2=y
CONFIG_CRYPTO_MANAGER=y
CONFIG_CRYPTO_MANAGER2=y
CONFIG_CRYPTO_USER=y
# CONFIG_CRYPTO_MANAGER_DISABLE_TESTS is not set
CONFIG_CRYPTO_MANAGER_EXTRA_TESTS=y
CONFIG_CRYPTO_GF128MUL=y
CONFIG_CRYPTO_NULL=y
CONFIG_CRYPTO_NULL2=y
CONFIG_CRYPTO_PCRYPT=y
CONFIG_CRYPTO_CRYPTD=m
CONFIG_CRYPTO_AUTHENC=y
CONFIG_CRYPTO_TEST=m

#
# Public-key cryptography
#
CONFIG_CRYPTO_RSA=y
CONFIG_CRYPTO_DH=y
CONFIG_CRYPTO_ECC=m
# CONFIG_CRYPTO_ECDH is not set
CONFIG_CRYPTO_ECRDSA=m
CONFIG_CRYPTO_CURVE25519=m

#
# Authenticated Encryption with Associated Data
#
# CONFIG_CRYPTO_CCM is not set
CONFIG_CRYPTO_GCM=y
# CONFIG_CRYPTO_CHACHA20POLY1305 is not set
CONFIG_CRYPTO_AEGIS128=y
CONFIG_CRYPTO_SEQIV=y
CONFIG_CRYPTO_ECHAINIV=y

#
# Block modes
#
CONFIG_CRYPTO_CBC=y
# CONFIG_CRYPTO_CFB is not set
CONFIG_CRYPTO_CTR=y
CONFIG_CRYPTO_CTS=m
CONFIG_CRYPTO_ECB=m
CONFIG_CRYPTO_LRW=m
CONFIG_CRYPTO_OFB=y
CONFIG_CRYPTO_PCBC=m
CONFIG_CRYPTO_XTS=m
# CONFIG_CRYPTO_KEYWRAP is not set
CONFIG_CRYPTO_NHPOLY1305=y
CONFIG_CRYPTO_ADIANTUM=y
CONFIG_CRYPTO_ESSIV=y

#
# Hash modes
#
CONFIG_CRYPTO_CMAC=y
CONFIG_CRYPTO_HMAC=y
# CONFIG_CRYPTO_XCBC is not set
CONFIG_CRYPTO_VMAC=y

#
# Digest
#
CONFIG_CRYPTO_CRC32C=y
CONFIG_CRYPTO_CRC32C_INTEL=y
# CONFIG_CRYPTO_CRC32 is not set
CONFIG_CRYPTO_CRC32_PCLMUL=m
CONFIG_CRYPTO_XXHASH=m
CONFIG_CRYPTO_BLAKE2B=y
CONFIG_CRYPTO_BLAKE2S=m
CONFIG_CRYPTO_CRCT10DIF=m
CONFIG_CRYPTO_GHASH=y
CONFIG_CRYPTO_POLY1305=y
CONFIG_CRYPTO_MD4=m
CONFIG_CRYPTO_MD5=y
CONFIG_CRYPTO_MICHAEL_MIC=m
# CONFIG_CRYPTO_RMD128 is not set
CONFIG_CRYPTO_RMD160=y
# CONFIG_CRYPTO_RMD256 is not set
# CONFIG_CRYPTO_RMD320 is not set
CONFIG_CRYPTO_SHA1=y
CONFIG_CRYPTO_SHA256=y
CONFIG_CRYPTO_SHA512=y
# CONFIG_CRYPTO_SHA3 is not set
CONFIG_CRYPTO_SM3=y
CONFIG_CRYPTO_STREEBOG=y
CONFIG_CRYPTO_TGR192=y
CONFIG_CRYPTO_WP512=m

#
# Ciphers
#
CONFIG_CRYPTO_AES=y
CONFIG_CRYPTO_AES_TI=m
# CONFIG_CRYPTO_AES_NI_INTEL is not set
# CONFIG_CRYPTO_ANUBIS is not set
CONFIG_CRYPTO_ARC4=m
# CONFIG_CRYPTO_BLOWFISH is not set
# CONFIG_CRYPTO_CAMELLIA is not set
CONFIG_CRYPTO_CAST_COMMON=y
CONFIG_CRYPTO_CAST5=m
CONFIG_CRYPTO_CAST6=y
# CONFIG_CRYPTO_DES is not set
CONFIG_CRYPTO_FCRYPT=m
CONFIG_CRYPTO_KHAZAD=m
CONFIG_CRYPTO_SALSA20=y
CONFIG_CRYPTO_CHACHA20=y
CONFIG_CRYPTO_SEED=y
CONFIG_CRYPTO_SERPENT=m
# CONFIG_CRYPTO_SERPENT_SSE2_586 is not set
# CONFIG_CRYPTO_SM4 is not set
# CONFIG_CRYPTO_TEA is not set
CONFIG_CRYPTO_TWOFISH=y
CONFIG_CRYPTO_TWOFISH_COMMON=y
CONFIG_CRYPTO_TWOFISH_586=y

#
# Compression
#
CONFIG_CRYPTO_DEFLATE=y
CONFIG_CRYPTO_LZO=y
CONFIG_CRYPTO_842=y
CONFIG_CRYPTO_LZ4=m
# CONFIG_CRYPTO_LZ4HC is not set
CONFIG_CRYPTO_ZSTD=y

#
# Random Number Generation
#
# CONFIG_CRYPTO_ANSI_CPRNG is not set
CONFIG_CRYPTO_DRBG_MENU=y
CONFIG_CRYPTO_DRBG_HMAC=y
# CONFIG_CRYPTO_DRBG_HASH is not set
CONFIG_CRYPTO_DRBG_CTR=y
CONFIG_CRYPTO_DRBG=y
CONFIG_CRYPTO_JITTERENTROPY=y
CONFIG_CRYPTO_USER_API=y
# CONFIG_CRYPTO_USER_API_HASH is not set
CONFIG_CRYPTO_USER_API_SKCIPHER=m
CONFIG_CRYPTO_USER_API_RNG=y
CONFIG_CRYPTO_USER_API_AEAD=y
# CONFIG_CRYPTO_STATS is not set
CONFIG_CRYPTO_HASH_INFO=y

#
# Crypto library routines
#
CONFIG_CRYPTO_LIB_AES=y
CONFIG_CRYPTO_LIB_ARC4=m
CONFIG_CRYPTO_LIB_BLAKE2S_GENERIC=m
# CONFIG_CRYPTO_LIB_BLAKE2S is not set
CONFIG_CRYPTO_LIB_CHACHA_GENERIC=y
CONFIG_CRYPTO_LIB_CHACHA=m
CONFIG_CRYPTO_LIB_CURVE25519_GENERIC=m
# CONFIG_CRYPTO_LIB_CURVE25519 is not set
CONFIG_CRYPTO_LIB_POLY1305_RSIZE=1
CONFIG_CRYPTO_LIB_POLY1305_GENERIC=y
CONFIG_CRYPTO_LIB_POLY1305=m
CONFIG_CRYPTO_LIB_CHACHA20POLY1305=m
CONFIG_CRYPTO_LIB_SHA256=y
# CONFIG_CRYPTO_HW is not set
CONFIG_ASYMMETRIC_KEY_TYPE=y
CONFIG_ASYMMETRIC_PUBLIC_KEY_SUBTYPE=y
CONFIG_ASYMMETRIC_TPM_KEY_SUBTYPE=m
CONFIG_X509_CERTIFICATE_PARSER=y
# CONFIG_PKCS8_PRIVATE_KEY_PARSER is not set
# CONFIG_TPM_KEY_PARSER is not set
CONFIG_PKCS7_MESSAGE_PARSER=y
# CONFIG_PKCS7_TEST_KEY is not set
# CONFIG_SIGNED_PE_FILE_VERIFICATION is not set

#
# Certificates for signature checking
#
CONFIG_MODULE_SIG_KEY="certs/signing_key.pem"
CONFIG_SYSTEM_TRUSTED_KEYRING=y
CONFIG_SYSTEM_TRUSTED_KEYS=""
# CONFIG_SYSTEM_EXTRA_CERTIFICATE is not set
# CONFIG_SECONDARY_TRUSTED_KEYRING is not set
CONFIG_SYSTEM_BLACKLIST_KEYRING=y
CONFIG_SYSTEM_BLACKLIST_HASH_LIST=""
# end of Certificates for signature checking

CONFIG_BINARY_PRINTF=y

#
# Library routines
#
CONFIG_LINEAR_RANGES=y
# CONFIG_PACKING is not set
CONFIG_BITREVERSE=y
CONFIG_GENERIC_STRNCPY_FROM_USER=y
CONFIG_GENERIC_STRNLEN_USER=y
CONFIG_GENERIC_NET_UTILS=y
CONFIG_GENERIC_FIND_FIRST_BIT=y
CONFIG_CORDIC=m
CONFIG_PRIME_NUMBERS=m
CONFIG_RATIONAL=y
CONFIG_GENERIC_PCI_IOMAP=y
CONFIG_GENERIC_IOMAP=y
CONFIG_STMP_DEVICE=y
CONFIG_ARCH_HAS_FAST_MULTIPLIER=y
CONFIG_ARCH_USE_SYM_ANNOTATIONS=y
CONFIG_CRC_CCITT=y
CONFIG_CRC16=y
CONFIG_CRC_T10DIF=m
# CONFIG_CRC_ITU_T is not set
CONFIG_CRC32=y
# CONFIG_CRC32_SELFTEST is not set
# CONFIG_CRC32_SLICEBY8 is not set
# CONFIG_CRC32_SLICEBY4 is not set
# CONFIG_CRC32_SARWATE is not set
CONFIG_CRC32_BIT=y
# CONFIG_CRC64 is not set
CONFIG_CRC4=m
# CONFIG_CRC7 is not set
CONFIG_LIBCRC32C=y
CONFIG_CRC8=m
CONFIG_XXHASH=y
CONFIG_RANDOM32_SELFTEST=y
CONFIG_842_COMPRESS=y
CONFIG_842_DECOMPRESS=y
CONFIG_ZLIB_INFLATE=y
CONFIG_ZLIB_DEFLATE=y
CONFIG_LZO_COMPRESS=y
CONFIG_LZO_DECOMPRESS=y
CONFIG_LZ4_COMPRESS=m
CONFIG_LZ4_DECOMPRESS=m
CONFIG_ZSTD_COMPRESS=y
CONFIG_ZSTD_DECOMPRESS=y
CONFIG_XZ_DEC=y
# CONFIG_XZ_DEC_X86 is not set
# CONFIG_XZ_DEC_POWERPC is not set
# CONFIG_XZ_DEC_IA64 is not set
CONFIG_XZ_DEC_ARM=y
CONFIG_XZ_DEC_ARMTHUMB=y
CONFIG_XZ_DEC_SPARC=y
CONFIG_XZ_DEC_BCJ=y
CONFIG_XZ_DEC_TEST=y
CONFIG_DECOMPRESS_GZIP=y
CONFIG_DECOMPRESS_XZ=y
CONFIG_DECOMPRESS_LZO=y
CONFIG_GENERIC_ALLOCATOR=y
CONFIG_BCH=m
CONFIG_ASSOCIATIVE_ARRAY=y
CONFIG_HAS_IOMEM=y
CONFIG_HAS_IOPORT_MAP=y
CONFIG_HAS_DMA=y
CONFIG_DMA_OPS=y
CONFIG_NEED_SG_DMA_LENGTH=y
CONFIG_NEED_DMA_MAP_STATE=y
CONFIG_ARCH_DMA_ADDR_T_64BIT=y
CONFIG_DMA_DECLARE_COHERENT=y
CONFIG_SWIOTLB=y
CONFIG_DMA_CMA=y

#
# Default contiguous memory area size:
#
CONFIG_CMA_SIZE_PERCENTAGE=0
# CONFIG_CMA_SIZE_SEL_MBYTES is not set
CONFIG_CMA_SIZE_SEL_PERCENTAGE=y
# CONFIG_CMA_SIZE_SEL_MIN is not set
# CONFIG_CMA_SIZE_SEL_MAX is not set
CONFIG_CMA_ALIGNMENT=8
CONFIG_DMA_API_DEBUG=y
# CONFIG_DMA_API_DEBUG_SG is not set
CONFIG_SGL_ALLOC=y
CONFIG_CPU_RMAP=y
CONFIG_DQL=y
CONFIG_GLOB=y
CONFIG_GLOB_SELFTEST=y
CONFIG_NLATTR=y
CONFIG_CLZ_TAB=y
CONFIG_IRQ_POLL=y
CONFIG_MPILIB=y
CONFIG_DIMLIB=y
CONFIG_LIBFDT=y
CONFIG_OID_REGISTRY=y
CONFIG_HAVE_GENERIC_VDSO=y
CONFIG_GENERIC_GETTIMEOFDAY=y
CONFIG_GENERIC_VDSO_32=y
CONFIG_GENERIC_VDSO_TIME_NS=y
CONFIG_FONT_SUPPORT=y
CONFIG_FONT_8x16=y
CONFIG_FONT_AUTOSELECT=y
CONFIG_ARCH_STACKWALK=y
CONFIG_STACKDEPOT=y
# CONFIG_PARMAN is not set
CONFIG_OBJAGG=m
# CONFIG_STRING_SELFTEST is not set
# end of Library routines

#
# Kernel hacking
#

#
# printk and dmesg options
#
# CONFIG_PRINTK_TIME is not set
CONFIG_PRINTK_CALLER=y
CONFIG_CONSOLE_LOGLEVEL_DEFAULT=7
CONFIG_CONSOLE_LOGLEVEL_QUIET=4
CONFIG_MESSAGE_LOGLEVEL_DEFAULT=4
CONFIG_DEBUG_SYNCHRO_TEST=m
# CONFIG_BOOT_PRINTK_DELAY is not set
CONFIG_DYNAMIC_DEBUG=y
CONFIG_DYNAMIC_DEBUG_CORE=y
CONFIG_SYMBOLIC_ERRNAME=y
# end of printk and dmesg options

#
# Compile-time checks and compiler options
#
# CONFIG_ENABLE_MUST_CHECK is not set
CONFIG_FRAME_WARN=1024
CONFIG_STRIP_ASM_SYMS=y
# CONFIG_READABLE_ASM is not set
# CONFIG_HEADERS_INSTALL is not set
# CONFIG_DEBUG_SECTION_MISMATCH is not set
# CONFIG_SECTION_MISMATCH_WARN_ONLY is not set
CONFIG_FRAME_POINTER=y
CONFIG_DEBUG_FORCE_WEAK_PER_CPU=y
# end of Compile-time checks and compiler options

#
# Generic Kernel Debugging Instruments
#
# CONFIG_MAGIC_SYSRQ is not set
CONFIG_DEBUG_FS=y
CONFIG_HAVE_ARCH_KGDB=y
CONFIG_KGDB=y
CONFIG_KGDB_TESTS=y
CONFIG_KGDB_TESTS_ON_BOOT=y
CONFIG_KGDB_TESTS_BOOT_STRING="V1F100"
CONFIG_KGDB_LOW_LEVEL_TRAP=y
# CONFIG_KGDB_KDB is not set
CONFIG_ARCH_HAS_EARLY_DEBUG=y
CONFIG_ARCH_HAS_UBSAN_SANITIZE_ALL=y
CONFIG_UBSAN=y
CONFIG_UBSAN_TRAP=y
# CONFIG_UBSAN_BOUNDS is not set
CONFIG_UBSAN_MISC=y
CONFIG_TEST_UBSAN=m
# end of Generic Kernel Debugging Instruments

CONFIG_DEBUG_KERNEL=y
CONFIG_DEBUG_MISC=y

#
# Memory Debugging
#
CONFIG_PAGE_EXTENSION=y
# CONFIG_DEBUG_PAGEALLOC is not set
# CONFIG_PAGE_OWNER is not set
# CONFIG_PAGE_POISONING is not set
# CONFIG_DEBUG_PAGE_REF is not set
CONFIG_DEBUG_RODATA_TEST=y
CONFIG_ARCH_HAS_DEBUG_WX=y
CONFIG_DEBUG_WX=y
CONFIG_GENERIC_PTDUMP=y
CONFIG_PTDUMP_CORE=y
# CONFIG_PTDUMP_DEBUGFS is not set
# CONFIG_DEBUG_OBJECTS is not set
CONFIG_HAVE_DEBUG_KMEMLEAK=y
# CONFIG_DEBUG_KMEMLEAK is not set
CONFIG_DEBUG_STACK_USAGE=y
CONFIG_SCHED_STACK_END_CHECK=y
# CONFIG_DEBUG_VM is not set
CONFIG_ARCH_HAS_DEBUG_VIRTUAL=y
# CONFIG_DEBUG_VIRTUAL is not set
# CONFIG_DEBUG_MEMORY_INIT is not set
# CONFIG_DEBUG_PER_CPU_MAPS is not set
CONFIG_HAVE_DEBUG_STACKOVERFLOW=y
CONFIG_DEBUG_STACKOVERFLOW=y
CONFIG_CC_HAS_KASAN_GENERIC=y
# end of Memory Debugging

# CONFIG_DEBUG_SHIRQ is not set

#
# Debug Oops, Lockups and Hangs
#
# CONFIG_PANIC_ON_OOPS is not set
CONFIG_PANIC_ON_OOPS_VALUE=0
CONFIG_PANIC_TIMEOUT=0
CONFIG_LOCKUP_DETECTOR=y
CONFIG_SOFTLOCKUP_DETECTOR=y
CONFIG_BOOTPARAM_SOFTLOCKUP_PANIC=y
CONFIG_BOOTPARAM_SOFTLOCKUP_PANIC_VALUE=1
CONFIG_HARDLOCKUP_DETECTOR_PERF=y
CONFIG_HARDLOCKUP_DETECTOR=y
# CONFIG_BOOTPARAM_HARDLOCKUP_PANIC is not set
CONFIG_BOOTPARAM_HARDLOCKUP_PANIC_VALUE=0
CONFIG_DETECT_HUNG_TASK=y
CONFIG_DEFAULT_HUNG_TASK_TIMEOUT=120
CONFIG_BOOTPARAM_HUNG_TASK_PANIC=y
CONFIG_BOOTPARAM_HUNG_TASK_PANIC_VALUE=1
# CONFIG_WQ_WATCHDOG is not set
CONFIG_TEST_LOCKUP=m
# end of Debug Oops, Lockups and Hangs

#
# Scheduler Debugging
#
CONFIG_SCHED_DEBUG=y
CONFIG_SCHED_INFO=y
CONFIG_SCHEDSTATS=y
# end of Scheduler Debugging

CONFIG_DEBUG_TIMEKEEPING=y

#
# Lock Debugging (spinlocks, mutexes, etc...)
#
CONFIG_LOCK_DEBUGGING_SUPPORT=y
CONFIG_PROVE_LOCKING=y
# CONFIG_PROVE_RAW_LOCK_NESTING is not set
CONFIG_LOCK_STAT=y
CONFIG_DEBUG_RT_MUTEXES=y
CONFIG_DEBUG_SPINLOCK=y
CONFIG_DEBUG_MUTEXES=y
CONFIG_DEBUG_WW_MUTEX_SLOWPATH=y
CONFIG_DEBUG_RWSEMS=y
CONFIG_DEBUG_LOCK_ALLOC=y
CONFIG_LOCKDEP=y
CONFIG_DEBUG_LOCKDEP=y
# CONFIG_DEBUG_ATOMIC_SLEEP is not set
CONFIG_DEBUG_LOCKING_API_SELFTESTS=y
CONFIG_LOCK_TORTURE_TEST=y
# CONFIG_WW_MUTEX_SELFTEST is not set
# CONFIG_SCF_TORTURE_TEST is not set
# end of Lock Debugging (spinlocks, mutexes, etc...)

CONFIG_TRACE_IRQFLAGS=y
CONFIG_STACKTRACE=y
# CONFIG_WARN_ALL_UNSEEDED_RANDOM is not set
# CONFIG_DEBUG_KOBJECT is not set

#
# Debug kernel data structures
#
CONFIG_DEBUG_LIST=y
CONFIG_DEBUG_PLIST=y
# CONFIG_DEBUG_SG is not set
CONFIG_DEBUG_NOTIFIERS=y
CONFIG_BUG_ON_DATA_CORRUPTION=y
# end of Debug kernel data structures

# CONFIG_DEBUG_CREDENTIALS is not set

#
# RCU Debugging
#
CONFIG_PROVE_RCU=y
CONFIG_TORTURE_TEST=y
CONFIG_RCU_PERF_TEST=m
CONFIG_RCU_TORTURE_TEST=y
# CONFIG_RCU_REF_SCALE_TEST is not set
CONFIG_RCU_CPU_STALL_TIMEOUT=21
# CONFIG_RCU_TRACE is not set
CONFIG_RCU_EQS_DEBUG=y
# end of RCU Debugging

CONFIG_DEBUG_WQ_FORCE_RR_CPU=y
# CONFIG_CPU_HOTPLUG_STATE_CONTROL is not set
CONFIG_LATENCYTOP=y
CONFIG_USER_STACKTRACE_SUPPORT=y
CONFIG_NOP_TRACER=y
CONFIG_HAVE_FUNCTION_TRACER=y
CONFIG_HAVE_FUNCTION_GRAPH_TRACER=y
CONFIG_HAVE_DYNAMIC_FTRACE=y
CONFIG_HAVE_DYNAMIC_FTRACE_WITH_REGS=y
CONFIG_HAVE_DYNAMIC_FTRACE_WITH_DIRECT_CALLS=y
CONFIG_HAVE_FTRACE_MCOUNT_RECORD=y
CONFIG_HAVE_SYSCALL_TRACEPOINTS=y
CONFIG_HAVE_FENTRY=y
CONFIG_HAVE_C_RECORDMCOUNT=y
CONFIG_TRACE_CLOCK=y
CONFIG_RING_BUFFER=y
CONFIG_EVENT_TRACING=y
CONFIG_CONTEXT_SWITCH_TRACER=y
CONFIG_PREEMPTIRQ_TRACEPOINTS=y
CONFIG_TRACING=y
CONFIG_GENERIC_TRACER=y
CONFIG_TRACING_SUPPORT=y
CONFIG_FTRACE=y
# CONFIG_BOOTTIME_TRACING is not set
CONFIG_FUNCTION_TRACER=y
# CONFIG_FUNCTION_GRAPH_TRACER is not set
CONFIG_DYNAMIC_FTRACE=y
CONFIG_DYNAMIC_FTRACE_WITH_REGS=y
CONFIG_DYNAMIC_FTRACE_WITH_DIRECT_CALLS=y
CONFIG_FUNCTION_PROFILER=y
CONFIG_STACK_TRACER=y
# CONFIG_IRQSOFF_TRACER is not set
# CONFIG_SCHED_TRACER is not set
# CONFIG_HWLAT_TRACER is not set
# CONFIG_FTRACE_SYSCALLS is not set
# CONFIG_TRACER_SNAPSHOT is not set
CONFIG_TRACE_BRANCH_PROFILING=y
# CONFIG_BRANCH_PROFILE_NONE is not set
# CONFIG_PROFILE_ANNOTATED_BRANCHES is not set
CONFIG_PROFILE_ALL_BRANCHES=y
CONFIG_TRACING_BRANCHES=y
CONFIG_BRANCH_TRACER=y
CONFIG_KPROBE_EVENTS=y
CONFIG_KPROBE_EVENTS_ON_NOTRACE=y
# CONFIG_UPROBE_EVENTS is not set
CONFIG_BPF_EVENTS=y
CONFIG_DYNAMIC_EVENTS=y
CONFIG_PROBE_EVENTS=y
# CONFIG_BPF_KPROBE_OVERRIDE is not set
CONFIG_FTRACE_MCOUNT_RECORD=y
CONFIG_TRACING_MAP=y
CONFIG_SYNTH_EVENTS=y
CONFIG_HIST_TRIGGERS=y
# CONFIG_TRACE_EVENT_INJECT is not set
# CONFIG_TRACEPOINT_BENCHMARK is not set
CONFIG_RING_BUFFER_BENCHMARK=m
# CONFIG_TRACE_EVAL_MAP_FILE is not set
CONFIG_GCOV_PROFILE_FTRACE=y
CONFIG_FTRACE_SELFTEST=y
CONFIG_FTRACE_STARTUP_TEST=y
# CONFIG_EVENT_TRACE_STARTUP_TEST is not set
# CONFIG_RING_BUFFER_STARTUP_TEST is not set
CONFIG_PREEMPTIRQ_DELAY_TEST=m
CONFIG_SYNTH_EVENT_GEN_TEST=y
# CONFIG_KPROBE_EVENT_GEN_TEST is not set
# CONFIG_HIST_TRIGGERS_DEBUG is not set
CONFIG_SAMPLES=y
# CONFIG_SAMPLE_TRACE_EVENTS is not set
CONFIG_SAMPLE_TRACE_PRINTK=m
CONFIG_SAMPLE_TRACE_ARRAY=m
CONFIG_SAMPLE_KOBJECT=y
# CONFIG_SAMPLE_KPROBES is not set
CONFIG_SAMPLE_HW_BREAKPOINT=m
CONFIG_SAMPLE_KFIFO=m
CONFIG_SAMPLE_RPMSG_CLIENT=m
CONFIG_SAMPLE_VFIO_MDEV_MTTY=m
CONFIG_SAMPLE_VFIO_MDEV_MDPY=m
CONFIG_SAMPLE_VFIO_MDEV_MDPY_FB=m
CONFIG_SAMPLE_VFIO_MDEV_MBOCHS=m
CONFIG_ARCH_HAS_DEVMEM_IS_ALLOWED=y

#
# x86 Debugging
#
CONFIG_DEBUG_AID_FOR_SYZBOT=y
CONFIG_TRACE_IRQFLAGS_SUPPORT=y
CONFIG_X86_VERBOSE_BOOTUP=y
# CONFIG_EARLY_PRINTK is not set
# CONFIG_DEBUG_TLBFLUSH is not set
CONFIG_HAVE_MMIOTRACE_SUPPORT=y
# CONFIG_IO_DELAY_0X80 is not set
# CONFIG_IO_DELAY_0XED is not set
# CONFIG_IO_DELAY_UDELAY is not set
CONFIG_IO_DELAY_NONE=y
CONFIG_DEBUG_BOOT_PARAMS=y
CONFIG_CPA_DEBUG=y
CONFIG_DEBUG_ENTRY=y
CONFIG_DEBUG_NMI_SELFTEST=y
CONFIG_X86_DEBUG_FPU=y
CONFIG_UNWINDER_FRAME_POINTER=y
# end of x86 Debugging

#
# Kernel Testing and Coverage
#
CONFIG_KUNIT=y
CONFIG_KUNIT_DEBUGFS=y
CONFIG_KUNIT_TEST=y
CONFIG_KUNIT_EXAMPLE_TEST=y
# CONFIG_KUNIT_ALL_TESTS is not set
CONFIG_NOTIFIER_ERROR_INJECTION=y
CONFIG_PM_NOTIFIER_ERROR_INJECT=m
CONFIG_OF_RECONFIG_NOTIFIER_ERROR_INJECT=m
CONFIG_NETDEV_NOTIFIER_ERROR_INJECT=m
CONFIG_FUNCTION_ERROR_INJECTION=y
# CONFIG_FAULT_INJECTION is not set
CONFIG_CC_HAS_SANCOV_TRACE_PC=y
# CONFIG_RUNTIME_TESTING_MENU is not set
# CONFIG_MEMTEST is not set
# end of Kernel Testing and Coverage
# end of Kernel hacking

CONFIG_WARN_MISSING_DOCUMENTS=y

^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-20-19-06 uploaded (net/ipv6/ip6_vti.o)
  2020-07-21  6:09   ` mmotm 2020-07-20-19-06 uploaded (net/ipv6/ip6_vti.o) Randy Dunlap
@ 2020-07-21  6:14     ` Steffen Klassert
  2020-07-21  6:54     ` Stephen Rothwell
  1 sibling, 0 replies; 203+ messages in thread
From: Steffen Klassert @ 2020-07-21  6:14 UTC (permalink / raw)
  To: Randy Dunlap
  Cc: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, sfr, netdev, Alexey Kuznetsov,
	Hideaki YOSHIFUJI, David Miller

On Mon, Jul 20, 2020 at 11:09:34PM -0700, Randy Dunlap wrote:
> On 7/20/20 7:07 PM, Andrew Morton wrote:
> > The mm-of-the-moment snapshot 2020-07-20-19-06 has been uploaded to
> > 
> >    http://www.ozlabs.org/~akpm/mmotm/
> > 
> > mmotm-readme.txt says
> > 
> > README for mm-of-the-moment:
> > 
> > http://www.ozlabs.org/~akpm/mmotm/
> > 
> > This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
> > more than once a week.
> > 
> > You will need quilt to apply these patches to the latest Linus release (5.x
> > or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
> > http://ozlabs.org/~akpm/mmotm/series
> > 
> 
> 
> on i386:
> 
> ld: net/ipv6/ip6_vti.o: in function `vti6_rcv_tunnel':
> ip6_vti.c:(.text+0x2d11): undefined reference to `xfrm6_tunnel_spi_lookup'

Thanks for the report!

I've applied a fix to ipsec-next just a minute ago.


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-20-19-06 uploaded (net/ipv6/ip6_vti.o)
  2020-07-21  6:09   ` mmotm 2020-07-20-19-06 uploaded (net/ipv6/ip6_vti.o) Randy Dunlap
  2020-07-21  6:14     ` Steffen Klassert
@ 2020-07-21  6:54     ` Stephen Rothwell
  2020-07-21  6:55       ` Stephen Rothwell
  1 sibling, 1 reply; 203+ messages in thread
From: Stephen Rothwell @ 2020-07-21  6:54 UTC (permalink / raw)
  To: Randy Dunlap
  Cc: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, netdev, Alexey Kuznetsov,
	Hideaki YOSHIFUJI, David Miller, Xin Long, Steffen Klassert

[-- Attachment #1: Type: text/plain, Size: 449 bytes --]

Hi all,

On Mon, 20 Jul 2020 23:09:34 -0700 Randy Dunlap <rdunlap@infradead.org> wrote:
>
> on i386:
> 
> ld: net/ipv6/ip6_vti.o: in function `vti6_rcv_tunnel':
> ip6_vti.c:(.text+0x2d11): undefined reference to `xfrm6_tunnel_spi_lookup'

Caused by commit

  08622869ed3f ("ip6_vti: support IP6IP6 tunnel processing with .cb_handler")

from the linux-next ipsec-next tree.

CONFIG_INET6_XFRM_TUNNEL=m
-- 
Cheers,
Stephen Rothwell

[-- Attachment #2: OpenPGP digital signature --]
[-- Type: application/pgp-signature, Size: 488 bytes --]

^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: mmotm 2020-07-20-19-06 uploaded (net/ipv6/ip6_vti.o)
  2020-07-21  6:54     ` Stephen Rothwell
@ 2020-07-21  6:55       ` Stephen Rothwell
  0 siblings, 0 replies; 203+ messages in thread
From: Stephen Rothwell @ 2020-07-21  6:55 UTC (permalink / raw)
  To: Randy Dunlap
  Cc: Andrew Morton, broonie, linux-fsdevel, linux-kernel, linux-mm,
	linux-next, mhocko, mm-commits, netdev, Alexey Kuznetsov,
	Hideaki YOSHIFUJI, David Miller, Xin Long, Steffen Klassert

[-- Attachment #1: Type: text/plain, Size: 607 bytes --]

Hi all,

On Tue, 21 Jul 2020 16:54:24 +1000 Stephen Rothwell <sfr@canb.auug.org.au> wrote:
>
> On Mon, 20 Jul 2020 23:09:34 -0700 Randy Dunlap <rdunlap@infradead.org> wrote:
> >
> > on i386:
> > 
> > ld: net/ipv6/ip6_vti.o: in function `vti6_rcv_tunnel':
> > ip6_vti.c:(.text+0x2d11): undefined reference to `xfrm6_tunnel_spi_lookup'  
> 
> Caused by commit
> 
>   08622869ed3f ("ip6_vti: support IP6IP6 tunnel processing with .cb_handler")
> 
> from the linux-next ipsec-next tree.
> 
> CONFIG_INET6_XFRM_TUNNEL=m

I need to read ahead in my email :-)

-- 
Cheers,
Stephen Rothwell

[-- Attachment #2: OpenPGP digital signature --]
[-- Type: application/pgp-signature, Size: 488 bytes --]

^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-09-10 17:11 ` incoming Kees Cook
@ 2021-09-10 20:13   ` Kees Cook
  0 siblings, 0 replies; 203+ messages in thread
From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw)
  To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits

On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote:
> On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> > 
> > More post linux-next material.
> > 
> > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> > 
> > Subsystems affected by this patch series:
> > 
> >   mm/slab-generic
> >   rapidio
> >   mm/debug
> > 
> > Subsystem: mm/slab-generic
> > 
> >     "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> >       mm: move kvmalloc-related functions to slab.h
> > 
> > Subsystem: rapidio
> > 
> >     Kees Cook <keescook@chromium.org>:
> >       rapidio: avoid bogus __alloc_size warning
> > 
> > Subsystem: mm/debug
> > 
> >     Kees Cook <keescook@chromium.org>:
> >     Patch series "Add __alloc_size() for better bounds checking", v2:
> >       Compiler Attributes: add __alloc_size() for better bounds checking
> >       checkpatch: add __alloc_size() to known $Attribute
> >       slab: clean up function declarations
> >       slab: add __alloc_size attributes for better bounds checking
> >       mm/page_alloc: add __alloc_size attributes for better bounds checking
> >       percpu: add __alloc_size attributes for better bounds checking
> >       mm/vmalloc: add __alloc_size attributes for better bounds checking
> 
> Hi,
> 
> FYI, in overnight build testing I found yet another corner case in
> GCC's handling of the __alloc_size attribute. It's the gift that keeps
> on giving. The fix is here:
> 
> https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/

I'm so glad it's Friday. Here's the v2 fix... *sigh*

https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/

-Kees

> 
> > 
> >  Makefile                                 |   15 +++
> >  drivers/of/kexec.c                       |    1 
> >  drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
> >  include/linux/compiler_attributes.h      |    6 +
> >  include/linux/gfp.h                      |    2 
> >  include/linux/mm.h                       |   34 --------
> >  include/linux/percpu.h                   |    3 
> >  include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
> >  include/linux/vmalloc.h                  |   11 ++
> >  scripts/checkpatch.pl                    |    3 
> >  10 files changed, 132 insertions(+), 74 deletions(-)
> > 
> 
> -- 
> Kees Cook

-- 
Kees Cook


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-09-10  3:09 incoming Andrew Morton
@ 2021-09-10 17:11 ` Kees Cook
  2021-09-10 20:13   ` incoming Kees Cook
  0 siblings, 1 reply; 203+ messages in thread
From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw)
  To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits

On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> 
> More post linux-next material.
> 
> 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> 
> Subsystems affected by this patch series:
> 
>   mm/slab-generic
>   rapidio
>   mm/debug
> 
> Subsystem: mm/slab-generic
> 
>     "Matthew Wilcox (Oracle)" <willy@infradead.org>:
>       mm: move kvmalloc-related functions to slab.h
> 
> Subsystem: rapidio
> 
>     Kees Cook <keescook@chromium.org>:
>       rapidio: avoid bogus __alloc_size warning
> 
> Subsystem: mm/debug
> 
>     Kees Cook <keescook@chromium.org>:
>     Patch series "Add __alloc_size() for better bounds checking", v2:
>       Compiler Attributes: add __alloc_size() for better bounds checking
>       checkpatch: add __alloc_size() to known $Attribute
>       slab: clean up function declarations
>       slab: add __alloc_size attributes for better bounds checking
>       mm/page_alloc: add __alloc_size attributes for better bounds checking
>       percpu: add __alloc_size attributes for better bounds checking
>       mm/vmalloc: add __alloc_size attributes for better bounds checking

Hi,

FYI, in overnight build testing I found yet another corner case in
GCC's handling of the __alloc_size attribute. It's the gift that keeps
on giving. The fix is here:

https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/

> 
>  Makefile                                 |   15 +++
>  drivers/of/kexec.c                       |    1 
>  drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
>  include/linux/compiler_attributes.h      |    6 +
>  include/linux/gfp.h                      |    2 
>  include/linux/mm.h                       |   34 --------
>  include/linux/percpu.h                   |    3 
>  include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
>  include/linux/vmalloc.h                  |   11 ++
>  scripts/checkpatch.pl                    |    3 
>  10 files changed, 132 insertions(+), 74 deletions(-)
> 

-- 
Kees Cook


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-09-10  3:09 Andrew Morton
  2021-09-10 17:11 ` incoming Kees Cook
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-09-10  3:09 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


More post linux-next material.

9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.

Subsystems affected by this patch series:

  mm/slab-generic
  rapidio
  mm/debug

Subsystem: mm/slab-generic

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move kvmalloc-related functions to slab.h

Subsystem: rapidio

    Kees Cook <keescook@chromium.org>:
      rapidio: avoid bogus __alloc_size warning

Subsystem: mm/debug

    Kees Cook <keescook@chromium.org>:
    Patch series "Add __alloc_size() for better bounds checking", v2:
      Compiler Attributes: add __alloc_size() for better bounds checking
      checkpatch: add __alloc_size() to known $Attribute
      slab: clean up function declarations
      slab: add __alloc_size attributes for better bounds checking
      mm/page_alloc: add __alloc_size attributes for better bounds checking
      percpu: add __alloc_size attributes for better bounds checking
      mm/vmalloc: add __alloc_size attributes for better bounds checking

 Makefile                                 |   15 +++
 drivers/of/kexec.c                       |    1 
 drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
 include/linux/compiler_attributes.h      |    6 +
 include/linux/gfp.h                      |    2 
 include/linux/mm.h                       |   34 --------
 include/linux/percpu.h                   |    3 
 include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
 include/linux/vmalloc.h                  |   11 ++
 scripts/checkpatch.pl                    |    3 
 10 files changed, 132 insertions(+), 74 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-09-09  1:08 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-09-09  1:08 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


A bunch of hotfixes, mostly cc:stable.


8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.

Subsystems affected by this patch series:

  mm/hmm
  mm/hugetlb
  mm/vmscan
  mm/pagealloc
  mm/pagemap
  mm/kmemleak
  mm/mempolicy
  mm/memblock

Subsystem: mm/hmm

    Li Zhijian <lizhijian@cn.fujitsu.com>:
      mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled

Subsystem: mm/hugetlb

    Liu Zixian <liuzixian4@huawei.com>:
      mm/hugetlb: initialize hugetlb_usage in mm_init

Subsystem: mm/vmscan

    Rik van Riel <riel@surriel.com>:
      mm,vmscan: fix divide by zero in get_scan_count

Subsystem: mm/pagealloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype

Subsystem: mm/pagemap

    Liam Howlett <liam.howlett@oracle.com>:
      mmap_lock: change trace and locking order

Subsystem: mm/kmemleak

    Naohiro Aota <naohiro.aota@wdc.com>:
      mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp

Subsystem: mm/mempolicy

    yanghui <yanghui.def@bytedance.com>:
      mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      nds32/setup: remove unused memblock_region variable in setup_memory()

 arch/nds32/kernel/setup.c |    1 -
 include/linux/hugetlb.h   |    9 +++++++++
 include/linux/mmap_lock.h |    8 ++++----
 kernel/fork.c             |    1 +
 mm/hmm.c                  |    5 ++++-
 mm/kmemleak.c             |    3 ++-
 mm/mempolicy.c            |   17 +++++++++++++----
 mm/page_alloc.c           |    4 +++-
 mm/vmscan.c               |    2 +-
 9 files changed, 37 insertions(+), 13 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-09-08 22:17 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


This is the post-linux-next material, so it is based upon latest
upstream to catch the now-merged dependencies.

10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.

Subsystems affected by this patch series:

  mm/vmstat
  mm/migration
  compat

Subsystem: mm/vmstat

    Ingo Molnar <mingo@elte.hu>:
      mm/vmstat: protect per cpu variables with preempt disable on RT

Subsystem: mm/migration

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: migrate: introduce a local variable to get the number of pages
      mm: migrate: fix the incorrect function name in comments
      mm: migrate: change to use bool type for 'page_was_mapped'

Subsystem: compat

    Arnd Bergmann <arnd@arndb.de>:
    Patch series "compat: remove compat_alloc_user_space", v5:
      kexec: move locking into do_kexec_load
      kexec: avoid compat_alloc_user_space
      mm: simplify compat_sys_move_pages
      mm: simplify compat numa syscalls
      compat: remove some compat entry points
      arch: remove compat_alloc_user_space

 arch/arm64/include/asm/compat.h           |    5 
 arch/arm64/include/asm/uaccess.h          |   11 -
 arch/arm64/include/asm/unistd32.h         |   10 -
 arch/arm64/lib/Makefile                   |    2 
 arch/arm64/lib/copy_in_user.S             |   77 ----------
 arch/mips/cavium-octeon/octeon-memcpy.S   |    2 
 arch/mips/include/asm/compat.h            |    8 -
 arch/mips/include/asm/uaccess.h           |   26 ---
 arch/mips/kernel/syscalls/syscall_n32.tbl |   10 -
 arch/mips/kernel/syscalls/syscall_o32.tbl |   10 -
 arch/mips/lib/memcpy.S                    |   11 -
 arch/parisc/include/asm/compat.h          |    6 
 arch/parisc/include/asm/uaccess.h         |    2 
 arch/parisc/kernel/syscalls/syscall.tbl   |    8 -
 arch/parisc/lib/memcpy.c                  |    9 -
 arch/powerpc/include/asm/compat.h         |   16 --
 arch/powerpc/kernel/syscalls/syscall.tbl  |   10 -
 arch/s390/include/asm/compat.h            |   10 -
 arch/s390/include/asm/uaccess.h           |    3 
 arch/s390/kernel/syscalls/syscall.tbl     |   10 -
 arch/s390/lib/uaccess.c                   |   63 --------
 arch/sparc/include/asm/compat.h           |   19 --
 arch/sparc/kernel/process_64.c            |    2 
 arch/sparc/kernel/signal32.c              |   12 -
 arch/sparc/kernel/signal_64.c             |    8 -
 arch/sparc/kernel/syscalls/syscall.tbl    |   10 -
 arch/x86/entry/syscalls/syscall_32.tbl    |    4 
 arch/x86/entry/syscalls/syscall_64.tbl    |    2 
 arch/x86/include/asm/compat.h             |   13 -
 arch/x86/include/asm/uaccess_64.h         |    7 
 include/linux/compat.h                    |   39 +----
 include/linux/uaccess.h                   |   10 -
 include/uapi/asm-generic/unistd.h         |   10 -
 kernel/compat.c                           |   21 --
 kernel/kexec.c                            |  105 +++++---------
 kernel/sys_ni.c                           |    5 
 mm/mempolicy.c                            |  213 +++++++-----------------------
 mm/migrate.c                              |   69 +++++----
 mm/vmstat.c                               |   48 ++++++
 39 files changed, 243 insertions(+), 663 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-09-08  2:52 incoming Andrew Morton
@ 2021-09-08  8:57 ` Vlastimil Babka
  0 siblings, 0 replies; 203+ messages in thread
From: Vlastimil Babka @ 2021-09-08  8:57 UTC (permalink / raw)
  To: Andrew Morton, Linus Torvalds
  Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman

On 9/8/21 04:52, Andrew Morton wrote:
> Subsystem: mm/slub
> 
>     Vlastimil Babka <vbabka@suse.cz>:
>     Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
>       mm, slub: don't call flush_all() from slab_debug_trace_open()
>       mm, slub: allocate private object map for debugfs listings
>       mm, slub: allocate private object map for validate_slab_cache()
>       mm, slub: don't disable irq for debug_check_no_locks_freed()
>       mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
>       mm, slub: extract get_partial() from new_slab_objects()
>       mm, slub: dissolve new_slab_objects() into ___slab_alloc()
>       mm, slub: return slab page from get_partial() and set c->page afterwards
>       mm, slub: restructure new page checks in ___slab_alloc()
>       mm, slub: simplify kmem_cache_cpu and tid setup
>       mm, slub: move disabling/enabling irqs to ___slab_alloc()
>       mm, slub: do initial checks in ___slab_alloc() with irqs enabled
>       mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
>       mm, slub: restore irqs around calling new_slab()
>       mm, slub: validate slab from partial list or page allocator before making it cpu slab
>       mm, slub: check new pages with restored irqs
>       mm, slub: stop disabling irqs around get_partial()
>       mm, slub: move reset of c->page and freelist out of deactivate_slab()
>       mm, slub: make locking in deactivate_slab() irq-safe
>       mm, slub: call deactivate_slab() without disabling irqs
>       mm, slub: move irq control into unfreeze_partials()
>       mm, slub: discard slabs in unfreeze_partials() without irqs disabled
>       mm, slub: detach whole partial list at once in unfreeze_partials()
>       mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
>       mm, slub: only disable irq with spin_lock in __unfreeze_partials()
>       mm, slub: don't disable irqs in slub_cpu_dead()
>       mm, slab: split out the cpu offline variant of flush_slab()
> 
>     Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
>       mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
>       mm: slub: make object_map_lock a raw_spinlock_t
> 
>     Vlastimil Babka <vbabka@suse.cz>:
>       mm, slub: make slab_lock() disable irqs with PREEMPT_RT
>       mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
>       mm, slub: use migrate_disable() on PREEMPT_RT
>       mm, slub: convert kmem_cpu_slab protection to local_lock

For my own piece of mind, I've checked that this part (patches 1 to 33)
are identical to the v6 posting [1] and git version [2] that Mel and
Mike tested (replies to [1]).

[1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/
[2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git
tags/mm-slub-5.15-rc1


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-09-08  2:52 Andrew Morton
  2021-09-08  8:57 ` incoming Vlastimil Babka
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-09-08  2:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f.

Subsystems affected by this patch series:

  mm/slub
  mm/memory-hotplug
  mm/rmap
  mm/ioremap
  mm/highmem
  mm/cleanups
  mm/secretmem
  mm/kfence
  mm/damon
  alpha
  percpu
  procfs
  misc
  core-kernel
  MAINTAINERS
  lib
  bitops
  checkpatch
  epoll
  init
  nilfs2
  coredump
  fork
  pids
  criu
  kconfig
  selftests
  ipc
  mm/vmscan
  scripts

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
      mm, slub: don't call flush_all() from slab_debug_trace_open()
      mm, slub: allocate private object map for debugfs listings
      mm, slub: allocate private object map for validate_slab_cache()
      mm, slub: don't disable irq for debug_check_no_locks_freed()
      mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
      mm, slub: extract get_partial() from new_slab_objects()
      mm, slub: dissolve new_slab_objects() into ___slab_alloc()
      mm, slub: return slab page from get_partial() and set c->page afterwards
      mm, slub: restructure new page checks in ___slab_alloc()
      mm, slub: simplify kmem_cache_cpu and tid setup
      mm, slub: move disabling/enabling irqs to ___slab_alloc()
      mm, slub: do initial checks in ___slab_alloc() with irqs enabled
      mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
      mm, slub: restore irqs around calling new_slab()
      mm, slub: validate slab from partial list or page allocator before making it cpu slab
      mm, slub: check new pages with restored irqs
      mm, slub: stop disabling irqs around get_partial()
      mm, slub: move reset of c->page and freelist out of deactivate_slab()
      mm, slub: make locking in deactivate_slab() irq-safe
      mm, slub: call deactivate_slab() without disabling irqs
      mm, slub: move irq control into unfreeze_partials()
      mm, slub: discard slabs in unfreeze_partials() without irqs disabled
      mm, slub: detach whole partial list at once in unfreeze_partials()
      mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
      mm, slub: only disable irq with spin_lock in __unfreeze_partials()
      mm, slub: don't disable irqs in slub_cpu_dead()
      mm, slab: split out the cpu offline variant of flush_slab()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
      mm: slub: make object_map_lock a raw_spinlock_t

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: make slab_lock() disable irqs with PREEMPT_RT
      mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
      mm, slub: use migrate_disable() on PREEMPT_RT
      mm, slub: convert kmem_cpu_slab protection to local_lock

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3:
      memory-hotplug.rst: remove locking details from admin-guide
      memory-hotplug.rst: complete admin-guide overhaul

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE":
      mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE
      mm: memory_hotplug: cleanup after removal of pfn_valid_within()

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory":
      mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range()
      mm/memory_hotplug: remove nid parameter from arch_remove_memory()
      mm/memory_hotplug: remove nid parameter from remove_memory() and friends
      ACPI: memhotplug: memory resources cannot be enabled yet
    Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3:
      mm: track present early pages per zone
      mm/memory_hotplug: introduce "auto-movable" online policy
      drivers/base/memory: introduce "memory groups" to logically group memory blocks
      mm/memory_hotplug: track present pages in memory groups
      ACPI: memhotplug: use a single static memory group for a single memory device
      dax/kmem: use a single static memory group for a single probed unit
      virtio-mem: use a single dynamic memory group for a single virtio-mem device
      mm/memory_hotplug: memory group aware "auto-movable" online policy
      mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixups for memory hotplug":
      mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code

Subsystem: mm/rmap

    Muchun Song <songmuchun@bytedance.com>:
      mm: remove redundant compound_head() calling

Subsystem: mm/ioremap

    Christoph Hellwig <hch@lst.de>:
      riscv: only select GENERIC_IOREMAP if MMU support is enabled
    Patch series "small ioremap cleanups":
      mm: move ioremap_page_range to vmalloc.c
      mm: don't allow executable ioremap mappings

    Weizhao Ouyang <o451686892@gmail.com>:
      mm/early_ioremap.c: remove redundant early_ioremap_shutdown()

Subsystem: mm/highmem

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      highmem: don't disable preemption on RT in kmap_atomic()

Subsystem: mm/cleanups

    Changbin Du <changbin.du@gmail.com>:
      mm: in_irq() cleanup

    Muchun Song <songmuchun@bytedance.com>:
      mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1)

Subsystem: mm/secretmem

    Jordy Zomer <jordy@jordyzomer.github.io>:
      mm/secretmem: use refcount_t instead of atomic_t

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: show cpu and timestamp in alloc/free info
      kfence: test: fail fast if disabled at boot

Subsystem: mm/damon

    SeongJae Park <sjpark@amazon.de>:
    Patch series "Introduce Data Access MONitor (DAMON)", v34:
      mm: introduce Data Access MONitor (DAMON)
      mm/damon/core: implement region-based sampling
      mm/damon: adaptively adjust regions
      mm/idle_page_tracking: make PG_idle reusable
      mm/damon: implement primitives for the virtual memory address spaces
      mm/damon: add a tracepoint
      mm/damon: implement a debugfs-based user space interface
      mm/damon/dbgfs: export kdamond pid to the user space
      mm/damon/dbgfs: support multiple contexts
      Documentation: add documents for DAMON
      mm/damon: add kunit tests
      mm/damon: add user space selftests
      MAINTAINERS: update for DAMON

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: agp: make empty macros use do-while-0 style
      alpha: pci-sysfs: fix all kernel-doc warnings

Subsystem: percpu

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      percpu: remove export of pcpu_base_addr

Subsystem: procfs

    Feng Zhou <zhoufeng.zf@bytedance.com>:
      fs/proc/kcore.c: add mmap interface

    Christoph Hellwig <hch@lst.de>:
      proc: stop using seq_get_buf in proc_task_name

    Ohhoon Kwon <ohoono.kwon@samsung.com>:
      connector: send event on write to /proc/[pid]/comm

Subsystem: misc

    Colin Ian King <colin.king@canonical.com>:
      arch: Kconfig: fix spelling mistake "seperate" -> "separate"

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/once.h: fix trivia typo Not -> Note

    Daniel Lezcano <daniel.lezcano@linaro.org>:
    Patch series "Add Hz macros", v3:
      units: change from 'L' to 'UL'
      units: add the HZ macros
      thermal/drivers/devfreq_cooling: use HZ macros
      devfreq: use HZ macros
      iio/drivers/as73211: use HZ macros
      hwmon/drivers/mr75203: use HZ macros
      iio/drivers/hid-sensor: use HZ macros
      i2c/drivers/ov02q10: use HZ macros
      mtd/drivers/nand: use HZ macros
      phy/drivers/stm32: use HZ macros

Subsystem: core-kernel

    Yang Yang <yang.yang29@zte.com.cn>:
      kernel/acct.c: use dedicated helper to access rlimit values

    Pavel Skripkin <paskripkin@gmail.com>:
      profiling: fix shift-out-of-bounds bugs

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS: update ClangBuiltLinux mailing list
      Documentation/llvm: update mailing list
      Documentation/llvm: update IRC location

Subsystem: lib

    Geert Uytterhoeven <geert@linux-m68k.org>:
    Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements":
      math: make RATIONAL tristate
      math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it

    Matteo Croce <mcroce@microsoft.com>:
    Patch series "lib/string: optimized mem* functions", v2:
      lib/string: optimized memcpy
      lib/string: optimized memmove
      lib/string: optimized memset

    Daniel Latypov <dlatypov@google.com>:
      lib/test: convert test_sort.c to use KUnit

    Randy Dunlap <rdunlap@infradead.org>:
      lib/dump_stack: correct kernel-doc notation
      lib/iov_iter.c: fix kernel-doc warnings

Subsystem: bitops

    Yury Norov <yury.norov@gmail.com>:
    Patch series "Resend bitmap patches":
      bitops: protect find_first_{,zero}_bit properly
      bitops: move find_bit_*_le functions from le.h to find.h
      include: move find.h from asm_generic to linux
      arch: remove GENERIC_FIND_FIRST_BIT entirely
      lib: add find_first_and_bit()
      cpumask: use find_first_and_bit()
      all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate
      tools: sync tools/bitmap with mother linux
      cpumask: replace cpumask_next_* with cpumask_first_* where appropriate
      include/linux: move for_each_bit() macros from bitops.h to find.h
      find: micro-optimize for_each_{set,clear}_bit()
      bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      tools: rename bitmap_alloc() to bitmap_zalloc()

    Yury Norov <yury.norov@gmail.com>:
      mm/percpu: micro-optimize pcpu_is_populated()
      bitmap: unify find_bit operations
      lib: bitmap: add performance test for bitmap_print_to_pagebuf
      vsprintf: rework bitmap_list_string

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: support wide strings

    Mimi Zohar <zohar@linux.ibm.com>:
      checkpatch: make email address check case insensitive

    Joe Perches <joe@perches.com>:
      checkpatch: improve GIT_COMMIT_ID test

Subsystem: epoll

    Nicholas Piggin <npiggin@gmail.com>:
      fs/epoll: use a per-cpu counter for user's watches count

Subsystem: init

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      init: move usermodehelper_enable() to populate_rootfs()

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      trap: cleanup trap_init()

Subsystem: nilfs2

    Nanyong Sun <sunnanyong@huawei.com>:
    Patch series "nilfs2: fix incorrect usage of kobject":
      nilfs2: fix memory leak in nilfs_sysfs_create_device_group
      nilfs2: fix NULL pointer in nilfs_##name##_attr_release
      nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group
      nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group
      nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group
      nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group

    Zhen Lei <thunder.leizhen@huawei.com>:
      nilfs2: use refcount_dec_and_lock() to fix potential UAF

Subsystem: coredump

    David Oberhollenzer <david.oberhollenzer@sigma-star.at>:
      fs/coredump.c: log if a core dump is aborted due to changed file permissions

    QiuXi <qiuxi1@huawei.com>:
      coredump: fix memleak in dump_vma_snapshot()

Subsystem: fork

    Christoph Hellwig <hch@lst.de>:
      kernel/fork.c: unexport get_{mm,task}_exe_file

Subsystem: pids

    Takahiro Itazuri <itazur@amazon.com>:
      pid: cleanup the stale comment mentioning pidmap_init().

Subsystem: criu

    Cyrill Gorcunov <gorcunov@gmail.com>:
      prctl: allow to setup brk for et_dyn executables

Subsystem: kconfig

    Zenghui Yu <yuzenghui@huawei.com>:
      configs: remove the obsolete CONFIG_INPUT_POLLDEV

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH

Subsystem: selftests

    Greg Thelen <gthelen@google.com>:
      selftests/memfd: remove unused variable

Subsystem: ipc

    Rafael Aquini <aquini@redhat.com>:
      ipc: replace costly bailout check in sysvipc_find_ipc()

Subsystem: mm/vmscan

    Randy Dunlap <rdunlap@infradead.org>:
      mm/workingset: correct kernel-doc notations

Subsystem: scripts

    Randy Dunlap <rdunlap@infradead.org>:
      scripts: check_extable: fix typo in user error message

 a/Documentation/admin-guide/mm/damon/index.rst            |   15 
 a/Documentation/admin-guide/mm/damon/start.rst            |  114 +
 a/Documentation/admin-guide/mm/damon/usage.rst            |  112 +
 a/Documentation/admin-guide/mm/index.rst                  |    1 
 a/Documentation/admin-guide/mm/memory-hotplug.rst         |  842 ++++++-----
 a/Documentation/dev-tools/kfence.rst                      |   98 -
 a/Documentation/kbuild/llvm.rst                           |    5 
 a/Documentation/vm/damon/api.rst                          |   20 
 a/Documentation/vm/damon/design.rst                       |  166 ++
 a/Documentation/vm/damon/faq.rst                          |   51 
 a/Documentation/vm/damon/index.rst                        |   30 
 a/Documentation/vm/index.rst                              |    1 
 a/MAINTAINERS                                             |   17 
 a/arch/Kconfig                                            |    2 
 a/arch/alpha/include/asm/agp.h                            |    4 
 a/arch/alpha/include/asm/bitops.h                         |    2 
 a/arch/alpha/kernel/pci-sysfs.c                           |   12 
 a/arch/arc/Kconfig                                        |    1 
 a/arch/arc/include/asm/bitops.h                           |    1 
 a/arch/arc/kernel/traps.c                                 |    5 
 a/arch/arm/configs/dove_defconfig                         |    1 
 a/arch/arm/configs/pxa_defconfig                          |    1 
 a/arch/arm/include/asm/bitops.h                           |    1 
 a/arch/arm/kernel/traps.c                                 |    5 
 a/arch/arm64/Kconfig                                      |    1 
 a/arch/arm64/include/asm/bitops.h                         |    1 
 a/arch/arm64/mm/mmu.c                                     |    3 
 a/arch/csky/include/asm/bitops.h                          |    1 
 a/arch/h8300/include/asm/bitops.h                         |    1 
 a/arch/h8300/kernel/traps.c                               |    4 
 a/arch/hexagon/include/asm/bitops.h                       |    1 
 a/arch/hexagon/kernel/traps.c                             |    4 
 a/arch/ia64/include/asm/bitops.h                          |    2 
 a/arch/ia64/mm/init.c                                     |    3 
 a/arch/m68k/include/asm/bitops.h                          |    2 
 a/arch/mips/Kconfig                                       |    1 
 a/arch/mips/configs/lemote2f_defconfig                    |    1 
 a/arch/mips/configs/pic32mzda_defconfig                   |    1 
 a/arch/mips/configs/rt305x_defconfig                      |    1 
 a/arch/mips/configs/xway_defconfig                        |    1 
 a/arch/mips/include/asm/bitops.h                          |    1 
 a/arch/nds32/kernel/traps.c                               |    5 
 a/arch/nios2/kernel/traps.c                               |    5 
 a/arch/openrisc/include/asm/bitops.h                      |    1 
 a/arch/openrisc/kernel/traps.c                            |    5 
 a/arch/parisc/configs/generic-32bit_defconfig             |    1 
 a/arch/parisc/include/asm/bitops.h                        |    2 
 a/arch/parisc/kernel/traps.c                              |    4 
 a/arch/powerpc/include/asm/bitops.h                       |    2 
 a/arch/powerpc/include/asm/cputhreads.h                   |    2 
 a/arch/powerpc/kernel/traps.c                             |    5 
 a/arch/powerpc/mm/mem.c                                   |    3 
 a/arch/powerpc/platforms/pasemi/dma_lib.c                 |    4 
 a/arch/powerpc/platforms/pseries/hotplug-memory.c         |    9 
 a/arch/riscv/Kconfig                                      |    2 
 a/arch/riscv/include/asm/bitops.h                         |    1 
 a/arch/riscv/kernel/traps.c                               |    5 
 a/arch/s390/Kconfig                                       |    1 
 a/arch/s390/include/asm/bitops.h                          |    1 
 a/arch/s390/kvm/kvm-s390.c                                |    2 
 a/arch/s390/mm/init.c                                     |    3 
 a/arch/sh/include/asm/bitops.h                            |    1 
 a/arch/sh/mm/init.c                                       |    3 
 a/arch/sparc/include/asm/bitops_32.h                      |    1 
 a/arch/sparc/include/asm/bitops_64.h                      |    2 
 a/arch/um/kernel/trap.c                                   |    4 
 a/arch/x86/Kconfig                                        |    1 
 a/arch/x86/configs/i386_defconfig                         |    1 
 a/arch/x86/configs/x86_64_defconfig                       |    1 
 a/arch/x86/include/asm/bitops.h                           |    2 
 a/arch/x86/kernel/apic/vector.c                           |    4 
 a/arch/x86/mm/init_32.c                                   |    3 
 a/arch/x86/mm/init_64.c                                   |    3 
 a/arch/x86/um/Kconfig                                     |    1 
 a/arch/xtensa/include/asm/bitops.h                        |    1 
 a/block/blk-mq.c                                          |    2 
 a/drivers/acpi/acpi_memhotplug.c                          |   46 
 a/drivers/base/memory.c                                   |  231 ++-
 a/drivers/base/node.c                                     |    2 
 a/drivers/block/rnbd/rnbd-clt.c                           |    2 
 a/drivers/dax/kmem.c                                      |   43 
 a/drivers/devfreq/devfreq.c                               |    2 
 a/drivers/dma/ti/edma.c                                   |    2 
 a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c                   |    4 
 a/drivers/hwmon/ltc2992.c                                 |    3 
 a/drivers/hwmon/mr75203.c                                 |    2 
 a/drivers/iio/adc/ad7124.c                                |    2 
 a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c  |    3 
 a/drivers/iio/light/as73211.c                             |    3 
 a/drivers/infiniband/hw/irdma/hw.c                        |   16 
 a/drivers/media/cec/core/cec-core.c                       |    2 
 a/drivers/media/i2c/ov02a10.c                             |    2 
 a/drivers/media/mc/mc-devnode.c                           |    2 
 a/drivers/mmc/host/renesas_sdhi_core.c                    |    2 
 a/drivers/mtd/nand/raw/intel-nand-controller.c            |    2 
 a/drivers/net/virtio_net.c                                |    2 
 a/drivers/pci/controller/dwc/pci-dra7xx.c                 |    2 
 a/drivers/phy/st/phy-stm32-usbphyc.c                      |    2 
 a/drivers/scsi/lpfc/lpfc_sli.c                            |   10 
 a/drivers/soc/fsl/qbman/bman_portal.c                     |    2 
 a/drivers/soc/fsl/qbman/qman_portal.c                     |    2 
 a/drivers/soc/ti/k3-ringacc.c                             |    4 
 a/drivers/thermal/devfreq_cooling.c                       |    2 
 a/drivers/tty/n_tty.c                                     |    2 
 a/drivers/virt/acrn/ioreq.c                               |    3 
 a/drivers/virtio/virtio_mem.c                             |   26 
 a/fs/coredump.c                                           |   15 
 a/fs/eventpoll.c                                          |   18 
 a/fs/f2fs/segment.c                                       |    8 
 a/fs/nilfs2/sysfs.c                                       |   26 
 a/fs/nilfs2/the_nilfs.c                                   |    9 
 a/fs/ocfs2/cluster/heartbeat.c                            |    2 
 a/fs/ocfs2/dlm/dlmdomain.c                                |    4 
 a/fs/ocfs2/dlm/dlmmaster.c                                |   18 
 a/fs/ocfs2/dlm/dlmrecovery.c                              |    2 
 a/fs/ocfs2/dlm/dlmthread.c                                |    2 
 a/fs/proc/array.c                                         |   18 
 a/fs/proc/base.c                                          |    5 
 a/fs/proc/kcore.c                                         |   73 
 a/include/asm-generic/bitops.h                            |    1 
 a/include/asm-generic/bitops/find.h                       |  198 --
 a/include/asm-generic/bitops/le.h                         |   64 
 a/include/asm-generic/early_ioremap.h                     |    6 
 a/include/linux/bitmap.h                                  |   34 
 a/include/linux/bitops.h                                  |   34 
 a/include/linux/cpumask.h                                 |   46 
 a/include/linux/damon.h                                   |  290 +++
 a/include/linux/find.h                                    |  134 +
 a/include/linux/highmem-internal.h                        |   27 
 a/include/linux/memory.h                                  |   55 
 a/include/linux/memory_hotplug.h                          |   40 
 a/include/linux/mmzone.h                                  |   19 
 a/include/linux/once.h                                    |    2 
 a/include/linux/page-flags.h                              |   17 
 a/include/linux/page_ext.h                                |    2 
 a/include/linux/page_idle.h                               |    6 
 a/include/linux/pagemap.h                                 |    7 
 a/include/linux/sched/user.h                              |    3 
 a/include/linux/slub_def.h                                |    6 
 a/include/linux/threads.h                                 |    2 
 a/include/linux/units.h                                   |   10 
 a/include/linux/vmalloc.h                                 |    3 
 a/include/trace/events/damon.h                            |   43 
 a/include/trace/events/mmflags.h                          |    2 
 a/include/trace/events/page_ref.h                         |    4 
 a/init/initramfs.c                                        |    2 
 a/init/main.c                                             |    3 
 a/init/noinitramfs.c                                      |    2 
 a/ipc/util.c                                              |   16 
 a/kernel/acct.c                                           |    2 
 a/kernel/fork.c                                           |    2 
 a/kernel/profile.c                                        |   21 
 a/kernel/sys.c                                            |    7 
 a/kernel/time/clocksource.c                               |    4 
 a/kernel/user.c                                           |   25 
 a/lib/Kconfig                                             |    3 
 a/lib/Kconfig.debug                                       |    9 
 a/lib/dump_stack.c                                        |    3 
 a/lib/find_bit.c                                          |   21 
 a/lib/find_bit_benchmark.c                                |   21 
 a/lib/genalloc.c                                          |    2 
 a/lib/iov_iter.c                                          |    8 
 a/lib/math/Kconfig                                        |    2 
 a/lib/math/rational.c                                     |    3 
 a/lib/string.c                                            |  130 +
 a/lib/test_bitmap.c                                       |   37 
 a/lib/test_printf.c                                       |    2 
 a/lib/test_sort.c                                         |   40 
 a/lib/vsprintf.c                                          |   26 
 a/mm/Kconfig                                              |   15 
 a/mm/Makefile                                             |    4 
 a/mm/compaction.c                                         |   20 
 a/mm/damon/Kconfig                                        |   68 
 a/mm/damon/Makefile                                       |    5 
 a/mm/damon/core-test.h                                    |  253 +++
 a/mm/damon/core.c                                         |  748 ++++++++++
 a/mm/damon/dbgfs-test.h                                   |  126 +
 a/mm/damon/dbgfs.c                                        |  631 ++++++++
 a/mm/damon/vaddr-test.h                                   |  329 ++++
 a/mm/damon/vaddr.c                                        |  672 +++++++++
 a/mm/early_ioremap.c                                      |    5 
 a/mm/highmem.c                                            |    2 
 a/mm/ioremap.c                                            |   25 
 a/mm/kfence/core.c                                        |    3 
 a/mm/kfence/kfence.h                                      |    2 
 a/mm/kfence/kfence_test.c                                 |    3 
 a/mm/kfence/report.c                                      |   19 
 a/mm/kmemleak.c                                           |    2 
 a/mm/memory_hotplug.c                                     |  396 ++++-
 a/mm/memremap.c                                           |    5 
 a/mm/page_alloc.c                                         |   27 
 a/mm/page_ext.c                                           |   12 
 a/mm/page_idle.c                                          |   10 
 a/mm/page_isolation.c                                     |    7 
 a/mm/page_owner.c                                         |   14 
 a/mm/percpu.c                                             |   36 
 a/mm/rmap.c                                               |    6 
 a/mm/secretmem.c                                          |    9 
 a/mm/slab_common.c                                        |    2 
 a/mm/slub.c                                               | 1023 +++++++++-----
 a/mm/vmalloc.c                                            |   24 
 a/mm/workingset.c                                         |    2 
 a/net/ncsi/ncsi-manage.c                                  |    4 
 a/scripts/check_extable.sh                                |    2 
 a/scripts/checkpatch.pl                                   |   93 -
 a/tools/include/linux/bitmap.h                            |    4 
 a/tools/perf/bench/find-bit-bench.c                       |    2 
 a/tools/perf/builtin-c2c.c                                |    6 
 a/tools/perf/builtin-record.c                             |    2 
 a/tools/perf/tests/bitmap.c                               |    2 
 a/tools/perf/tests/mem2node.c                             |    2 
 a/tools/perf/util/affinity.c                              |    4 
 a/tools/perf/util/header.c                                |    4 
 a/tools/perf/util/metricgroup.c                           |    2 
 a/tools/perf/util/mmap.c                                  |    4 
 a/tools/testing/selftests/damon/Makefile                  |    7 
 a/tools/testing/selftests/damon/_chk_dependency.sh        |   28 
 a/tools/testing/selftests/damon/debugfs_attrs.sh          |   75 +
 a/tools/testing/selftests/kvm/dirty_log_perf_test.c       |    2 
 a/tools/testing/selftests/kvm/dirty_log_test.c            |    4 
 a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c |    2 
 a/tools/testing/selftests/memfd/memfd_test.c              |    2 
 b/MAINTAINERS                                             |    2 
 b/tools/include/asm-generic/bitops.h                      |    1 
 b/tools/include/linux/bitmap.h                            |    7 
 b/tools/include/linux/find.h                              |   81 +
 b/tools/lib/find_bit.c                                    |   20 
 227 files changed, 6695 insertions(+), 1875 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-09-02 21:48 incoming Andrew Morton
@ 2021-09-02 21:49 ` Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw)
  To: Linus Torvalds, linux-mm, mm-commits

On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote:

> 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.

Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f".


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-09-02 21:48 Andrew Morton
  2021-09-02 21:49 ` incoming Andrew Morton
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.

Subsystems affected by this patch series:

  ia64
  ocfs2
  block
  mm/slub
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mremap
  mm/bootmem
  mm/sparsemem
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/mempolicy
  mm/memblock
  mm/oom-kill
  mm/migration
  mm/ksm
  mm/percpu
  mm/vmstat
  mm/madvise

Subsystem: ia64

    Jason Wang <wangborong@cdjrlc.com>:
      ia64: fix typo in a comment

    Geert Uytterhoeven <geert+renesas@glider.be>:
    Patch series "ia64: Miscellaneous fixes and cleanups":
      ia64: fix #endif comment for reserve_elfcorehdr()
      ia64: make reserve_elfcorehdr() static
      ia64: make num_rsvd_regions static

Subsystem: ocfs2

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: remove an unnecessary condition

    Tuo Li <islituo@gmail.com>:
      ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info()

    Gang He <ghe@suse.com>:
      ocfs2: ocfs2_downconvert_lock failure results in deadlock

Subsystem: block

    kernel test robot <lkp@intel.com>:
      arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4:
      mm, slub: don't call flush_all() from slab_debug_trace_open()
      mm, slub: allocate private object map for debugfs listings
      mm, slub: allocate private object map for validate_slab_cache()
      mm, slub: don't disable irq for debug_check_no_locks_freed()
      mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
      mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab()
      mm, slub: extract get_partial() from new_slab_objects()
      mm, slub: dissolve new_slab_objects() into ___slab_alloc()
      mm, slub: return slab page from get_partial() and set c->page afterwards
      mm, slub: restructure new page checks in ___slab_alloc()
      mm, slub: simplify kmem_cache_cpu and tid setup
      mm, slub: move disabling/enabling irqs to ___slab_alloc()
      mm, slub: do initial checks in ___slab_alloc() with irqs enabled
      mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
      mm, slub: restore irqs around calling new_slab()
      mm, slub: validate slab from partial list or page allocator before making it cpu slab
      mm, slub: check new pages with restored irqs
      mm, slub: stop disabling irqs around get_partial()
      mm, slub: move reset of c->page and freelist out of deactivate_slab()
      mm, slub: make locking in deactivate_slab() irq-safe
      mm, slub: call deactivate_slab() without disabling irqs
      mm, slub: move irq control into unfreeze_partials()
      mm, slub: discard slabs in unfreeze_partials() without irqs disabled
      mm, slub: detach whole partial list at once in unfreeze_partials()
      mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
      mm, slub: only disable irq with spin_lock in __unfreeze_partials()
      mm, slub: don't disable irqs in slub_cpu_dead()
      mm, slab: make flush_slab() possible to call with irqs enabled

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
      mm: slub: make object_map_lock a raw_spinlock_t

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: optionally save/restore irqs in slab_[un]lock()/
      mm, slub: make slab_lock() disable irqs with PREEMPT_RT
      mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
      mm, slub: use migrate_disable() on PREEMPT_RT
      mm, slub: convert kmem_cpu_slab protection to local_lock

Subsystem: mm/debug

    Gavin Shan <gshan@redhat.com>:
    Patch series "mm/debug_vm_pgtable: Enhancements", v6:
      mm/debug_vm_pgtable: introduce struct pgtable_debug_args
      mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests
      mm/debug_vm_pgtable: remove unused code
      mm/debug_vm_pgtable: fix corrupted page flag

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: report a more useful address for reclaim acquisition

    liuhailong <liuhailong@oppo.com>:
      mm: add kernel_misc_reclaimable in show_free_areas

Subsystem: mm/pagecache

    Jan Kara <jack@suse.cz>:
    Patch series "writeback: Fix bandwidth estimates", v4:
      writeback: track number of inodes under writeback
      writeback: reliably update bandwidth estimation
      writeback: fix bandwidth estimate for spiky workload
      writeback: rename domain_update_bandwidth()
      writeback: use READ_ONCE for unlocked reads of writeback stats

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: remove irqsave/restore locking from contexts with irqs enabled
      fs: drop_caches: fix skipping over shadow cache inodes
      fs: inode: count invalidated shadow pages in pginodesteal

    Shakeel Butt <shakeelb@google.com>:
      writeback: memcg: simplify cgroup_writeback_by_id

    Jing Yangyang <jing.yangyang@zte.com.cn>:
      include/linux/buffer_head.h: fix boolreturn.cocci warnings

Subsystem: mm/gup

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for gup":
      mm: gup: remove set but unused local variable major
      mm: gup: remove unneed local variable orig_refs
      mm: gup: remove useless BUG_ON in __get_user_pages()
      mm: gup: fix potential pgmap refcnt leak in __gup_device_huge()
      mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range()

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "A few gup refactorings and documentation updates", v3:
      mm/gup: documentation corrections for gup/pup
      mm/gup: small refactoring: simplify try_grab_page()
      mm/gup: remove try_get_page(), call try_get_compound_head() directly

Subsystem: mm/swap

    Hugh Dickins <hughd@google.com>:
      fs, mm: fix race in unlinking swapfile

    John Hubbard <jhubbard@nvidia.com>:
      mm: delete unused get_kernel_page()

Subsystem: mm/shmem

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      shmem: use raw_spinlock_t for ->stat_lock

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for shmem":
      shmem: remove unneeded variable ret
      shmem: remove unneeded header file
      shmem: remove unneeded function forward declaration
      shmem: include header file to declare swap_info

    Hugh Dickins <hughd@google.com>:
    Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups":
      huge tmpfs: fix fallocate(vanilla) advance over huge pages
      huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE
      huge tmpfs: remove shrinklist addition from shmem_setattr()
      huge tmpfs: revert shmem's use of transhuge_vma_enabled()
      huge tmpfs: move shmem_huge_enabled() upwards
      huge tmpfs: SGP_NOALLOC to stop collapse_file() on race
      huge tmpfs: shmem_is_huge(vma, inode, index)
      huge tmpfs: decide stat.st_blksize by shmem_is_huge()
      shmem: shmem_writepage() split unlikely i915 THP

Subsystem: mm/memcg

    Suren Baghdasaryan <surenb@google.com>:
      mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions
      mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config
      mm, memcg: inline swap-related functions to improve disabled memcg config

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: enable accounting for pids in nested pid namespaces

    Shakeel Butt <shakeelb@google.com>:
      memcg: switch lruvec stats to rstat
      memcg: infrastructure to flush memcg stats

    Yutian Yang <nglaive@gmail.com>:
      memcg: charge fs_context and legacy_fs_context

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "memcg accounting from OpenVZ", v7:
      memcg: enable accounting for mnt_cache entries
      memcg: enable accounting for pollfd and select bits arrays
      memcg: enable accounting for file lock caches
      memcg: enable accounting for fasync_cache
      memcg: enable accounting for new namesapces and struct nsproxy
      memcg: enable accounting of ipc resources
      memcg: enable accounting for signals
      memcg: enable accounting for posix_timers_cache slab
      memcg: enable accounting for ldt_struct objects

    Shakeel Butt <shakeelb@google.com>:
      memcg: cleanup racy sum avoidance code

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: replace in_interrupt() by !in_task() in active_memcg()

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: memcontrol: set the correct memcg swappiness restriction

    Miaohe Lin <linmiaohe@huawei.com>:
      mm, memcg: remove unused functions
      mm, memcg: save some atomic ops when flush is already true

    Michal Hocko <mhocko@suse.com>:
      memcg: fix up drain_local_stock comment

    Shakeel Butt <shakeelb@google.com>:
      memcg: make memcg->event_list_lock irqsafe

Subsystem: mm/selftests

    Po-Hsu Lin <po-hsu.lin@canonical.com>:
      selftests/vm: use kselftest skip code for skipped tests

    Colin Ian King <colin.king@canonical.com>:
      selftests: Fix spelling mistake "cann't" -> "cannot"

Subsystem: mm/pagemap

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "shoot lazy tlbs", v4:
      lazy tlb: introduce lazy mm refcount helper functions
      lazy tlb: allow lazy tlb mm refcounting to be configurable
      lazy tlb: shoot lazies, a non-refcounting lazy tlb option
      powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN

    Christoph Hellwig <hch@lst.de>:
    Patch series "_kernel_dcache_page fixes and removal":
      mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data
      mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page
      scatterlist: replace flush_kernel_dcache_page with flush_dcache_page
      mm: remove flush_kernel_dcache_page

    Huang Ying <ying.huang@intel.com>:
      mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      mm: change fault_in_pages_* to have an unsigned size parameter

    Luigi Rizzo <lrizzo@google.com>:
      mm/pagemap: add mmap_assert_locked() annotations to find_vma*()

    "Liam R. Howlett" <Liam.Howlett@Oracle.com>:
      remap_file_pages: Use vma_lookup() instead of find_vma()

Subsystem: mm/mremap

    Chen Wandun <chenwandun@huawei.com>:
      mm/mremap: fix memory account on do_munmap() failure

Subsystem: mm/bootmem

    Muchun Song <songmuchun@bytedance.com>:
      mm/bootmem_info.c: mark __init on register_page_bootmem_info_section

Subsystem: mm/sparsemem

    Ohhoon Kwon <ohoono.kwon@samsung.com>:
    Patch series "mm: sparse: remove __section_nr() function", v4:
      mm: sparse: pass section_nr to section_mark_present
      mm: sparse: pass section_nr to find_memory_block
      mm: sparse: remove __section_nr() function

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/sparse: set SECTION_NID_SHIFT to 6

    Matthew Wilcox <willy@infradead.org>:
      include/linux/mmzone.h: avoid a warning in sparse memory support

    Miles Chen <miles.chen@mediatek.com>:
      mm/sparse: clarify pgdat_to_phys

Subsystem: mm/vmalloc

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: use batched page requests in bulk-allocator
      mm/vmalloc: remove gfpflags_allow_blocking() check
      lib/test_vmalloc.c: add a new 'nr_pages' parameter

    Chen Wandun <chenwandun@huawei.com>:
      mm/vmalloc: fix wrong behavior in vread

Subsystem: mm/kasan

    Woody Lin <woodylin@google.com>:
      mm/kasan: move kasan.fault to mm/kasan/report.c

    Andrey Konovalov <andreyknvl@gmail.com>:
    Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2:
      kasan: test: rework kmalloc_oob_right
      kasan: test: avoid writing invalid memory
      kasan: test: avoid corrupting memory via memset
      kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS
      kasan: test: only do kmalloc_uaf_memset for generic mode
      kasan: test: clean up ksize_uaf
      kasan: test: avoid corrupting memory in copy_user_test
      kasan: test: avoid corrupting memory in kasan_rcu_uaf

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: ensure consistency of memory map poisoning":
      mm/page_alloc: always initialize memory map for the holes
      microblaze: simplify pte_alloc_one_kernel()
      mm: introduce memmap_alloc() to unify memory map allocation
      memblock: stop poisoning raw allocations

    Nico Pache <npache@redhat.com>:
      mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc: make alloc_node_mem_map() __init rather than __ref

    Vasily Averin <vvs@virtuozzo.com>:
      mm/page_alloc.c: use in_task()

    "George G. Davis" <davis.george@siemens.com>:
      mm/page_isolation: tracing: trace all test_pages_isolated failures

Subsystem: mm/memory-failure

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for hwpoison":
      mm/hwpoison: remove unneeded variable unmap_success
      mm/hwpoison: fix potential pte_unmap_unlock pte error
      mm/hwpoison: change argument struct page **hpagep to *hpage
      mm/hwpoison: fix some obsolete comments

    Yang Shi <shy828301@gmail.com>:
      mm: hwpoison: don't drop slab caches for offlining non-LRU page
      doc: hwpoison: correct the support for hugepage
      mm: hwpoison: dump page for unhandlable page

    Michael Wang <yun.wang@linux.alibaba.com>:
      mm: fix panic caused by __page_handle_poison()

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: simplify prep_compound_gigantic_page ref count racing code
      hugetlb: drop ref count earlier after page allocation
      hugetlb: before freeing hugetlb page set dtor to appropriate value
      hugetlb: fix hugetlb cgroup refcounting during vma split

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
    Patch series "userfaultfd: minor bug fixes":
      userfaultfd: change mmap_changing to atomic
      userfaultfd: prevent concurrent API initialization
      selftests/vm/userfaultfd: wake after copy failure

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "Migrate Pages in lieu of discard", v11:
      mm/numa: automatically generate node migration order
      mm/migrate: update node demotion order on hotplug events

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/migrate: enable returning precise migrate_pages() success count

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/migrate: demote pages during reclaim

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/vmscan: add page demotion counter

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: add helper for querying ability to age anonymous pages

    Keith Busch <kbusch@kernel.org>:
      mm/vmscan: Consider anonymous pages without swap

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: never demote for memcg reclaim

    Huang Ying <ying.huang@intel.com>:
      mm/migrate: add sysfs interface to enable reclaim migration

    Hui Su <suhui@zeku.com>:
      mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg()

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for vmscan", v2:
      mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed
      mm/vmscan: remove misleading setting to sc->priority
      mm/vmscan: remove unneeded return value of kswapd_run()
      mm/vmscan: add 'else' to remove check_pending label

    Vlastimil Babka <vbabka@suse.cz>:
      mm, vmscan: guarantee drop_slab_node() termination

Subsystem: mm/compaction

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: optimize proactive compaction deferrals
      mm: compaction: support triggering of proactive compaction by user

Subsystem: mm/mempolicy

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "Introduce multi-preference mempolicy", v7:
      mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes

    Feng Tang <feng.tang@intel.com>:
      mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY
      mm/mempolicy: advertise new MPOL_PREFERRED_MANY

    Feng Tang <feng.tang@intel.com>:
      mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies

    Vasily Averin <vvs@virtuozzo.com>:
      mm/mempolicy.c: use in_task() in mempolicy_slab_node()

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      memblock: make memblock_find_in_range method private

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm: introduce process_mrelease system call
      mm: wire up syscall process_mrelease

Subsystem: mm/migration

    Randy Dunlap <rdunlap@infradead.org>:
      mm/migrate: correct kernel-doc notation

Subsystem: mm/ksm

    Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>:
    Patch series "add KSM selftests":
      selftests: vm: add KSM merge test
      selftests: vm: add KSM unmerge test
      selftests: vm: add KSM zero page merging test
      selftests: vm: add KSM merging across nodes test
      mm: KSM: fix data type
    Patch series "add KSM performance tests", v3:
      selftests: vm: add KSM merging time test
      selftests: vm: add COW time test for KSM pages

Subsystem: mm/percpu

    Jing Xiangfeng <jingxiangfeng@huawei.com>:
      mm/percpu,c: remove obsolete comments of pcpu_chunk_populated()

Subsystem: mm/vmstat

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for vmstat":
      mm/vmstat: correct some wrong comments
      mm/vmstat: simplify the array size calculation
      mm/vmstat: remove unneeded return value

Subsystem: mm/madvise

    zhangkui <zhangkui@oppo.com>:
      mm/madvise: add MADV_WILLNEED to process_madvise()

 Documentation/ABI/testing/sysfs-kernel-mm-numa         |   24 
 Documentation/admin-guide/mm/numa_memory_policy.rst    |   15 
 Documentation/admin-guide/sysctl/vm.rst                |    3 
 Documentation/core-api/cachetlb.rst                    |   86 -
 Documentation/dev-tools/kasan.rst                      |   13 
 Documentation/translations/zh_CN/core-api/cachetlb.rst |    9 
 Documentation/vm/hwpoison.rst                          |    1 
 arch/Kconfig                                           |   28 
 arch/alpha/kernel/syscalls/syscall.tbl                 |    2 
 arch/arm/include/asm/cacheflush.h                      |    4 
 arch/arm/kernel/setup.c                                |   20 
 arch/arm/mach-rpc/ecard.c                              |    2 
 arch/arm/mm/flush.c                                    |   33 
 arch/arm/mm/nommu.c                                    |    6 
 arch/arm/tools/syscall.tbl                             |    2 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    2 
 arch/arm64/kvm/hyp/reserved_mem.c                      |    9 
 arch/arm64/mm/init.c                                   |   38 
 arch/csky/abiv1/cacheflush.c                           |   11 
 arch/csky/abiv1/inc/abi/cacheflush.h                   |    4 
 arch/csky/kernel/probes/kprobes.c                      |    3 
 arch/ia64/include/asm/meminit.h                        |    2 
 arch/ia64/kernel/acpi.c                                |    2 
 arch/ia64/kernel/setup.c                               |   55 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    2 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    2 
 arch/microblaze/include/asm/page.h                     |    3 
 arch/microblaze/include/asm/pgtable.h                  |    2 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    2 
 arch/microblaze/mm/init.c                              |   12 
 arch/microblaze/mm/pgtable.c                           |   17 
 arch/mips/include/asm/cacheflush.h                     |    8 
 arch/mips/kernel/setup.c                               |   14 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    2 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    2 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    2 
 arch/nds32/include/asm/cacheflush.h                    |    3 
 arch/nds32/mm/cacheflush.c                             |    9 
 arch/parisc/include/asm/cacheflush.h                   |    8 
 arch/parisc/kernel/cache.c                             |    3 
 arch/parisc/kernel/syscalls/syscall.tbl                |    2 
 arch/powerpc/Kconfig                                   |    1 
 arch/powerpc/kernel/smp.c                              |    2 
 arch/powerpc/kernel/syscalls/syscall.tbl               |    2 
 arch/powerpc/mm/book3s64/radix_tlb.c                   |    4 
 arch/powerpc/platforms/pseries/hotplug-memory.c        |    4 
 arch/riscv/mm/init.c                                   |   44 
 arch/s390/kernel/setup.c                               |    9 
 arch/s390/kernel/syscalls/syscall.tbl                  |    2 
 arch/s390/mm/fault.c                                   |    2 
 arch/sh/include/asm/cacheflush.h                       |    8 
 arch/sh/kernel/syscalls/syscall.tbl                    |    2 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    2 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    1 
 arch/x86/kernel/aperture_64.c                          |    5 
 arch/x86/kernel/ldt.c                                  |    6 
 arch/x86/mm/init.c                                     |   23 
 arch/x86/mm/numa.c                                     |    5 
 arch/x86/mm/numa_emulation.c                           |    5 
 arch/x86/realmode/init.c                               |    2 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    2 
 block/blk-map.c                                        |    2 
 drivers/acpi/tables.c                                  |    5 
 drivers/base/arch_numa.c                               |    5 
 drivers/base/memory.c                                  |    4 
 drivers/mmc/host/jz4740_mmc.c                          |    4 
 drivers/mmc/host/mmc_spi.c                             |    2 
 drivers/of/of_reserved_mem.c                           |   12 
 fs/drop_caches.c                                       |    3 
 fs/exec.c                                              |   12 
 fs/fcntl.c                                             |    3 
 fs/fs-writeback.c                                      |   28 
 fs/fs_context.c                                        |    4 
 fs/inode.c                                             |    2 
 fs/locks.c                                             |    6 
 fs/namei.c                                             |    8 
 fs/namespace.c                                         |    7 
 fs/ocfs2/dlmglue.c                                     |   14 
 fs/ocfs2/quota_global.c                                |    1 
 fs/ocfs2/quota_local.c                                 |    2 
 fs/pipe.c                                              |    2 
 fs/select.c                                            |    4 
 fs/userfaultfd.c                                       |  116 -
 include/linux/backing-dev-defs.h                       |    2 
 include/linux/backing-dev.h                            |   19 
 include/linux/buffer_head.h                            |    2 
 include/linux/compaction.h                             |    2 
 include/linux/highmem.h                                |    5 
 include/linux/hugetlb_cgroup.h                         |   12 
 include/linux/memblock.h                               |    2 
 include/linux/memcontrol.h                             |  118 +
 include/linux/memory.h                                 |    2 
 include/linux/mempolicy.h                              |   16 
 include/linux/migrate.h                                |   14 
 include/linux/mm.h                                     |   17 
 include/linux/mmzone.h                                 |    4 
 include/linux/page-flags.h                             |    9 
 include/linux/pagemap.h                                |    4 
 include/linux/sched/mm.h                               |   35 
 include/linux/shmem_fs.h                               |   25 
 include/linux/slub_def.h                               |    6 
 include/linux/swap.h                                   |   28 
 include/linux/syscalls.h                               |    1 
 include/linux/userfaultfd_k.h                          |    8 
 include/linux/vm_event_item.h                          |    2 
 include/linux/vmpressure.h                             |    2 
 include/linux/writeback.h                              |    4 
 include/trace/events/migrate.h                         |    3 
 include/uapi/asm-generic/unistd.h                      |    4 
 include/uapi/linux/mempolicy.h                         |    1 
 ipc/msg.c                                              |    2 
 ipc/namespace.c                                        |    2 
 ipc/sem.c                                              |    9 
 ipc/shm.c                                              |    2 
 kernel/cgroup/namespace.c                              |    2 
 kernel/cpu.c                                           |    2 
 kernel/exit.c                                          |    2 
 kernel/fork.c                                          |   51 
 kernel/kthread.c                                       |   21 
 kernel/nsproxy.c                                       |    2 
 kernel/pid_namespace.c                                 |    5 
 kernel/sched/core.c                                    |   37 
 kernel/sched/sched.h                                   |    4 
 kernel/signal.c                                        |    2 
 kernel/sys_ni.c                                        |    1 
 kernel/sysctl.c                                        |    2 
 kernel/time/namespace.c                                |    4 
 kernel/time/posix-timers.c                             |    4 
 kernel/user_namespace.c                                |    2 
 lib/scatterlist.c                                      |    5 
 lib/test_kasan.c                                       |   80 -
 lib/test_kasan_module.c                                |   20 
 lib/test_vmalloc.c                                     |    5 
 mm/backing-dev.c                                       |   11 
 mm/bootmem_info.c                                      |    4 
 mm/compaction.c                                        |   69 -
 mm/debug_vm_pgtable.c                                  |  982 +++++++++------
 mm/filemap.c                                           |   15 
 mm/gup.c                                               |  109 -
 mm/huge_memory.c                                       |   32 
 mm/hugetlb.c                                           |  173 ++
 mm/hwpoison-inject.c                                   |    2 
 mm/internal.h                                          |    9 
 mm/kasan/hw_tags.c                                     |   43 
 mm/kasan/kasan.h                                       |    1 
 mm/kasan/report.c                                      |   29 
 mm/khugepaged.c                                        |    2 
 mm/ksm.c                                               |    8 
 mm/madvise.c                                           |    1 
 mm/memblock.c                                          |   22 
 mm/memcontrol.c                                        |  234 +--
 mm/memory-failure.c                                    |   53 
 mm/memory_hotplug.c                                    |    2 
 mm/mempolicy.c                                         |  207 ++-
 mm/migrate.c                                           |  319 ++++
 mm/mmap.c                                              |    7 
 mm/mremap.c                                            |    2 
 mm/oom_kill.c                                          |   70 +
 mm/page-writeback.c                                    |  133 +-
 mm/page_alloc.c                                        |   62 
 mm/page_isolation.c                                    |   13 
 mm/percpu.c                                            |    3 
 mm/shmem.c                                             |  309 ++--
 mm/slab_common.c                                       |    2 
 mm/slub.c                                              | 1085 ++++++++++-------
 mm/sparse.c                                            |   46 
 mm/swap.c                                              |   22 
 mm/swapfile.c                                          |   14 
 mm/truncate.c                                          |   28 
 mm/userfaultfd.c                                       |   15 
 mm/vmalloc.c                                           |   79 -
 mm/vmpressure.c                                        |   10 
 mm/vmscan.c                                            |  220 ++-
 mm/vmstat.c                                            |   25 
 security/tomoyo/domain.c                               |   13 
 tools/testing/scatterlist/linux/mm.h                   |    1 
 tools/testing/selftests/vm/.gitignore                  |    1 
 tools/testing/selftests/vm/Makefile                    |    3 
 tools/testing/selftests/vm/charge_reserved_hugetlb.sh  |    5 
 tools/testing/selftests/vm/hugetlb_reparenting_test.sh |    5 
 tools/testing/selftests/vm/ksm_tests.c                 |  696 ++++++++++
 tools/testing/selftests/vm/mlock-random-test.c         |    2 
 tools/testing/selftests/vm/run_vmtests.sh              |   98 +
 tools/testing/selftests/vm/userfaultfd.c               |   13 
 186 files changed, 4488 insertions(+), 2281 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-08-25 19:17 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9.

Subsystems affected by this patch series:

  mm/memory-hotplug
  MAINTAINERS

Subsystem: mm/memory-hotplug

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory_hotplug: fix potential permanent lru cache disable

Subsystem: MAINTAINERS

    Namjae Jeon <namjae.jeon@samsung.com>:
      MAINTAINERS: exfat: update my email address

 MAINTAINERS         |    2 +-
 mm/memory_hotplug.c |    1 +
 2 files changed, 2 insertions(+), 1 deletion(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-08-20  2:03 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-08-20  2:03 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

10 patches, based on 614cb2751d3150850d459bee596c397f344a7936.

Subsystems affected by this patch series:

  mm/shmem
  mm/pagealloc
  mm/tracing
  MAINTAINERS
  mm/memcg
  mm/memory-failure
  mm/vmscan
  mm/kfence
  mm/hugetlb

Subsystem: mm/shmem

    Yang Shi <shy828301@gmail.com>:
      Revert "mm/shmem: fix shmem_swapin() race with swapoff"
      Revert "mm: swap: check if swap backing device is congested or not"

Subsystem: mm/pagealloc

    Doug Berger <opendmb@gmail.com>:
      mm/page_alloc: don't corrupt pcppage_migratetype

Subsystem: mm/tracing

    Mike Rapoport <rppt@linux.ibm.com>:
      mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS: update ClangBuiltLinux IRC chat

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: retry with shake_page() for unhandlable pages

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: vmscan: fix missing psi annotation for node_reclaim()

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: don't pass page cache pages to restore_reserve_on_error

 MAINTAINERS                    |    2 +-
 include/linux/kfence.h         |    7 ++++---
 include/linux/memcontrol.h     |   29 +++++++++++++++--------------
 include/trace/events/mmflags.h |    4 +++-
 mm/hugetlb.c                   |   19 ++++++++++++++-----
 mm/memory-failure.c            |   12 +++++++++---
 mm/page_alloc.c                |   25 ++++++++++++-------------
 mm/shmem.c                     |   14 +-------------
 mm/swap_state.c                |    7 -------
 mm/vmscan.c                    |   30 ++++++++++++++++++++++--------
 10 files changed, 81 insertions(+), 68 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-08-13 23:53 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008.

Subsystems affected by this patch series:

  mm/kasan
  mm/slub
  mm/madvise
  mm/memcg
  lib

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
    Patch series "kasan, slub: reset tag when printing address", v3:
      kasan, kmemleak: reset tags when scanning block
      kasan, slub: reset tag when printing address

Subsystem: mm/slub

    Shakeel Butt <shakeelb@google.com>:
      slub: fix kmalloc_pagealloc_invalid_free unit test

    Vlastimil Babka <vbabka@suse.cz>:
      mm: slub: fix slub_debug disabling for list of slabs

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
      mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE)

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
      mm/memcg: fix incorrect flushing of lruvec data in obj_stock

Subsystem: lib

    Liang Wang <wangliang101@huawei.com>:
      lib: use PFN_PHYS() in devmem_is_allowed()

 lib/devmem_is_allowed.c |    2 +-
 mm/gup.c                |    7 +++++--
 mm/kmemleak.c           |    6 +++---
 mm/madvise.c            |    4 +++-
 mm/memcontrol.c         |    6 ++++--
 mm/slub.c               |   25 ++++++++++++++-----------
 6 files changed, 30 insertions(+), 20 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-07-29 21:52 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2.

Subsystems affected by this patch series:

  lib
  ocfs2
  mm/memcg
  mm/migration
  mm/slub
  mm/memcg

Subsystem: lib

    Matteo Croce <mcroce@microsoft.com>:
      lib/test_string.c: move string selftest in the Runtime Testing menu

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: fix zero out valid data
      ocfs2: issue zeroout to EOF blocks

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code

Subsystem: mm/migration

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/migrate: fix NR_ISOLATED corruption on 64-bit

Subsystem: mm/slub

    Shakeel Butt <shakeelb@google.com>:
      slub: fix unreclaimable slab stat for bulk free

Subsystem: mm/memcg

    Wang Hai <wanghai38@huawei.com>:
      mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook()

 fs/ocfs2/file.c   |  103 ++++++++++++++++++++++++++++++++----------------------
 lib/Kconfig       |    3 -
 lib/Kconfig.debug |    3 +
 mm/memcontrol.c   |    3 +
 mm/migrate.c      |    2 -
 mm/slab.h         |    2 -
 mm/slub.c         |   22 ++++++-----
 7 files changed, 81 insertions(+), 57 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-07-23 22:49 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55.

Subsystems affected by this patch series:

  mm/userfaultfd
  mm/kfence
  mm/highmem
  mm/pagealloc
  mm/memblock
  mm/pagecache
  mm/secretmem
  mm/pagemap
  mm/hugetlbfs

Subsystem: mm/userfaultfd

    Peter Collingbourne <pcc@google.com>:
    Patch series "userfaultfd: do not untag user pointers", v5:
      userfaultfd: do not untag user pointers
      selftest: use mmap instead of posix_memalign to allocate memory

Subsystem: mm/kfence

    Weizhao Ouyang <o451686892@gmail.com>:
      kfence: defer kfence_test_init to ensure that kunit debugfs is created

    Alexander Potapenko <glider@google.com>:
      kfence: move the size check to the beginning of __kfence_alloc()
      kfence: skip all GFP_ZONEMASK allocations

Subsystem: mm/highmem

    Christoph Hellwig <hch@lst.de>:
      mm: call flush_dcache_page() in memcpy_to_page() and memzero_page()
      mm: use kmap_local_page in memzero_page

Subsystem: mm/pagealloc

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions

Subsystem: mm/pagecache

    Roman Gushchin <guro@fb.com>:
      writeback, cgroup: remove wb from offline list before releasing refcnt
      writeback, cgroup: do not reparent dax inodes

Subsystem: mm/secretmem

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/secretmem: wire up ->set_page_dirty

Subsystem: mm/pagemap

    Muchun Song <songmuchun@bytedance.com>:
      mm: mmap_lock: fix disabling preemption directly

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm: fix the deadlock in finish_fault()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: fix mount mode command line processing

 Documentation/arm64/tagged-address-abi.rst |   26 ++++++++++++++++++--------
 fs/fs-writeback.c                          |    3 +++
 fs/hugetlbfs/inode.c                       |    2 +-
 fs/userfaultfd.c                           |   26 ++++++++++++--------------
 include/linux/highmem.h                    |    6 ++++--
 include/linux/memblock.h                   |    4 ++--
 mm/backing-dev.c                           |    2 +-
 mm/kfence/core.c                           |   19 ++++++++++++++++---
 mm/kfence/kfence_test.c                    |    2 +-
 mm/memblock.c                              |    3 ++-
 mm/memory.c                                |   11 ++++++++++-
 mm/mmap_lock.c                             |    4 ++--
 mm/page_alloc.c                            |   29 ++++++++++++++++-------------
 mm/secretmem.c                             |    1 +
 tools/testing/selftests/vm/userfaultfd.c   |    6 ++++--
 15 files changed, 93 insertions(+), 51 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-07-15  4:26 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-07-15  4:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e.

Subsystems affected by this patch series:

  mm/kasan
  mm/pagealloc
  mm/rmap
  mm/hmm
  hfs
  mm/hugetlb

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      mm: move helper to check slub_debug_enabled

    Yee Lee <yee.lee@mediatek.com>:
      kasan: add memzero init for unaligned size at DEBUG

    Marco Elver <elver@google.com>:
      kasan: fix build by including kernel.h

Subsystem: mm/pagealloc

    Matteo Croce <mcroce@microsoft.com>:
      Revert "mm/page_alloc: make should_fail_alloc_page() static"

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: avoid page allocator recursion with pagesets.lock held

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/page_alloc: correct return value when failing at preparing

    Chuck Lever <chuck.lever@oracle.com>:
      mm/page_alloc: further fix __alloc_pages_bulk() return value

Subsystem: mm/rmap

    Christoph Hellwig <hch@lst.de>:
      mm: fix the try_to_unmap prototype for !CONFIG_MMU

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
      lib/test_hmm: remove set but unused page variable

Subsystem: hfs

    Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
    Patch series "hfs: fix various errors", v2:
      hfs: add missing clean-up in hfs_fill_super
      hfs: fix high memory mapping in hfs_bnode_read
      hfs: add lock nesting notation to hfs_find_init

Subsystem: mm/hugetlb

    Joao Martins <joao.m.martins@oracle.com>:
      mm/hugetlb: fix refs calculation from unaligned @vaddr

 fs/hfs/bfind.c        |   14 +++++++++++++-
 fs/hfs/bnode.c        |   25 ++++++++++++++++++++-----
 fs/hfs/btree.h        |    7 +++++++
 fs/hfs/super.c        |   10 +++++-----
 include/linux/kasan.h |    1 +
 include/linux/rmap.h  |    4 +++-
 lib/test_hmm.c        |    2 --
 mm/hugetlb.c          |    5 +++--
 mm/kasan/kasan.h      |   12 ++++++++++++
 mm/page_alloc.c       |   30 ++++++++++++++++++++++--------
 mm/slab.h             |   15 +++++++++++----
 mm/slub.c             |   14 --------------
 12 files changed, 97 insertions(+), 42 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-07-08  0:59 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-07-08  0:59 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d.

Subsystems affected by this patch series:

  lib
  mm/slub
  mm/secretmem
  mm/cleanups
  mm/init
  debug
  mm/pagemap
  mm/mremap

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/test: fix spelling mistakes
      lib: fix spelling mistakes
      lib: fix spelling mistakes in header files

Subsystem: mm/slub

    Nathan Chancellor <nathan@kernel.org>:
    Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN":
      hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script
      hexagon: use common DISCARDS macro
      hexagon: select ARCH_WANT_LD_ORPHAN_WARN

    Oliver Glitta <glittao@gmail.com>:
      mm/slub: use stackdepot to save stack trace in objects

Subsystem: mm/secretmem

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20:
      mmap: make mlock_future_check() global
      riscv/Kconfig: make direct map manipulation options depend on MMU
      set_memory: allow querying whether set_direct_map_*() is actually enabled
      mm: introduce memfd_secret system call to create "secret" memory areas
      PM: hibernate: disable when there are active secretmem users
      arch, mm: wire up memfd_secret system call where relevant
      secretmem: test: add basic selftest for memfd_secret(2)

Subsystem: mm/cleanups

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm: fix spelling mistakes in header files

Subsystem: mm/init

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3:
      mm: add setup_initial_init_mm() helper
      arc: convert to setup_initial_init_mm()
      arm: convert to setup_initial_init_mm()
      arm64: convert to setup_initial_init_mm()
      csky: convert to setup_initial_init_mm()
      h8300: convert to setup_initial_init_mm()
      m68k: convert to setup_initial_init_mm()
      nds32: convert to setup_initial_init_mm()
      nios2: convert to setup_initial_init_mm()
      openrisc: convert to setup_initial_init_mm()
      powerpc: convert to setup_initial_init_mm()
      riscv: convert to setup_initial_init_mm()
      s390: convert to setup_initial_init_mm()
      sh: convert to setup_initial_init_mm()
      x86: convert to setup_initial_init_mm()

Subsystem: debug

    Stephen Boyd <swboyd@chromium.org>:
    Patch series "Add build ID to stacktraces", v6:
      buildid: only consider GNU notes for build ID parsing
      buildid: add API to parse build ID out of buffer
      buildid: stash away kernels build ID on init
      dump_stack: add vmlinux build ID to stack traces
      module: add printk formats to add module build ID to stacktraces
      arm64: stacktrace: use %pSb for backtrace printing
      x86/dumpstack: use %pSb/%pBb for backtrace printing
      scripts/decode_stacktrace.sh: support debuginfod
      scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm
      scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path
      buildid: mark some arguments const
      buildid: fix kernel-doc notation
      kdump: use vmlinux_build_id to simplify

Subsystem: mm/pagemap

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t *
      mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t *

Subsystem: mm/mremap

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mrermap fixes", v2:
      selftest/mremap_test: update the test to handle pagesize other than 4K
      selftest/mremap_test: avoid crash with static build
      mm/mremap: convert huge PUD move to separate helper
      mm/mremap: don't enable optimized PUD move if page table levels is 2
      mm/mremap: use pmd/pud_poplulate to update page table entries
      mm/mremap: hold the rmap lock in write mode when moving page table entries.
    Patch series "Speedup mremap on ppc64", v8:
      mm/mremap: allow arch runtime override
      powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache
      powerpc/mm: enable HAVE_MOVE_PMD support

 Documentation/core-api/printk-formats.rst           |   11 
 arch/alpha/include/asm/pgtable.h                    |    8 
 arch/arc/mm/init.c                                  |    5 
 arch/arm/include/asm/pgtable-3level.h               |    2 
 arch/arm/kernel/setup.c                             |    5 
 arch/arm64/include/asm/Kbuild                       |    1 
 arch/arm64/include/asm/cacheflush.h                 |    6 
 arch/arm64/include/asm/kfence.h                     |    2 
 arch/arm64/include/asm/pgtable.h                    |    8 
 arch/arm64/include/asm/set_memory.h                 |   17 +
 arch/arm64/include/uapi/asm/unistd.h                |    1 
 arch/arm64/kernel/machine_kexec.c                   |    1 
 arch/arm64/kernel/setup.c                           |    5 
 arch/arm64/kernel/stacktrace.c                      |    2 
 arch/arm64/mm/mmu.c                                 |    7 
 arch/arm64/mm/pageattr.c                            |   13 
 arch/csky/kernel/setup.c                            |    5 
 arch/h8300/kernel/setup.c                           |    5 
 arch/hexagon/Kconfig                                |    1 
 arch/hexagon/kernel/vmlinux.lds.S                   |    9 
 arch/ia64/include/asm/pgtable.h                     |    4 
 arch/m68k/include/asm/motorola_pgtable.h            |    2 
 arch/m68k/kernel/setup_mm.c                         |    5 
 arch/m68k/kernel/setup_no.c                         |    5 
 arch/mips/include/asm/pgtable-64.h                  |    8 
 arch/nds32/kernel/setup.c                           |    5 
 arch/nios2/kernel/setup.c                           |    5 
 arch/openrisc/kernel/setup.c                        |    5 
 arch/parisc/include/asm/pgtable.h                   |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h        |   11 
 arch/powerpc/include/asm/book3s/64/tlbflush-radix.h |    2 
 arch/powerpc/include/asm/nohash/64/pgtable-4k.h     |    6 
 arch/powerpc/include/asm/nohash/64/pgtable.h        |    6 
 arch/powerpc/include/asm/tlb.h                      |    6 
 arch/powerpc/kernel/setup-common.c                  |    5 
 arch/powerpc/mm/book3s64/radix_hugetlbpage.c        |    8 
 arch/powerpc/mm/book3s64/radix_pgtable.c            |    6 
 arch/powerpc/mm/book3s64/radix_tlb.c                |   44 +-
 arch/powerpc/mm/pgtable_64.c                        |    4 
 arch/powerpc/platforms/Kconfig.cputype              |    2 
 arch/riscv/Kconfig                                  |    4 
 arch/riscv/include/asm/pgtable-64.h                 |    4 
 arch/riscv/include/asm/unistd.h                     |    1 
 arch/riscv/kernel/setup.c                           |    5 
 arch/s390/kernel/setup.c                            |    5 
 arch/sh/include/asm/pgtable-3level.h                |    4 
 arch/sh/kernel/setup.c                              |    5 
 arch/sparc/include/asm/pgtable_32.h                 |    6 
 arch/sparc/include/asm/pgtable_64.h                 |   10 
 arch/um/include/asm/pgtable-3level.h                |    2 
 arch/x86/entry/syscalls/syscall_32.tbl              |    1 
 arch/x86/entry/syscalls/syscall_64.tbl              |    1 
 arch/x86/include/asm/pgtable.h                      |    8 
 arch/x86/kernel/dumpstack.c                         |    2 
 arch/x86/kernel/setup.c                             |    5 
 arch/x86/mm/init_64.c                               |    4 
 arch/x86/mm/pat/set_memory.c                        |    4 
 arch/x86/mm/pgtable.c                               |    2 
 include/asm-generic/pgtable-nop4d.h                 |    2 
 include/asm-generic/pgtable-nopmd.h                 |    2 
 include/asm-generic/pgtable-nopud.h                 |    4 
 include/linux/bootconfig.h                          |    4 
 include/linux/buildid.h                             |   10 
 include/linux/compaction.h                          |    4 
 include/linux/cpumask.h                             |    2 
 include/linux/crash_core.h                          |   12 
 include/linux/debugobjects.h                        |    2 
 include/linux/hmm.h                                 |    2 
 include/linux/hugetlb.h                             |    6 
 include/linux/kallsyms.h                            |   21 +
 include/linux/list_lru.h                            |    4 
 include/linux/lru_cache.h                           |    8 
 include/linux/mm.h                                  |    3 
 include/linux/mmu_notifier.h                        |    8 
 include/linux/module.h                              |    9 
 include/linux/nodemask.h                            |    6 
 include/linux/percpu-defs.h                         |    2 
 include/linux/percpu-refcount.h                     |    2 
 include/linux/pgtable.h                             |    4 
 include/linux/scatterlist.h                         |    2 
 include/linux/secretmem.h                           |   54 +++
 include/linux/set_memory.h                          |   12 
 include/linux/shrinker.h                            |    2 
 include/linux/syscalls.h                            |    1 
 include/linux/vmalloc.h                             |    4 
 include/uapi/asm-generic/unistd.h                   |    7 
 include/uapi/linux/magic.h                          |    1 
 init/Kconfig                                        |    1 
 init/main.c                                         |    2 
 kernel/crash_core.c                                 |   50 ---
 kernel/kallsyms.c                                   |  104 +++++--
 kernel/module.c                                     |   42 ++
 kernel/power/hibernate.c                            |    5 
 kernel/sys_ni.c                                     |    2 
 lib/Kconfig.debug                                   |   17 -
 lib/asn1_encoder.c                                  |    2 
 lib/buildid.c                                       |   80 ++++-
 lib/devres.c                                        |    2 
 lib/dump_stack.c                                    |   13 
 lib/dynamic_debug.c                                 |    2 
 lib/fonts/font_pearl_8x8.c                          |    2 
 lib/kfifo.c                                         |    2 
 lib/list_sort.c                                     |    2 
 lib/nlattr.c                                        |    4 
 lib/oid_registry.c                                  |    2 
 lib/pldmfw/pldmfw.c                                 |    2 
 lib/reed_solomon/test_rslib.c                       |    2 
 lib/refcount.c                                      |    2 
 lib/rhashtable.c                                    |    2 
 lib/sbitmap.c                                       |    2 
 lib/scatterlist.c                                   |    4 
 lib/seq_buf.c                                       |    2 
 lib/sort.c                                          |    2 
 lib/stackdepot.c                                    |    2 
 lib/test_bitops.c                                   |    2 
 lib/test_bpf.c                                      |    2 
 lib/test_kasan.c                                    |    2 
 lib/test_kmod.c                                     |    6 
 lib/test_scanf.c                                    |    2 
 lib/vsprintf.c                                      |   10 
 mm/Kconfig                                          |    4 
 mm/Makefile                                         |    1 
 mm/gup.c                                            |   12 
 mm/init-mm.c                                        |    9 
 mm/internal.h                                       |    3 
 mm/mlock.c                                          |    3 
 mm/mmap.c                                           |    5 
 mm/mremap.c                                         |  108 ++++++-
 mm/secretmem.c                                      |  254 +++++++++++++++++
 mm/slub.c                                           |   79 +++--
 scripts/checksyscalls.sh                            |    4 
 scripts/decode_stacktrace.sh                        |   89 +++++-
 tools/testing/selftests/vm/.gitignore               |    1 
 tools/testing/selftests/vm/Makefile                 |    3 
 tools/testing/selftests/vm/memfd_secret.c           |  296 ++++++++++++++++++++
 tools/testing/selftests/vm/mremap_test.c            |  116 ++++---
 tools/testing/selftests/vm/run_vmtests.sh           |   17 +
 137 files changed, 1470 insertions(+), 442 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-07-03  0:28 ` incoming Linus Torvalds
@ 2021-07-03  1:06   ` Linus Torvalds
  0 siblings, 0 replies; 203+ messages in thread
From: Linus Torvalds @ 2021-07-03  1:06 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
> at the pulls and merges I've done since, this -mm series looks like
> the obvious culprit.

No, unless my bisection is wrong, the -mm branch is innocent, and was
discarded from the suspects on the very first bisection trial.

So never mind.

             Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-07-01  1:46 incoming Andrew Morton
@ 2021-07-03  0:28 ` Linus Torvalds
  2021-07-03  1:06   ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2021-07-03  0:28 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> This is the rest of the -mm tree, less 66 patches which are dependent on
> things which are (or were recently) in linux-next.  I'll trickle that
> material over next week.

I haven't bisected this yet, but with the current -git I'm getting

   watchdog: BUG: soft lockup - CPU#41 stuck for 49s!

and the common call chain seems to be in flush_tlb_mm_range ->
on_each_cpu_cond_mask.

Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
at the pulls and merges I've done since, this -mm series looks like
the obvious culprit.

I'll go start bisection, but I thought I'd give a heads-up in case
somebody else has seen TLB-flush-related lockups and already figured
out the guilty party..

                 Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-07-01  1:46 Andrew Morton
  2021-07-03  0:28 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-07-01  1:46 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


This is the rest of the -mm tree, less 66 patches which are dependent on
things which are (or were recently) in linux-next.  I'll trickle that
material over next week.


192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the
June 28 sendings.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/kconfig
  mm/proc
  mm/z3fold
  mm/zbud
  mm/ras
  mm/mempolicy
  mm/memblock
  mm/migration
  mm/thp
  mm/nommu
  mm/kconfig
  mm/madvise
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/zram
  mm/cleanups
  mm/kfence
  mm/hmm
  procfs
  sysctl
  misc
  core-kernel
  lib
  lz4
  checkpatch
  init
  kprobes
  nilfs2
  hfs
  signals
  exec
  kcov
  selftests
  compress/decompress
  ipc

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Free some vmemmap pages of HugeTLB page", v23:
      mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c
      mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP
      mm: hugetlb: gather discrete indexes of tail page
      mm: hugetlb: free the vmemmap pages associated with each HugeTLB page
      mm: hugetlb: defer freeing of HugeTLB pages
      mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page
      mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap
      mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled
      mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate

    Shixin Liu <liushixin2@huawei.com>:
      mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE
      mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for huge_memory:, v3:
      mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK
      mm/huge_memory.c: use page->deferred_list
      mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled()
      mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd
      mm/huge_memory.c: don't discard hugepage if other processes are mapping it

    Christophe Leroy <christophe.leroy@csgroup.eu>:
    Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2:
      mm/hugetlb: change parameters of arch_make_huge_pte()
      mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge
      mm/vmalloc: enable mapping of huge pages at pte level in vmap
      mm/vmalloc: enable mapping of huge pages at pte level in vmalloc
      powerpc/8xx: add support for huge pages on VMAP and VMALLOC

    Nanyong Sun <sunnanyong@huawei.com>:
      khugepaged: selftests: remove debug_cow

    Mina Almasry <almasrymina@google.com>:
      mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Split huge PMD mapping of vmemmap pages", v4:
      mm: sparsemem: split the huge PMD mapping of vmemmap pages
      mm: sparsemem: use huge PMD mapping for vmemmap pages
      mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "Fix prep_compound_gigantic_page ref count adjustment":
      hugetlb: remove prep_compound_huge_page cleanup
      hugetlb: address ref count racing in prep_compound_gigantic_page

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: disable pcp for page_handle_poison()

Subsystem: mm/userfaultfd

    Peter Xu <peterx@redhat.com>:
    Patch series "userfaultfd/selftests: A few cleanups", v2:
      userfaultfd/selftests: use user mode only
      userfaultfd/selftests: remove the time() check on delayed uffd
      userfaultfd/selftests: dropping VERIFY check in locking_thread
      userfaultfd/selftests: only dump counts if mode enabled
      userfaultfd/selftests: unify error handling
    Patch series "mm/uffd: Misc fix for uffd-wp and one more test":
      mm/thp: simplify copying of huge zero page pmd when fork
      mm/userfaultfd: fix uffd-wp special cases for fork()
      mm/userfaultfd: fail uffd-wp registration if not supported
      mm/pagemap: export uffd-wp protection information
      userfaultfd/selftests: add pagemap uffd-wp test

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling for shmem", v6:
      userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte
      userfaultfd/shmem: support minor fault registration for shmem
      userfaultfd/shmem: support UFFDIO_CONTINUE for shmem
      userfaultfd/shmem: advertise shmem minor fault support
      userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte()
      userfaultfd/selftests: use memfd_create for shmem test type
      userfaultfd/selftests: create alias mappings in the shmem test
      userfaultfd/selftests: reinitialize test context in each test
      userfaultfd/selftests: exercise minor fault handling shmem support

Subsystem: mm/vmscan

    Yu Zhao <yuzhao@google.com>:
      mm/vmscan.c: fix potential deadlock in reclaim_pages()
      include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: workingset: define macro WORKINGSET_SHIFT

Subsystem: mm/kconfig

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm/kconfig: move HOLES_IN_ZONE into mm

Subsystem: mm/proc

    Mike Rapoport <rppt@linux.ibm.com>:
      docs: proc.rst: meminfo: briefly describe gaps in memory accounting

    David Hildenbrand <david@redhat.com>:
    Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3:
      fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER
      fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM
      fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages
      mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline()
      virtio-mem: use page_offline_(start|end) when setting PageOffline()
      fs/proc/kcore: use page_offline_(freeze|thaw)

Subsystem: mm/z3fold

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for z3fold":
      mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS
      mm/z3fold: avoid possible underflow in z3fold_alloc()
      mm/z3fold: remove magic number in z3fold_create_pool()
      mm/z3fold: remove unused function handle_to_z3fold_header()
      mm/z3fold: fix potential memory leak in z3fold_destroy_pool()
      mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page

Subsystem: mm/zbud

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for zbud", v2:
      mm/zbud: reuse unbuddied[0] as buddied in zbud_pool
      mm/zbud: don't export any zbud API

Subsystem: mm/ras

    YueHaibing <yuehaibing@huawei.com>:
      mm/compaction: use DEVICE_ATTR_WO macro

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm: compaction: remove duplicate !list_empty(&sublist) check

    Wonhyuk Yang <vvghjk1234@gmail.com>:
      mm/compaction: fix 'limit' in fast_isolate_freepages

Subsystem: mm/mempolicy

    Feng Tang <feng.tang@intel.com>:
    Patch series "mm/mempolicy: some fix and semantics cleanup", v4:
      mm/mempolicy: cleanup nodemask intersection check for oom
      mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy
      mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy

    Yang Shi <shy828301@gmail.com>:
      mm: mempolicy: don't have to split pmd for huge zero page

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4:
      include/linux/mmzone.h: add documentation for pfn_valid()
      memblock: update initialization of reserved pages
      arm64: decouple check whether pfn is in linear map from pfn_valid()
      arm64: drop pfn_valid_within() and simplify pfn_valid()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      arm64/mm: drop HAVE_ARCH_PFN_VALID

Subsystem: mm/migration

    Muchun Song <songmuchun@bytedance.com>:
      mm: migrate: fix missing update page_private to hugetlb_page_subpool

Subsystem: mm/thp

    Collin Fijalkovich <cfijalkovich@google.com>:
      mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs

    Yang Shi <shy828301@gmail.com>:
      mm: memory: add orig_pmd to struct vm_fault
      mm: memory: make numa_migrate_prep() non-static
      mm: thp: refactor NUMA fault handling
      mm: migrate: account THP NUMA migration counters correctly
      mm: migrate: don't split THP for misplaced NUMA page
      mm: migrate: check mapcount for THP instead of refcount
      mm: thp: skip make PMD PROT_NONE if THP migration is not supported

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2

    Yang Shi <shy828301@gmail.com>:
      mm: rmap: make try_to_unmap() void function

    Hugh Dickins <hughd@google.com>:
      mm/thp: remap_page() is only needed on anonymous THP
      mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/thp: fix strncpy warning

Subsystem: mm/nommu

    Chen Li <chenli@uniontech.com>:
      nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc

    Liam Howlett <liam.howlett@oracle.com>:
      mm/nommu: unexport do_munmap()

Subsystem: mm/kconfig

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: generalize ZONE_[DMA|DMA32]

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2:
      mm: make variable names for populate_vma_page_range() consistent
      mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables
      MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT
      selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore
      selftests/vm: add test for MADV_POPULATE_(READ|WRITE)

Subsystem: mm/memory-hotplug

    Liam Mark <lmark@codeaurora.org>:
      mm/memory_hotplug: rate limit page migration warnings

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: drop unneeded locking

Subsystem: mm/zswap

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for zswap":
      mm/zswap.c: remove unused function zswap_debugfs_exit()
      mm/zswap.c: avoid unnecessary copy-in at map time
      mm/zswap.c: fix two bugs in zswap_writeback_entry()

Subsystem: mm/zsmalloc

    Zhaoyang Huang <zhaoyang.huang@unisoc.com>:
      mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for zsmalloc":
      mm/zsmalloc.c: remove confusing code in obj_free()
      mm/zsmalloc.c: improve readability for async_free_zspage()

Subsystem: mm/zram

    Yue Hu <huyue2@yulong.com>:
      zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK

Subsystem: mm/cleanups

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm: fix typos and grammar error in comments

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: define default value for FIRST_USER_ADDRESS

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm: fix spelling mistakes

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Clean W=1 build warnings for mm/":
      mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages
      mm/vmalloc: include header for prototype of set_iounmap_nonlazy
      mm/page_alloc: make should_fail_alloc_page() static
      mm/mapping_dirty_helpers: remove double Note in kerneldoc
      mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection
      mm/memory_hotplug: fix kerneldoc comment for __try_online_node
      mm/memory_hotplug: fix kerneldoc comment for __remove_memory
      mm/zbud: add kerneldoc fields for zbud_pool
      mm/z3fold: add kerneldoc fields for z3fold_pool
      mm/swap: make swap_address_space an inline function
      mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations
      mm/page_alloc: move prototype for find_suitable_fallback
      mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: define default pmd_pgtable()

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: unconditionally use unbound work queue

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
    Patch series "Add support for SVM atomics in Nouveau", v11:
      mm: remove special swap entry functions
      mm/swapops: rework swap entry manipulation code
      mm/rmap: split try_to_munlock from try_to_unmap
      mm/rmap: split migration into its own function
      mm: rename migrate_pgmap_owner
      mm/memory.c: allow different return codes for copy_nonpresent_pte()
      mm: device exclusive memory access
      mm: selftests for exclusive device memory
      nouveau/svm: refactor nouveau_range_fault
      nouveau/svm: implement atomic SVM access

Subsystem: procfs

    Marcelo Henrique Cerri <marcelo.cerri@canonical.com>:
      proc: Avoid mixing integer types in mem_rw()

    ZHOUFENG <zhoufeng.zf@bytedance.com>:
      fs/proc/kcore.c: add mmap interface

    Kalesh Singh <kaleshsingh@google.com>:
      procfs: allow reading fdinfo with PTRACE_MODE_READ
      procfs/dmabuf: add inode number to /proc/*/fdinfo

Subsystem: sysctl

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      sysctl: remove redundant assignment to first

Subsystem: misc

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      drm: include only needed headers in ascii85.h

Subsystem: core-kernel

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out panic and oops helpers

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib: decompress_bunzip2: remove an unneeded semicolon

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
    Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3:
      lib/string_helpers: switch to use BIT() macro
      lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop
      lib/string_helpers: drop indentation level in string_escape_mem()
      lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII
      lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable
      lib/string_helpers: allow to append additional characters to be escaped
      lib/test-string_helpers: print flags in hexadecimal format
      lib/test-string_helpers: get rid of trailing comma in terminators
      lib/test-string_helpers: add test cases for new features
      MAINTAINERS: add myself as designated reviewer for generic string library
      seq_file: introduce seq_escape_mem()
      seq_file: add seq_escape_str() as replica of string_escape_str()
      seq_file: convert seq_escape() to use seq_escape_str()
      nfsd: avoid non-flexible API in seq_quote_mem()
      seq_file: drop unused *_escape_mem_ascii()

    Trent Piepho <tpiepho@gmail.com>:
      lib/math/rational.c: fix divide by zero
      lib/math/rational: add Kunit test cases

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/decompressors: fix spelling mistakes
      lib/mpi: fix spelling mistakes

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: memscan() fixlet
      lib: uninline simple_strtoull()

    Matteo Croce <mcroce@microsoft.com>:
      lib/test_string.c: allow module removal

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out kstrtox() and simple_strtox() to a separate header

Subsystem: lz4

    Rajat Asthana <thisisrast7@gmail.com>:
      lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static

    Dimitri John Ledkov <dimitri.ledkov@canonical.com>:
      lib/decompress_unlz4.c: correctly handle zero-padding around initrds.

Subsystem: checkpatch

    Guenter Roeck <linux@roeck-us.net>:
      checkpatch: scripts/spdxcheck.py now requires python3

    Joe Perches <joe@perches.com>:
      checkpatch: improve the indented label test

    Guenter Roeck <linux@roeck-us.net>:
      checkpatch: do not complain about positive return values starting with EPOLL

Subsystem: init

    Andrew Halaney <ahalaney@redhat.com>:
      init: print out unknown kernel parameters

Subsystem: kprobes

    Barry Song <song.bao.hua@hisilicon.com>:
      kprobes: remove duplicated strong free_insn_page in x86 and s390

Subsystem: nilfs2

    Colin Ian King <colin.king@canonical.com>:
      nilfs2: remove redundant continue statement in a while-loop

Subsystem: hfs

    Zhen Lei <thunder.leizhen@huawei.com>:
      hfsplus: remove unnecessary oom message

    Chung-Chiang Cheng <shepjeng@gmail.com>:
      hfsplus: report create_date to kstat.btime

Subsystem: signals

    Al Viro <viro@zeniv.linux.org.uk>:
      x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned

Subsystem: exec

    Alexey Dobriyan <adobriyan@gmail.com>:
      exec: remove checks in __register_bimfmt()

Subsystem: kcov

    Marco Elver <elver@google.com>:
      kcov: add __no_sanitize_coverage to fix noinstr for all architectures

Subsystem: selftests

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "selftests/vm/pkeys: Bug fixes and a new test":
      selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random
      selftests/vm/pkeys: handle negative sys_pkey_alloc() return code
      selftests/vm/pkeys: refill shadow register after implicit kernel write
      selftests/vm/pkeys: exercise x86 XSAVE init state

Subsystem: compress/decompress

    Yu Kuai <yukuai3@huawei.com>:
      lib/decompressors: remove set but not used variabled 'level'

Subsystem: ipc

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "ipc: allocations cleanup", v2:
      ipc sem: use kvmalloc for sem_undo allocation
      ipc: use kmalloc for msg_queue and shmid_kernel

    Manfred Spraul <manfred@colorfullife.com>:
      ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock
      ipc/util.c: use binary search for max_idx

 Documentation/admin-guide/kernel-parameters.txt    |   35 
 Documentation/admin-guide/mm/hugetlbpage.rst       |   11 
 Documentation/admin-guide/mm/memory-hotplug.rst    |   13 
 Documentation/admin-guide/mm/pagemap.rst           |    2 
 Documentation/admin-guide/mm/userfaultfd.rst       |    3 
 Documentation/core-api/kernel-api.rst              |    7 
 Documentation/filesystems/proc.rst                 |   48 
 Documentation/vm/hmm.rst                           |   19 
 Documentation/vm/unevictable-lru.rst               |   33 
 MAINTAINERS                                        |   10 
 arch/alpha/Kconfig                                 |    5 
 arch/alpha/include/asm/pgalloc.h                   |    1 
 arch/alpha/include/asm/pgtable.h                   |    1 
 arch/alpha/include/uapi/asm/mman.h                 |    3 
 arch/alpha/kernel/setup.c                          |    2 
 arch/arc/include/asm/pgalloc.h                     |    2 
 arch/arc/include/asm/pgtable.h                     |    8 
 arch/arm/Kconfig                                   |    3 
 arch/arm/include/asm/pgalloc.h                     |    1 
 arch/arm64/Kconfig                                 |   15 
 arch/arm64/include/asm/hugetlb.h                   |    3 
 arch/arm64/include/asm/memory.h                    |    2 
 arch/arm64/include/asm/page.h                      |    4 
 arch/arm64/include/asm/pgalloc.h                   |    1 
 arch/arm64/include/asm/pgtable.h                   |    2 
 arch/arm64/kernel/setup.c                          |    1 
 arch/arm64/kvm/mmu.c                               |    2 
 arch/arm64/mm/hugetlbpage.c                        |    5 
 arch/arm64/mm/init.c                               |   51 
 arch/arm64/mm/ioremap.c                            |    4 
 arch/arm64/mm/mmu.c                                |   22 
 arch/csky/include/asm/pgalloc.h                    |    2 
 arch/csky/include/asm/pgtable.h                    |    1 
 arch/hexagon/include/asm/pgtable.h                 |    4 
 arch/ia64/Kconfig                                  |    7 
 arch/ia64/include/asm/pal.h                        |    1 
 arch/ia64/include/asm/pgalloc.h                    |    1 
 arch/ia64/include/asm/pgtable.h                    |    1 
 arch/m68k/Kconfig                                  |    5 
 arch/m68k/include/asm/mcf_pgalloc.h                |    2 
 arch/m68k/include/asm/mcf_pgtable.h                |    2 
 arch/m68k/include/asm/motorola_pgalloc.h           |    1 
 arch/m68k/include/asm/motorola_pgtable.h           |    2 
 arch/m68k/include/asm/pgtable_mm.h                 |    1 
 arch/m68k/include/asm/sun3_pgalloc.h               |    1 
 arch/microblaze/Kconfig                            |    4 
 arch/microblaze/include/asm/pgalloc.h              |    2 
 arch/microblaze/include/asm/pgtable.h              |    2 
 arch/mips/Kconfig                                  |   10 
 arch/mips/include/asm/pgalloc.h                    |    1 
 arch/mips/include/asm/pgtable-32.h                 |    1 
 arch/mips/include/asm/pgtable-64.h                 |    1 
 arch/mips/include/uapi/asm/mman.h                  |    3 
 arch/mips/kernel/relocate.c                        |    1 
 arch/mips/sgi-ip22/ip22-reset.c                    |    1 
 arch/mips/sgi-ip32/ip32-reset.c                    |    1 
 arch/nds32/include/asm/pgalloc.h                   |    5 
 arch/nios2/include/asm/pgalloc.h                   |    1 
 arch/nios2/include/asm/pgtable.h                   |    2 
 arch/openrisc/include/asm/pgalloc.h                |    2 
 arch/openrisc/include/asm/pgtable.h                |    1 
 arch/parisc/include/asm/pgalloc.h                  |    1 
 arch/parisc/include/asm/pgtable.h                  |    2 
 arch/parisc/include/uapi/asm/mman.h                |    3 
 arch/parisc/kernel/pdc_chassis.c                   |    1 
 arch/powerpc/Kconfig                               |    6 
 arch/powerpc/include/asm/book3s/pgtable.h          |    1 
 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h   |    5 
 arch/powerpc/include/asm/nohash/32/mmu-8xx.h       |   43 
 arch/powerpc/include/asm/nohash/32/pgtable.h       |    1 
 arch/powerpc/include/asm/nohash/64/pgtable.h       |    2 
 arch/powerpc/include/asm/pgalloc.h                 |    5 
 arch/powerpc/include/asm/pgtable.h                 |    6 
 arch/powerpc/kernel/setup-common.c                 |    1 
 arch/powerpc/platforms/Kconfig.cputype             |    1 
 arch/riscv/Kconfig                                 |    5 
 arch/riscv/include/asm/pgalloc.h                   |    2 
 arch/riscv/include/asm/pgtable.h                   |    2 
 arch/s390/Kconfig                                  |    6 
 arch/s390/include/asm/pgalloc.h                    |    3 
 arch/s390/include/asm/pgtable.h                    |    5 
 arch/s390/kernel/ipl.c                             |    1 
 arch/s390/kernel/kprobes.c                         |    5 
 arch/s390/mm/pgtable.c                             |    2 
 arch/sh/include/asm/pgalloc.h                      |    1 
 arch/sh/include/asm/pgtable.h                      |    2 
 arch/sparc/Kconfig                                 |    5 
 arch/sparc/include/asm/pgalloc_32.h                |    1 
 arch/sparc/include/asm/pgalloc_64.h                |    1 
 arch/sparc/include/asm/pgtable_32.h                |    3 
 arch/sparc/include/asm/pgtable_64.h                |    8 
 arch/sparc/kernel/sstate.c                         |    1 
 arch/sparc/mm/hugetlbpage.c                        |    6 
 arch/sparc/mm/init_64.c                            |    1 
 arch/um/drivers/mconsole_kern.c                    |    1 
 arch/um/include/asm/pgalloc.h                      |    1 
 arch/um/include/asm/pgtable-2level.h               |    1 
 arch/um/include/asm/pgtable-3level.h               |    1 
 arch/um/kernel/um_arch.c                           |    1 
 arch/x86/Kconfig                                   |   17 
 arch/x86/include/asm/desc.h                        |    1 
 arch/x86/include/asm/pgalloc.h                     |    2 
 arch/x86/include/asm/pgtable_types.h               |    2 
 arch/x86/kernel/cpu/mshyperv.c                     |    1 
 arch/x86/kernel/kprobes/core.c                     |    6 
 arch/x86/kernel/setup.c                            |    1 
 arch/x86/mm/init_64.c                              |   21 
 arch/x86/mm/pgtable.c                              |   34 
 arch/x86/purgatory/purgatory.c                     |    2 
 arch/x86/xen/enlighten.c                           |    1 
 arch/xtensa/include/asm/pgalloc.h                  |    2 
 arch/xtensa/include/asm/pgtable.h                  |    1 
 arch/xtensa/include/uapi/asm/mman.h                |    3 
 arch/xtensa/platforms/iss/setup.c                  |    1 
 drivers/block/zram/zram_drv.h                      |    2 
 drivers/bus/brcmstb_gisb.c                         |    1 
 drivers/char/ipmi/ipmi_msghandler.c                |    1 
 drivers/clk/analogbits/wrpll-cln28hpc.c            |    4 
 drivers/edac/altera_edac.c                         |    1 
 drivers/firmware/google/gsmi.c                     |    1 
 drivers/gpu/drm/nouveau/include/nvif/if000c.h      |    1 
 drivers/gpu/drm/nouveau/nouveau_svm.c              |  162 ++-
 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h      |    1 
 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c |    6 
 drivers/hv/vmbus_drv.c                             |    1 
 drivers/hwtracing/coresight/coresight-cpu-debug.c  |    1 
 drivers/leds/trigger/ledtrig-activity.c            |    1 
 drivers/leds/trigger/ledtrig-heartbeat.c           |    1 
 drivers/leds/trigger/ledtrig-panic.c               |    1 
 drivers/misc/bcm-vk/bcm_vk_dev.c                   |    1 
 drivers/misc/ibmasm/heartbeat.c                    |    1 
 drivers/misc/pvpanic/pvpanic.c                     |    1 
 drivers/net/ipa/ipa_smp2p.c                        |    1 
 drivers/parisc/power.c                             |    1 
 drivers/power/reset/ltc2952-poweroff.c             |    1 
 drivers/remoteproc/remoteproc_core.c               |    1 
 drivers/s390/char/con3215.c                        |    1 
 drivers/s390/char/con3270.c                        |    1 
 drivers/s390/char/sclp.c                           |    1 
 drivers/s390/char/sclp_con.c                       |    1 
 drivers/s390/char/sclp_vt220.c                     |    1 
 drivers/s390/char/zcore.c                          |    1 
 drivers/soc/bcm/brcmstb/pm/pm-arm.c                |    1 
 drivers/staging/olpc_dcon/olpc_dcon.c              |    1 
 drivers/video/fbdev/hyperv_fb.c                    |    1 
 drivers/virtio/virtio_mem.c                        |    2 
 fs/Kconfig                                         |   15 
 fs/exec.c                                          |    3 
 fs/hfsplus/inode.c                                 |    5 
 fs/hfsplus/xattr.c                                 |    1 
 fs/nfsd/nfs4state.c                                |    2 
 fs/nilfs2/btree.c                                  |    1 
 fs/open.c                                          |   13 
 fs/proc/base.c                                     |    6 
 fs/proc/fd.c                                       |   20 
 fs/proc/kcore.c                                    |  136 ++
 fs/proc/task_mmu.c                                 |   34 
 fs/seq_file.c                                      |   43 
 fs/userfaultfd.c                                   |   15 
 include/asm-generic/bug.h                          |    3 
 include/linux/ascii85.h                            |    3 
 include/linux/bootmem_info.h                       |   68 +
 include/linux/compat.h                             |    2 
 include/linux/compiler-clang.h                     |   17 
 include/linux/compiler-gcc.h                       |    6 
 include/linux/compiler_types.h                     |    2 
 include/linux/huge_mm.h                            |   74 -
 include/linux/hugetlb.h                            |   80 +
 include/linux/hugetlb_cgroup.h                     |   19 
 include/linux/kcore.h                              |    3 
 include/linux/kernel.h                             |  227 ----
 include/linux/kprobes.h                            |    1 
 include/linux/kstrtox.h                            |  155 ++
 include/linux/memblock.h                           |    4 
 include/linux/memory_hotplug.h                     |   27 
 include/linux/mempolicy.h                          |    9 
 include/linux/memremap.h                           |    2 
 include/linux/migrate.h                            |   27 
 include/linux/mm.h                                 |   18 
 include/linux/mm_types.h                           |    2 
 include/linux/mmu_notifier.h                       |   26 
 include/linux/mmzone.h                             |   27 
 include/linux/mpi.h                                |    4 
 include/linux/page-flags.h                         |   22 
 include/linux/panic.h                              |   98 +
 include/linux/panic_notifier.h                     |   12 
 include/linux/pgtable.h                            |   44 
 include/linux/rmap.h                               |   13 
 include/linux/seq_file.h                           |   10 
 include/linux/shmem_fs.h                           |   19 
 include/linux/signal.h                             |    2 
 include/linux/string.h                             |    7 
 include/linux/string_helpers.h                     |   31 
 include/linux/sunrpc/cache.h                       |    1 
 include/linux/swap.h                               |   19 
 include/linux/swapops.h                            |  171 +--
 include/linux/thread_info.h                        |    1 
 include/linux/userfaultfd_k.h                      |    5 
 include/linux/vmalloc.h                            |   15 
 include/linux/zbud.h                               |   23 
 include/trace/events/vmscan.h                      |   41 
 include/uapi/asm-generic/mman-common.h             |    3 
 include/uapi/linux/mempolicy.h                     |    1 
 include/uapi/linux/userfaultfd.h                   |    7 
 init/main.c                                        |   42 
 ipc/msg.c                                          |    6 
 ipc/sem.c                                          |   25 
 ipc/shm.c                                          |    6 
 ipc/util.c                                         |   44 
 ipc/util.h                                         |    3 
 kernel/hung_task.c                                 |    1 
 kernel/kexec_core.c                                |    1 
 kernel/kprobes.c                                   |    2 
 kernel/panic.c                                     |    1 
 kernel/rcu/tree.c                                  |    2 
 kernel/signal.c                                    |   14 
 kernel/sysctl.c                                    |    4 
 kernel/trace/trace.c                               |    1 
 lib/Kconfig.debug                                  |   12 
 lib/decompress_bunzip2.c                           |    6 
 lib/decompress_unlz4.c                             |    8 
 lib/decompress_unlzo.c                             |    3 
 lib/decompress_unxz.c                              |    2 
 lib/decompress_unzstd.c                            |    4 
 lib/kstrtox.c                                      |    5 
 lib/lz4/lz4_decompress.c                           |    2 
 lib/math/Makefile                                  |    1 
 lib/math/rational-test.c                           |   56 +
 lib/math/rational.c                                |   16 
 lib/mpi/longlong.h                                 |    4 
 lib/mpi/mpicoder.c                                 |    6 
 lib/mpi/mpiutil.c                                  |    2 
 lib/parser.c                                       |    1 
 lib/string.c                                       |    2 
 lib/string_helpers.c                               |  142 +-
 lib/test-string_helpers.c                          |  157 ++-
 lib/test_hmm.c                                     |  127 ++
 lib/test_hmm_uapi.h                                |    2 
 lib/test_string.c                                  |    5 
 lib/vsprintf.c                                     |    1 
 lib/xz/xz_dec_bcj.c                                |    2 
 lib/xz/xz_dec_lzma2.c                              |    8 
 lib/zlib_inflate/inffast.c                         |    2 
 lib/zstd/huf.h                                     |    2 
 mm/Kconfig                                         |   16 
 mm/Makefile                                        |    2 
 mm/bootmem_info.c                                  |  127 ++
 mm/compaction.c                                    |   20 
 mm/debug_vm_pgtable.c                              |  109 --
 mm/gup.c                                           |   58 +
 mm/hmm.c                                           |   12 
 mm/huge_memory.c                                   |  269 ++---
 mm/hugetlb.c                                       |  369 +++++--
 mm/hugetlb_vmemmap.c                               |  332 ++++++
 mm/hugetlb_vmemmap.h                               |   53 -
 mm/internal.h                                      |   29 
 mm/kfence/core.c                                   |    4 
 mm/khugepaged.c                                    |   20 
 mm/madvise.c                                       |   66 +
 mm/mapping_dirty_helpers.c                         |    2 
 mm/memblock.c                                      |   28 
 mm/memcontrol.c                                    |    4 
 mm/memory-failure.c                                |   38 
 mm/memory.c                                        |  239 +++-
 mm/memory_hotplug.c                                |  161 ---
 mm/mempolicy.c                                     |  323 ++----
 mm/migrate.c                                       |  268 +----
 mm/mlock.c                                         |   12 
 mm/mmap_lock.c                                     |   59 -
 mm/mprotect.c                                      |   18 
 mm/nommu.c                                         |    5 
 mm/oom_kill.c                                      |    2 
 mm/page_alloc.c                                    |    5 
 mm/page_vma_mapped.c                               |   15 
 mm/rmap.c                                          |  644 +++++++++---
 mm/shmem.c                                         |  125 --
 mm/sparse-vmemmap.c                                |  432 +++++++-
 mm/sparse.c                                        |    1 
 mm/swap.c                                          |    2 
 mm/swapfile.c                                      |    2 
 mm/userfaultfd.c                                   |  249 ++--
 mm/util.c                                          |   40 
 mm/vmalloc.c                                       |   37 
 mm/vmscan.c                                        |   20 
 mm/workingset.c                                    |   10 
 mm/z3fold.c                                        |   39 
 mm/zbud.c                                          |  235 ++--
 mm/zsmalloc.c                                      |    5 
 mm/zswap.c                                         |   26 
 scripts/checkpatch.pl                              |   16 
 tools/testing/selftests/vm/.gitignore              |    3 
 tools/testing/selftests/vm/Makefile                |    5 
 tools/testing/selftests/vm/hmm-tests.c             |  158 +++
 tools/testing/selftests/vm/khugepaged.c            |    4 
 tools/testing/selftests/vm/madv_populate.c         |  342 ++++++
 tools/testing/selftests/vm/pkey-x86.h              |    1 
 tools/testing/selftests/vm/protection_keys.c       |   85 +
 tools/testing/selftests/vm/run_vmtests.sh          |   16 
 tools/testing/selftests/vm/userfaultfd.c           | 1094 ++++++++++-----------
 299 files changed, 6277 insertions(+), 3183 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-06-29  2:32 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-06-29  2:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2.

Subsystems affected by this patch series:

  mm/gup
  mm/pagealloc
  kthread
  ia64
  scripts
  ntfs
  squashfs
  ocfs2
  z
  kernel/watchdog
  mm/slab
  mm/slub
  mm/kmemleak
  mm/dax
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/bootmem
  mm/dma
  mm/tracing
  mm/vmalloc
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/memory-failure

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mm/gup: fix try_grab_compound_head() race with split_huge_page()

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc: fix memory map initialization for descending nodes

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: correct return value of populated elements if bulk array is populated

Subsystem: kthread

    Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
      kthread: switch to new kerneldoc syntax for named variable macro argument

    Petr Mladek <pmladek@suse.com>:
      kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: headers: drop duplicated words

    Arnd Bergmann <arnd@arndb.de>:
      ia64: mca_drv: fix incorrect array size calculation

Subsystem: scripts

    "Steven Rostedt (VMware)" <rostedt@goodmis.org>:
    Patch series "streamline_config.pl: Fix Perl spacing":
      streamline_config.pl: make spacing consistent
      streamline_config.pl: add softtabstop=4 for vim users

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
      ntfs: fix validity check for file name attribute

Subsystem: squashfs

    Vincent Whitchurch <vincent.whitchurch@axis.com>:
      squashfs: add option to panic on errors

Subsystem: ocfs2

    Yang Yingliang <yangyingliang@huawei.com>:
      ocfs2: remove unnecessary INIT_LIST_HEAD()

Subsystem: z

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: fix snprintf() checking

    Colin Ian King <colin.king@canonical.com>:
      ocfs2: remove redundant assignment to pointer queue

    Wan Jiabing <wanjiabing@vivo.com>:
      ocfs2: remove repeated uptodate check for buffer

    Chen Huang <chenhuang5@huawei.com>:
      ocfs2: replace simple_strtoull() with kstrtoull()

    Colin Ian King <colin.king@canonical.com>:
      ocfs2: remove redundant initialization of variable ret

Subsystem: kernel/watchdog

    Wang Qing <wangqing@vivo.com>:
      kernel: watchdog: modify the explanation related to watchdog thread
      doc: watchdog: modify the explanation related to watchdog thread
      doc: watchdog: modify the doc related to "watchdog/%u"

Subsystem: mm/slab

    gumingtao <gumingtao1225@gmail.com>:
      slab: use __func__ to trace function name

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      kunit: make test->lock irq safe

    Oliver Glitta <glittao@gmail.com>:
      mm/slub, kunit: add a KUnit test for SLUB debugging functionality
      slub: remove resiliency_test() function

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm, slub: change run-time assertion in kmalloc_index() to compile-time

    Stephen Boyd <swboyd@chromium.org>:
      slub: restore slub_debug=- behavior
      slub: actually use 'message' in restore_bytes()

    Joe Perches <joe@perches.com>:
      slub: indicate slab_fix() uses printf formats

    Stephen Boyd <swboyd@chromium.org>:
      slub: force on no_hash_pointers when slub_debug is enabled

    Faiyaz Mohammed <faiyazm@codeaurora.org>:
      mm: slub: move sysfs slab alloc/free interfaces to debugfs

    Georgi Djakov <quic_c_gdjako@quicinc.com>:
      mm/slub: add taint after the errors are printed

Subsystem: mm/kmemleak

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/kmemleak: fix possible wrong memory scanning period

Subsystem: mm/dax

    Jan Kara <jack@suse.cz>:
      dax: fix ENOMEM handling in grab_mapping_entry()

Subsystem: mm/debug

    Tang Bin <tangbin@cmss.chinamobile.com>:
      tools/vm/page_owner_sort.c: check malloc() return

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage()

    Nicolas Saenz Julienne <nsaenzju@redhat.com>:
      mm: mmap_lock: use local locks instead of disabling preemption

    Gavin Shan <gshan@redhat.com>:
    Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4:
      mm/page_reporting: fix code style in __page_reporting_request()
      mm/page_reporting: export reporting order as module parameter
      mm/page_reporting: allow driver to specify reporting order
      virtio_balloon: specify page reporting order if needed

Subsystem: mm/pagecache

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: page-writeback: kill get_writeback_state() comments

    Chi Wu <wuchi.zero@gmail.com>:
      mm/page-writeback: Fix performance when BDI's share of ratio is 0.
      mm/page-writeback: update the comment of Dirty position control
      mm/page-writeback: use __this_cpu_inc() in account_page_dirtied()

    Roman Gushchin <guro@fb.com>:
    Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9:
      writeback, cgroup: do not switch inodes with I_WILL_FREE flag
      writeback, cgroup: add smp_mb() to cgroup_writeback_umount()
      writeback, cgroup: increment isw_nr_in_flight before grabbing an inode
      writeback, cgroup: switch to rcu_work API in inode_switch_wbs()
      writeback, cgroup: keep list of inodes attached to bdi_writeback
      writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn()
      writeback, cgroup: support switching multiple inodes at once
      writeback, cgroup: release dying cgwbs by switching attached inodes

    Christoph Hellwig <hch@lst.de>:
    Patch series "remove the implicit .set_page_dirty default":
      fs: unexport __set_page_dirty
      fs: move ramfs_aops to libfs
      mm: require ->set_page_dirty to be explicitly wired up

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Further set_page_dirty cleanups":
      mm/writeback: move __set_page_dirty() to core mm
      mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers
      iomap: use __set_page_dirty_nobuffers
      fs: remove anon_set_page_dirty()
      fs: remove noop_set_page_dirty()
      mm: move page dirtying prototypes from mm.h

Subsystem: mm/gup

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2:
      mm/gup_benchmark: support threading

    Andrea Arcangeli <aarcange@redhat.com>:
      mm: gup: allow FOLL_PIN to scale in SMP
      mm: gup: pack has_pinned in MMF_HAS_PINNED

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: pagewalk: fix walk for hugepage tables

Subsystem: mm/swap

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "close various race windows for swap", v6:
      mm/swapfile: use percpu_ref to serialize against concurrent swapoff
      swap: fix do_swap_page() race with swapoff
      mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info()
      mm/shmem: fix shmem_swapin() race with swapoff
    Patch series "Cleanups for swap", v2:
      mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION
      mm/swap: remove unused local variable nr_shadows
      mm/swap_slots.c: delete meaningless forward declarations

    Huang Ying <ying.huang@intel.com>:
      mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info()
      mm: free idle swap cache page after COW
      swap: check mapping_empty() for swap cache before being freed

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
    Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6:
      mm/memcg: move mod_objcg_state() to memcontrol.c
      mm/memcg: cache vmstat data in percpu memcg_stock_pcp
      mm/memcg: improve refill_obj_stock() performance
      mm/memcg: optimize user context object stock access
    Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4:
      mm: memcg/slab: properly set up gfp flags for objcg pointer array
      mm: memcg/slab: create a new set of kmalloc-cg-<n> caches
      mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix root_mem_cgroup charging
    Patch series "memcontrol code cleanup and simplification", v3:
      mm: memcontrol: fix page charging in page replacement
      mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm
      mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec
      mm: memcontrol: simplify lruvec_holds_page_lru_lock
      mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec
      mm: memcontrol: simplify the logic of objcg pinning memcg
      mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock
      mm: vmscan: remove noinline_for_stack

    wenhuizhang <wenhui@gwmail.gwu.edu>:
      memcontrol: use flexible-array member

    Dan Schatzberg <schatzberg.dan@gmail.com>:
    Patch series "Charge loop device i/o to issuing cgroup", v14:
      loop: use worker per cgroup instead of kworker
      mm: charge active memcg when no mm is set
      loop: charge i/o to mem and blk cg

    Huilong Deng <denghuilong@cdjrlc.com>:
      mm: memcontrol: remove trailing semicolon in macros

Subsystem: mm/pagemap

    David Hildenbrand <david@redhat.com>:
    Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE":
      perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC
      binfmt: remove in-tree usage of MAP_EXECUTABLE
      mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff()

    Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>:
      mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap: introduce unlock_range() for code cleanup
      mm/mmap: use find_vma_intersection() in do_mmap() for overlap

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm/memory.c: fix comment of finish_mkwrite_fault()

    Liam Howlett <liam.howlett@oracle.com>:
    Patch series "mm: Add vma_lookup()", v2:
      mm: add vma_lookup(), update find_vma_intersection() comments
      drm/i915/selftests: use vma_lookup() in __igt_mmap()
      arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma()
      arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection()
      arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection()
      arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma()
      arch/mips/kernel/traps: use vma_lookup() instead of find_vma()
      arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush()
      x86/sgx: use vma_lookup() in sgx_encl_find()
      virt/kvm: use vma_lookup() instead of find_vma_intersection()
      vfio: use vma_lookup() instead of find_vma_intersection()
      net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive()
      drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages()
      media: videobuf2: use vma_lookup() in get_vaddr_frames()
      misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma()
      kernel/events/uprobes: use vma_lookup() in find_active_uprobe()
      lib/test_hmm: use vma_lookup() in dmirror_migrate()
      mm/ksm: use vma_lookup() in find_mergeable_vma()
      mm/migrate: use vma_lookup() in do_pages_stat_array()
      mm/mremap: use vma_lookup() in vma_to_resize()
      mm/memory.c: use vma_lookup() in __access_remote_vm()
      mm/mempolicy: use vma_lookup() in __access_remote_vm()

    Chen Li <chenli@uniontech.com>:
      mm: update legacy flush_tlb_* to use vma

Subsystem: mm/mprotect

    Peter Collingbourne <pcc@google.com>:
      mm: improve mprotect(R|W) efficiency on pages referenced once

Subsystem: mm/bootmem

    Souptick Joarder <jrdr.linux@gmail.com>:
      h8300: remove unused variable

Subsystem: mm/dma

    YueHaibing <yuehaibing@huawei.com>:
      mm/dmapool: use DEVICE_ATTR_RO macro

Subsystem: mm/tracing

    Vincent Whitchurch <vincent.whitchurch@axis.com>:
      mm, tracing: unify PFN format strings

Subsystem: mm/vmalloc

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
    Patch series "vmalloc() vs bulk allocator", v2:
      mm/page_alloc: add an alloc_pages_bulk_array_node() helper
      mm/vmalloc: switch to bulk allocator in __vmalloc_area_node()
      mm/vmalloc: print a warning message first on failure
      mm/vmalloc: remove quoted strings split across lines

    Uladzislau Rezki <urezki@gmail.com>:
      mm/vmalloc: fallback to a single page allocator

    Rafael Aquini <aquini@redhat.com>:
      mm: vmalloc: add cond_resched() in __vunmap()

Subsystem: mm/kasan

    Alexander Potapenko <glider@google.com>:
      printk: introduce dump_stack_lvl()
      kasan: use dump_stack_lvl(KERN_ERR) to print stacks

    David Gow <davidgow@google.com>:
      kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL()

    Daniel Axtens <dja@axtens.net>:
    Patch series "KASAN core changes for ppc64 radix KASAN", v16:
      kasan: allow an architecture to disable inline instrumentation
      kasan: allow architectures to provide an outline readiness check
      mm: define default MAX_PTRS_PER_* in include/pgtable.h
      kasan: use MAX_PTRS_PER_* for early shadow tables

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
    Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4:
      kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY
      kasan: integrate the common part of two KASAN tag-based modes
      kasan: add memory corruption identification support for hardware tag-based mode

Subsystem: mm/initialization

    Jungseung Lee <js07.lee@samsung.com>:
      mm: report which part of mem is being freed on initmem case

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/mmzone.h: simplify is_highmem_idx()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Constify struct page arguments":
      mm: make __dump_page static

    Aaron Tomlin <atomlin@redhat.com>:
      mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug: factor PagePoisoned out of __dump_page
      mm/page_owner: constify dump_page_owner
      mm: make compound_head const-preserving
      mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype
      mm: constify page_count and page_ref_count
      mm: optimise nth_page for contiguous memmap

    Heiner Kallweit <hkallweit1@gmail.com>:
      mm/page_alloc: switch to pr_debug

    Andrii Nakryiko <andrii@kernel.org>:
      kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: split per cpu page lists and zone stats
      mm/page_alloc: convert per-cpu list protection to local_lock
      mm/vmstat: convert NUMA statistics to basic NUMA counters
      mm/vmstat: inline NUMA event counter updates
      mm/page_alloc: batch the accounting updates in the bulk allocator
      mm/page_alloc: reduce duration that IRQs are disabled for VM counters
      mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok
      mm/page_alloc: avoid conflating IRQs disabled with zone->lock
      mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok

    Minchan Kim <minchan@kernel.org>:
      mm: page_alloc: dump migrate-failed pages only at -EBUSY

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2:
      mm/page_alloc: delete vm.percpu_pagelist_fraction
      mm/page_alloc: disassociate the pcp->high from pcp->batch
      mm/page_alloc: adjust pcp->high after CPU hotplug events
      mm/page_alloc: scale the number of pages that are batch freed
      mm/page_alloc: limit the number of pages on PCP lists when reclaim is active
      mm/page_alloc: introduce vm.percpu_pagelist_high_fraction

    Dong Aisheng <aisheng.dong@nxp.com>:
      mm: drop SECTION_SHIFT in code comments
      mm/page_alloc: improve memmap_pages dbg msg

    Liu Shixin <liushixin2@huawei.com>:
      mm/page_alloc: fix counting of managed_pages

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Allow high order pages to be stored on PCP", v2:
      mm/page_alloc: move free_the_page

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "Remove DISCONTIGMEM memory model", v3:
      alpha: remove DISCONTIGMEM and NUMA
      arc: update comment about HIGHMEM implementation
      arc: remove support for DISCONTIGMEM
      m68k: remove support for DISCONTIGMEM
      mm: remove CONFIG_DISCONTIGMEM
      arch, mm: remove stale mentions of DISCONIGMEM
      docs: remove description of DISCONTIGMEM
      mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA
      mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: allow high-order pages to be stored on the per-cpu lists
      mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: send SIGBUS with error virutal address
      mm,hwpoison: make get_hwpoison_page() call get_any_page()

 Documentation/admin-guide/kernel-parameters.txt    |    6 
 Documentation/admin-guide/lockup-watchdogs.rst     |    4 
 Documentation/admin-guide/sysctl/kernel.rst        |   10 
 Documentation/admin-guide/sysctl/vm.rst            |   52 -
 Documentation/dev-tools/kasan.rst                  |    9 
 Documentation/vm/memory-model.rst                  |   45 
 arch/alpha/Kconfig                                 |   22 
 arch/alpha/include/asm/machvec.h                   |    6 
 arch/alpha/include/asm/mmzone.h                    |  100 --
 arch/alpha/include/asm/pgtable.h                   |    4 
 arch/alpha/include/asm/topology.h                  |   39 
 arch/alpha/kernel/core_marvel.c                    |   53 -
 arch/alpha/kernel/core_wildfire.c                  |   29 
 arch/alpha/kernel/pci_iommu.c                      |   29 
 arch/alpha/kernel/proto.h                          |    8 
 arch/alpha/kernel/setup.c                          |   16 
 arch/alpha/kernel/sys_marvel.c                     |    5 
 arch/alpha/kernel/sys_wildfire.c                   |    5 
 arch/alpha/mm/Makefile                             |    2 
 arch/alpha/mm/init.c                               |    3 
 arch/alpha/mm/numa.c                               |  223 ----
 arch/arc/Kconfig                                   |   13 
 arch/arc/include/asm/mmzone.h                      |   40 
 arch/arc/kernel/troubleshoot.c                     |    8 
 arch/arc/mm/init.c                                 |   21 
 arch/arm/include/asm/tlbflush.h                    |   13 
 arch/arm/mm/tlb-v6.S                               |    2 
 arch/arm/mm/tlb-v7.S                               |    2 
 arch/arm64/Kconfig                                 |    2 
 arch/arm64/kvm/mmu.c                               |    2 
 arch/h8300/kernel/setup.c                          |    2 
 arch/ia64/Kconfig                                  |    2 
 arch/ia64/include/asm/pal.h                        |    2 
 arch/ia64/include/asm/spinlock.h                   |    2 
 arch/ia64/include/asm/uv/uv_hub.h                  |    2 
 arch/ia64/kernel/efi_stub.S                        |    2 
 arch/ia64/kernel/mca_drv.c                         |    2 
 arch/ia64/kernel/topology.c                        |    5 
 arch/ia64/mm/numa.c                                |    5 
 arch/m68k/Kconfig.cpu                              |   10 
 arch/m68k/include/asm/mmzone.h                     |   10 
 arch/m68k/include/asm/page.h                       |    2 
 arch/m68k/include/asm/page_mm.h                    |   35 
 arch/m68k/include/asm/tlbflush.h                   |    2 
 arch/m68k/kernel/sys_m68k.c                        |    4 
 arch/m68k/mm/init.c                                |   20 
 arch/mips/Kconfig                                  |    2 
 arch/mips/include/asm/mmzone.h                     |    8 
 arch/mips/include/asm/page.h                       |    2 
 arch/mips/kernel/traps.c                           |    4 
 arch/mips/mm/init.c                                |    7 
 arch/nds32/include/asm/memory.h                    |    6 
 arch/openrisc/include/asm/tlbflush.h               |    2 
 arch/powerpc/Kconfig                               |    2 
 arch/powerpc/include/asm/mmzone.h                  |    4 
 arch/powerpc/kernel/setup_64.c                     |    2 
 arch/powerpc/kernel/smp.c                          |    2 
 arch/powerpc/kexec/core.c                          |    4 
 arch/powerpc/kvm/book3s_hv.c                       |    4 
 arch/powerpc/kvm/book3s_hv_uvmem.c                 |    2 
 arch/powerpc/mm/Makefile                           |    2 
 arch/powerpc/mm/mem.c                              |    4 
 arch/riscv/Kconfig                                 |    2 
 arch/s390/Kconfig                                  |    2 
 arch/s390/include/asm/pgtable.h                    |    2 
 arch/sh/include/asm/mmzone.h                       |    4 
 arch/sh/kernel/topology.c                          |    2 
 arch/sh/mm/Kconfig                                 |    2 
 arch/sh/mm/init.c                                  |    2 
 arch/sparc/Kconfig                                 |    2 
 arch/sparc/include/asm/mmzone.h                    |    4 
 arch/sparc/kernel/smp_64.c                         |    2 
 arch/sparc/mm/init_64.c                            |   12 
 arch/x86/Kconfig                                   |    2 
 arch/x86/ia32/ia32_aout.c                          |    4 
 arch/x86/kernel/cpu/mce/core.c                     |   13 
 arch/x86/kernel/cpu/sgx/encl.h                     |    4 
 arch/x86/kernel/setup_percpu.c                     |    6 
 arch/x86/mm/init_32.c                              |    4 
 arch/xtensa/include/asm/page.h                     |    4 
 arch/xtensa/include/asm/tlbflush.h                 |    4 
 drivers/base/node.c                                |   18 
 drivers/block/loop.c                               |  270 ++++-
 drivers/block/loop.h                               |   15 
 drivers/dax/device.c                               |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c            |    4 
 drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c |    2 
 drivers/media/common/videobuf2/frame_vector.c      |    2 
 drivers/misc/sgi-gru/grufault.c                    |    4 
 drivers/vfio/vfio_iommu_type1.c                    |    2 
 drivers/virtio/virtio_balloon.c                    |   17 
 fs/adfs/inode.c                                    |    1 
 fs/affs/file.c                                     |    2 
 fs/bfs/file.c                                      |    1 
 fs/binfmt_aout.c                                   |    4 
 fs/binfmt_elf.c                                    |    2 
 fs/binfmt_elf_fdpic.c                              |   11 
 fs/binfmt_flat.c                                   |    2 
 fs/block_dev.c                                     |    1 
 fs/buffer.c                                        |   25 
 fs/configfs/inode.c                                |    8 
 fs/dax.c                                           |    3 
 fs/ecryptfs/mmap.c                                 |   13 
 fs/exfat/inode.c                                   |    1 
 fs/ext2/inode.c                                    |    4 
 fs/ext4/inode.c                                    |    2 
 fs/fat/inode.c                                     |    1 
 fs/fs-writeback.c                                  |  366 +++++---
 fs/fuse/dax.c                                      |    3 
 fs/gfs2/aops.c                                     |    2 
 fs/gfs2/meta_io.c                                  |    2 
 fs/hfs/inode.c                                     |    2 
 fs/hfsplus/inode.c                                 |    2 
 fs/hpfs/file.c                                     |    1 
 fs/iomap/buffered-io.c                             |   27 
 fs/jfs/inode.c                                     |    1 
 fs/kernfs/inode.c                                  |    8 
 fs/libfs.c                                         |   44 
 fs/minix/inode.c                                   |    1 
 fs/nilfs2/mdt.c                                    |    1 
 fs/ntfs/inode.c                                    |    2 
 fs/ocfs2/aops.c                                    |    4 
 fs/ocfs2/cluster/heartbeat.c                       |    7 
 fs/ocfs2/cluster/nodemanager.c                     |    2 
 fs/ocfs2/dlm/dlmmaster.c                           |    2 
 fs/ocfs2/filecheck.c                               |    6 
 fs/ocfs2/stackglue.c                               |    8 
 fs/omfs/file.c                                     |    1 
 fs/proc/task_mmu.c                                 |    2 
 fs/ramfs/inode.c                                   |    9 
 fs/squashfs/block.c                                |    5 
 fs/squashfs/squashfs_fs_sb.h                       |    1 
 fs/squashfs/super.c                                |   86 +
 fs/sysv/itree.c                                    |    1 
 fs/udf/file.c                                      |    1 
 fs/udf/inode.c                                     |    1 
 fs/ufs/inode.c                                     |    1 
 fs/xfs/xfs_aops.c                                  |    4 
 fs/zonefs/super.c                                  |    4 
 include/asm-generic/memory_model.h                 |   37 
 include/asm-generic/pgtable-nop4d.h                |    1 
 include/asm-generic/topology.h                     |    2 
 include/kunit/test.h                               |    5 
 include/linux/backing-dev-defs.h                   |   20 
 include/linux/cpuhotplug.h                         |    2 
 include/linux/fs.h                                 |    6 
 include/linux/gfp.h                                |   13 
 include/linux/iomap.h                              |    1 
 include/linux/kasan.h                              |    7 
 include/linux/kernel.h                             |    2 
 include/linux/kthread.h                            |    2 
 include/linux/memblock.h                           |    6 
 include/linux/memcontrol.h                         |   60 -
 include/linux/mm.h                                 |   53 -
 include/linux/mm_types.h                           |   10 
 include/linux/mman.h                               |    2 
 include/linux/mmdebug.h                            |    3 
 include/linux/mmzone.h                             |   96 +-
 include/linux/page-flags.h                         |   10 
 include/linux/page_owner.h                         |    6 
 include/linux/page_ref.h                           |    4 
 include/linux/page_reporting.h                     |    3 
 include/linux/pageblock-flags.h                    |    2 
 include/linux/pagemap.h                            |    4 
 include/linux/pgtable.h                            |   22 
 include/linux/printk.h                             |    5 
 include/linux/sched/coredump.h                     |    8 
 include/linux/slab.h                               |   59 +
 include/linux/swap.h                               |   19 
 include/linux/swapops.h                            |    5 
 include/linux/vmstat.h                             |   69 -
 include/linux/writeback.h                          |    1 
 include/trace/events/cma.h                         |    4 
 include/trace/events/filemap.h                     |    2 
 include/trace/events/kmem.h                        |   12 
 include/trace/events/page_pool.h                   |    4 
 include/trace/events/pagemap.h                     |    4 
 include/trace/events/vmscan.h                      |    2 
 kernel/cgroup/cgroup.c                             |    1 
 kernel/crash_core.c                                |    4 
 kernel/events/core.c                               |    2 
 kernel/events/uprobes.c                            |    4 
 kernel/fork.c                                      |    1 
 kernel/kthread.c                                   |   19 
 kernel/sysctl.c                                    |   16 
 kernel/watchdog.c                                  |   12 
 lib/Kconfig.debug                                  |   15 
 lib/Kconfig.kasan                                  |   16 
 lib/Makefile                                       |    1 
 lib/dump_stack.c                                   |   20 
 lib/kunit/test.c                                   |   18 
 lib/slub_kunit.c                                   |  152 +++
 lib/test_hmm.c                                     |    5 
 lib/test_kasan.c                                   |   11 
 lib/vsprintf.c                                     |    2 
 mm/Kconfig                                         |   38 
 mm/backing-dev.c                                   |   66 +
 mm/compaction.c                                    |    2 
 mm/debug.c                                         |   27 
 mm/debug_vm_pgtable.c                              |   63 +
 mm/dmapool.c                                       |    5 
 mm/filemap.c                                       |    2 
 mm/gup.c                                           |   81 +
 mm/hugetlb.c                                       |    2 
 mm/internal.h                                      |    9 
 mm/kasan/Makefile                                  |    4 
 mm/kasan/common.c                                  |    6 
 mm/kasan/generic.c                                 |    3 
 mm/kasan/hw_tags.c                                 |   22 
 mm/kasan/init.c                                    |    6 
 mm/kasan/kasan.h                                   |   12 
 mm/kasan/report.c                                  |    6 
 mm/kasan/report_hw_tags.c                          |    5 
 mm/kasan/report_sw_tags.c                          |   45 
 mm/kasan/report_tags.c                             |   51 +
 mm/kasan/shadow.c                                  |    6 
 mm/kasan/sw_tags.c                                 |   45 
 mm/kasan/tags.c                                    |   59 +
 mm/kfence/kfence_test.c                            |    5 
 mm/kmemleak.c                                      |   18 
 mm/ksm.c                                           |    6 
 mm/memblock.c                                      |    8 
 mm/memcontrol.c                                    |  385 ++++++--
 mm/memory-failure.c                                |  344 +++++--
 mm/memory.c                                        |   22 
 mm/memory_hotplug.c                                |    6 
 mm/mempolicy.c                                     |    4 
 mm/migrate.c                                       |    4 
 mm/mmap.c                                          |   54 -
 mm/mmap_lock.c                                     |   33 
 mm/mprotect.c                                      |   52 +
 mm/mremap.c                                        |    5 
 mm/nommu.c                                         |    2 
 mm/page-writeback.c                                |   89 +
 mm/page_alloc.c                                    |  950 +++++++++++++--------
 mm/page_ext.c                                      |    2 
 mm/page_owner.c                                    |    2 
 mm/page_reporting.c                                |   19 
 mm/page_reporting.h                                |    5 
 mm/pagewalk.c                                      |   58 +
 mm/shmem.c                                         |   18 
 mm/slab.h                                          |   24 
 mm/slab_common.c                                   |   60 -
 mm/slub.c                                          |  420 +++++----
 mm/sparse.c                                        |    2 
 mm/swap.c                                          |    4 
 mm/swap_slots.c                                    |    2 
 mm/swap_state.c                                    |   20 
 mm/swapfile.c                                      |  177 +--
 mm/vmalloc.c                                       |  181 ++--
 mm/vmscan.c                                        |   43 
 mm/vmstat.c                                        |  282 ++----
 mm/workingset.c                                    |    2 
 net/ipv4/tcp.c                                     |    4 
 scripts/kconfig/streamline_config.pl               |   76 -
 scripts/link-vmlinux.sh                            |    4 
 scripts/spelling.txt                               |   16 
 tools/testing/selftests/vm/gup_test.c              |   96 +-
 tools/vm/page_owner_sort.c                         |    4 
 virt/kvm/kvm_main.c                                |    2 
 260 files changed, 3989 insertions(+), 2996 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-06-25  1:38 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-06-25  1:38 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6.

Subsystems affected by this patch series:

  mm/thp
  nilfs2
  mm/vmalloc
  kthread
  mm/hugetlb
  mm/memory-failure
  mm/pagealloc
  MAINTAINERS
  mailmap

Subsystem: mm/thp

    Hugh Dickins <hughd@google.com>:
    Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes":
      mm: page_vma_mapped_walk(): use page for pvmw->page
      mm: page_vma_mapped_walk(): settle PageHuge on entry
      mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd
      mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block
      mm: page_vma_mapped_walk(): crossing page table boundary
      mm: page_vma_mapped_walk(): add a level of indentation
      mm: page_vma_mapped_walk(): use goto instead of while (1)
      mm: page_vma_mapped_walk(): get vma_address_end() earlier
      mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes
      mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk()

Subsystem: nilfs2

    Pavel Skripkin <paskripkin@gmail.com>:
      nilfs2: fix memory leak in nilfs_sysfs_delete_device_group

Subsystem: mm/vmalloc

    Claudio Imbrenda <imbrenda@linux.ibm.com>:
    Patch series "mm: add vmalloc_no_huge and use it", v4:
      mm/vmalloc: add vmalloc_no_huge
      KVM: s390: prepare for hugepage vmalloc

    Daniel Axtens <dja@axtens.net>:
      mm/vmalloc: unbreak kasan vmalloc support

Subsystem: kthread

    Petr Mladek <pmladek@suse.com>:
    Patch series "kthread_worker: Fix race between kthread_mod_delayed_work():
      kthread_worker: split code for canceling the delayed work timer
      kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()

Subsystem: mm/hugetlb

    Hugh Dickins <hughd@google.com>:
      mm, futex: fix shared futex pgoff on shmem huge page

Subsystem: mm/memory-failure

    Tony Luck <tony.luck@intel.com>:
    Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5:
      mm/memory-failure: use a mutex to avoid memory_failure() races

    Aili Yao <yaoaili@kingsoft.com>:
      mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: do not lock page again when me_huge_page() successfully recovers

Subsystem: mm/pagealloc

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: do bulk array bounds check after checking populated elements

Subsystem: MAINTAINERS

    Marek Behún <kabel@kernel.org>:
      MAINTAINERS: fix Marek's identity again

Subsystem: mailmap

    Marek Behún <kabel@kernel.org>:
      mailmap: add Marek's other e-mail address and identity without diacritics

 .mailmap                |    2 
 MAINTAINERS             |    4 
 arch/s390/kvm/pv.c      |    7 +
 fs/nilfs2/sysfs.c       |    1 
 include/linux/hugetlb.h |   16 ---
 include/linux/pagemap.h |   13 +-
 include/linux/vmalloc.h |    1 
 kernel/futex.c          |    3 
 kernel/kthread.c        |   81 ++++++++++------
 mm/hugetlb.c            |    5 -
 mm/memory-failure.c     |   83 +++++++++++------
 mm/page_alloc.c         |    6 +
 mm/page_vma_mapped.c    |  233 +++++++++++++++++++++++++++---------------------
 mm/vmalloc.c            |   41 ++++++--
 14 files changed, 297 insertions(+), 199 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-06-16  1:22 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-06-16  1:22 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71.

Subsystems affected by this patch series:

  mm/memory-failure
  mm/swap
  mm/slub
  mm/hugetlb
  mm/memory-failure
  coredump
  mm/slub
  mm/thp
  mm/sparsemem

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: fix race with hugetlb page allocation

Subsystem: mm/swap

    Peter Xu <peterx@redhat.com>:
      mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare

Subsystem: mm/slub

    Kees Cook <keescook@chromium.org>:
    Patch series "Actually fix freelist pointer vs redzoning", v4:
      mm/slub: clarify verification reporting
      mm/slub: fix redzoning for small allocations
      mm/slub: actually fix freelist pointer vs redzoning

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: expand restore_reserve_on_error functionality

Subsystem: mm/memory-failure

    yangerkun <yangerkun@huawei.com>:
      mm/memory-failure: make sure wait for page writeback in memory_failure

Subsystem: coredump

    Pingfan Liu <kernelfans@gmail.com>:
      crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo

Subsystem: mm/slub

    Andrew Morton <akpm@linux-foundation.org>:
      mm/slub.c: include swab.h

Subsystem: mm/thp

    Xu Yu <xuyu@linux.alibaba.com>:
      mm, thp: use head page in __migration_entry_wait()

    Hugh Dickins <hughd@google.com>:
    Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10:
      mm/thp: fix __split_huge_pmd_locked() on shmem migration entry
      mm/thp: make is_huge_zero_pmd() safe and quicker
      mm/thp: try_to_unmap() use TTU_SYNC for safe splitting
      mm/thp: fix vma_address() if virtual address below file offset

    Jue Wang <juew@google.com>:
      mm/thp: fix page_address_in_vma() on file THP tails

    Hugh Dickins <hughd@google.com>:
      mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page()

    Yang Shi <shy828301@gmail.com>:
      mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split

Subsystem: mm/sparsemem

    Miles Chen <miles.chen@mediatek.com>:
      mm/sparse: fix check_usemap_section_nr warnings

 Documentation/vm/slub.rst |   10 +--
 fs/hugetlbfs/inode.c      |    1 
 include/linux/huge_mm.h   |    8 ++
 include/linux/hugetlb.h   |    8 ++
 include/linux/mm.h        |    3 +
 include/linux/rmap.h      |    1 
 include/linux/swapops.h   |   15 +++--
 kernel/crash_core.c       |    1 
 mm/huge_memory.c          |   58 ++++++++++---------
 mm/hugetlb.c              |  137 +++++++++++++++++++++++++++++++++++++---------
 mm/internal.h             |   51 ++++++++++++-----
 mm/memory-failure.c       |   36 +++++++++++-
 mm/memory.c               |   41 +++++++++++++
 mm/migrate.c              |    1 
 mm/page_vma_mapped.c      |   27 +++++----
 mm/pgtable-generic.c      |    5 -
 mm/rmap.c                 |   41 +++++++++----
 mm/slab_common.c          |    3 -
 mm/slub.c                 |   37 +++++-------
 mm/sparse.c               |   13 +++-
 mm/swapfile.c             |    2 
 mm/truncate.c             |   43 ++++++--------
 22 files changed, 388 insertions(+), 154 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-06-05  3:00 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-06-05  3:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c.

Subsystems affected by this patch series:

  mips
  mm/kfence
  init
  mm/debug
  mm/pagealloc
  mm/memory-hotplug
  mm/hugetlb
  proc
  mm/kasan
  mm/hugetlb
  lib
  ocfs2
  mailmap

Subsystem: mips

    Thomas Bogendoerfer <tsbogend@alpha.franken.de>:
      Revert "MIPS: make userspace mapping young by default"

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: use TASK_IDLE when awaiting allocation

Subsystem: init

    Mark Rutland <mark.rutland@arm.com>:
      pid: take a reference when initializing `cad_pid`

Subsystem: mm/debug

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests()

Subsystem: mm/pagealloc

    Ding Hui <dinghui@sangfor.com.cn>:
      mm/page_alloc: fix counting of free pages after take off from buddy

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64

Subsystem: mm/hugetlb

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      hugetlb: pass head page to remove_hugetlb_page()

Subsystem: proc

    David Matlack <dmatlack@google.com>:
      proc: add .gitignore for proc-subset-pid selftest

Subsystem: mm/kasan

    Yu Kuai <yukuai3@huawei.com>:
      mm/kasan/init.c: fix doc warning

Subsystem: mm/hugetlb

    Mina Almasry <almasrymina@google.com>:
      mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY

Subsystem: lib

    YueHaibing <yuehaibing@huawei.com>:
      lib: crc64: fix kernel-doc warning

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: fix data corruption by fallocate

Subsystem: mailmap

    Michel Lespinasse <michel@lespinasse.org>:
      mailmap: use private address for Michel Lespinasse

 .mailmap                                |    3 +
 arch/mips/mm/cache.c                    |   30 ++++++++---------
 drivers/base/memory.c                   |    6 +--
 fs/ocfs2/file.c                         |   55 +++++++++++++++++++++++++++++---
 include/linux/pgtable.h                 |    8 ++++
 init/main.c                             |    2 -
 lib/crc64.c                             |    2 -
 mm/debug_vm_pgtable.c                   |    4 +-
 mm/hugetlb.c                            |   16 +++++++--
 mm/kasan/init.c                         |    4 +-
 mm/kfence/core.c                        |    6 +--
 mm/memory.c                             |    4 ++
 mm/page_alloc.c                         |    2 +
 tools/testing/selftests/proc/.gitignore |    1 
 14 files changed, 107 insertions(+), 36 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-05-23  0:41 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-05-23  0:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c.

Subsystems affected by this patch series:

  mm/pagealloc
  mm/gup
  ipc
  selftests
  mm/kasan
  kernel/watchdog
  bitmap
  procfs
  lib
  mm/userfaultfd

Subsystem: mm/pagealloc

    Arnd Bergmann <arnd@arndb.de>:
      mm/shuffle: fix section mismatch warning

Subsystem: mm/gup

    Michal Hocko <mhocko@suse.com>:
      Revert "mm/gup: check page posion status for coredump."

Subsystem: ipc

    Varad Gautam <varad.gautam@suse.com>:
      ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry

Subsystem: selftests

    Yang Yingliang <yangyingliang@huawei.com>:
      tools/testing/selftests/exec: fix link error

Subsystem: mm/kasan

    Alexander Potapenko <glider@google.com>:
      kasan: slab: always reset the tag in get_freepointer_safe()

Subsystem: kernel/watchdog

    Petr Mladek <pmladek@suse.com>:
      watchdog: reliable handling of timestamps

Subsystem: bitmap

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      linux/bits.h: fix compilation error with GENMASK

Subsystem: procfs

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: remove Alexey from MAINTAINERS

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib: kunit: suppress a compilation warning of frame size

Subsystem: mm/userfaultfd

    Mike Kravetz <mike.kravetz@oracle.com>:
      userfaultfd: hugetlbfs: fix new flag usage in error path

 MAINTAINERS                           |    1 -
 fs/hugetlbfs/inode.c                  |    2 +-
 include/linux/bits.h                  |    2 +-
 include/linux/const.h                 |    8 ++++++++
 include/linux/minmax.h                |   10 ++--------
 ipc/mqueue.c                          |    6 ++++--
 ipc/msg.c                             |    6 ++++--
 ipc/sem.c                             |    6 ++++--
 kernel/watchdog.c                     |   34 ++++++++++++++++++++--------------
 lib/Makefile                          |    1 +
 mm/gup.c                              |    4 ----
 mm/internal.h                         |   20 --------------------
 mm/shuffle.h                          |    4 ++--
 mm/slub.c                             |    1 +
 mm/userfaultfd.c                      |   28 ++++++++++++++--------------
 tools/include/linux/bits.h            |    2 +-
 tools/include/linux/const.h           |    8 ++++++++
 tools/testing/selftests/exec/Makefile |    6 +++---
 18 files changed, 74 insertions(+), 75 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-05-15  0:26 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-05-15  0:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/slub
  resource
  squashfs
  mm/userfaultfd
  mm/ksm
  mm/pagealloc
  mm/kasan
  mm/pagemap
  hfsplus
  modprobe
  mm/ioremap

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2:
      mm/hugetlb: fix F_SEAL_FUTURE_WRITE
      mm/hugetlb: fix cow where page writtable in child

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: move slub_debug static key enabling outside slab_mutex

Subsystem: resource

    Alistair Popple <apopple@nvidia.com>:
      kernel/resource: fix return code check in __request_free_mem_region

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix divide error in calculate_skip()

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: release page in error path to avoid BUG_ON

Subsystem: mm/ksm

    Hugh Dickins <hughd@google.com>:
      ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()"

Subsystem: mm/pagealloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix struct page layout on 32-bit systems

Subsystem: mm/kasan

    Peter Collingbourne <pcc@google.com>:
      kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled

Subsystem: mm/pagemap

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap: fix readahead return types

Subsystem: hfsplus

    Jouni Roivas <jouni.roivas@tuxera.com>:
      hfsplus: prevent corruption in shrinking truncate

Subsystem: modprobe

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      docs: admin-guide: update description for kernel.modprobe sysctl

Subsystem: mm/ioremap

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm/ioremap: fix iomap_max_page_shift

 Documentation/admin-guide/sysctl/kernel.rst |    9 ++++---
 fs/hfsplus/extents.c                        |    7 +++--
 fs/hugetlbfs/inode.c                        |    5 ++++
 fs/iomap/buffered-io.c                      |    4 +--
 fs/squashfs/file.c                          |    6 ++--
 include/linux/mm.h                          |   32 ++++++++++++++++++++++++++
 include/linux/mm_types.h                    |    4 +--
 include/linux/pagemap.h                     |    6 ++--
 include/net/page_pool.h                     |   12 +++++++++
 kernel/resource.c                           |    2 -
 lib/test_kasan.c                            |   29 ++++++++++++++++++-----
 mm/hugetlb.c                                |    1 
 mm/ioremap.c                                |    6 ++--
 mm/ksm.c                                    |    3 +-
 mm/shmem.c                                  |   34 ++++++++++++----------------
 mm/slab_common.c                            |   10 ++++++++
 mm/slub.c                                   |    9 -------
 net/core/page_pool.c                        |   12 +++++----
 18 files changed, 129 insertions(+), 62 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-05-07  1:01 incoming Andrew Morton
@ 2021-05-07  7:12 ` Linus Torvalds
  0 siblings, 0 replies; 203+ messages in thread
From: Linus Torvalds @ 2021-05-07  7:12 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> I've been wobbly about the secretmem patches due to doubts about
> whether the feature is sufficiently useful to justify inclusion, but
> developers are now weighing in with helpful information and I've asked Mike
> for an extensively updated [0/n] changelog.  This will take a few days
> to play out so it is possible that I will prevail upon you for a post-rc1
> merge.

Oh, much too late for this release by now.

> If that's a problem, there's always 5.13-rc1.

5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time -
and version numbers - fly.

             Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-05-07  1:01 Andrew Morton
  2021-05-07  7:12 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-05-07  1:01 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


This is everything else from -mm for this merge window, with the
possible exception of Mike Rapoport's "secretmem" syscall patch series
(https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org).

I've been wobbly about the secretmem patches due to doubts about
whether the feature is sufficiently useful to justify inclusion, but
developers are now weighing in with helpful information and I've asked Mike
for an extensively updated [0/n] changelog.  This will take a few days
to play out so it is possible that I will prevail upon you for a post-rc1
merge.  If that's a problem, there's always 5.13-rc1.

91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Thanks.



Subsystems affected by this patch series:

  alpha
  procfs
  sysctl
  misc
  core-kernel
  bitmap
  lib
  compat
  checkpatch
  epoll
  isofs
  nilfs2
  hpfs
  exit
  fork
  kexec
  gcov
  panic
  delayacct
  gdb
  resource
  selftests
  async
  initramfs
  ipc
  mm/cleanups
  drivers/char
  mm/slub
  spelling

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: eliminate old-style function definitions
      alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h>

Subsystem: procfs

    Colin Ian King <colin.king@canonical.com>:
      fs/proc/generic.c: fix incorrect pde_is_permanent check

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: save LOC in __xlate_proc_name()
      proc: mandate ->proc_lseek in "struct proc_ops"
      proc: delete redundant subset=pid check
      selftests: proc: test subset=pid

Subsystem: sysctl

    zhouchuangao <zhouchuangao@vivo.com>:
      proc/sysctl: fix function name error in comments

Subsystem: misc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include: remove pagemap.h from blkdev.h

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: drop inclusion in bitmap.h

    Wan Jiabing <wanjiabing@vivo.com>:
      linux/profile.h: remove unnecessary declaration

Subsystem: core-kernel

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      kernel/async.c: fix pr_debug statement
      kernel/cred.c: make init_groups static

Subsystem: bitmap

    Yury Norov <yury.norov@gmail.com>:
    Patch series "lib/find_bit: fast path for small bitmaps", v6:
      tools: disable -Wno-type-limits
      tools: bitmap: sync function declarations with the kernel
      tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel
      arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300
      lib: extend the scope of small_const_nbits() macro
      tools: sync small_const_nbits() macro with the kernel
      lib: inline _find_next_bit() wrappers
      tools: sync find_next_bit implementation
      lib: add fast path for find_next_*_bit()
      lib: add fast path for find_first_*_bit() and find_last_bit()
      tools: sync lib/find_bit implementation
      MAINTAINERS: add entry for the bitmap API

Subsystem: lib

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      lib/bch.c: fix a typo in the file bch.c

    Wang Qing <wangqing@vivo.com>:
      lib: fix inconsistent indenting in process_bit1()

    ToastC <mrtoastcheng@gmail.com>:
      lib/list_sort.c: fix typo in function description

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      lib/genalloc.c: Fix a typo

    Richard Fitzgerald <rf@opensource.cirrus.com>:
      lib: crc8: pointer to data block should be const

    Zqiang <qiang.zhang@windriver.com>:
      lib: stackdepot: turn depot_lock spinlock to raw_spinlock

    Alex Shi <alexs@kernel.org>:
      lib/percpu_counter: tame kernel-doc compile warning
      lib/genalloc: add parameter description to fix doc compile warning

    Randy Dunlap <rdunlap@infradead.org>:
      lib: parser: clean up kernel-doc

Subsystem: compat

    Masahiro Yamada <masahiroy@kernel.org>:
      include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx()

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: warn when missing newline in return sysfs_emit() formats

    Vincent Mailhol <mailhol.vincent@wanadoo.fr>:
      checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      checkpatch: improve ALLOC_ARRAY_ARGS test

Subsystem: epoll

    Davidlohr Bueso <dave@stgolabs.net>:
    Patch series "fs/epoll: restore user-visible behavior upon event ready":
      kselftest: introduce new epoll test case
      fs/epoll: restore waking from ep_done_scan()

Subsystem: isofs

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      isofs: fix fall-through warnings for Clang

Subsystem: nilfs2

    Liu xuzhi <liu.xuzhi@zte.com.cn>:
      fs/nilfs2: fix misspellings using codespell tool

    Lu Jialin <lujialin4@huawei.com>:
      nilfs2: fix typos in comments

Subsystem: hpfs

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      hpfs: replace one-element array with flexible-array member

Subsystem: exit

    Jim Newsome <jnewsome@torproject.org>:
      do_wait: make PIDTYPE_PID case O(1) instead of O(n)

Subsystem: fork

    Rolf Eike Beer <eb@emlix.com>:
      kernel/fork.c: simplify copy_mm()

    Xiaofeng Cao <cxfcosmos@gmail.com>:
      kernel/fork.c: fix typos

Subsystem: kexec

    Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>:
      kernel/crash_core: add crashkernel=auto for vmcore creation

    Joe LeVeque <jolevequ@microsoft.com>:
      kexec: Add kexec reboot string

    Jia-Ju Bai <baijiaju1990@gmail.com>:
      kernel: kexec_file: fix error return code of kexec_calculate_store_digests()

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      kexec: dump kmessage before machine_kexec

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      gcov: combine common code
      gcov: simplify buffer allocation
      gcov: use kvmalloc()

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: clang: drop support for clang-10 and older

Subsystem: panic

    He Ying <heying24@huawei.com>:
      smp: kernel/panic.c - silence warnings

Subsystem: delayacct

    Yafang Shao <laoar.shao@gmail.com>:
      delayacct: clear right task's flag after blkio completes

Subsystem: gdb

    Johannes Berg <johannes.berg@intel.com>:
      gdb: lx-symbols: store the abspath()

    Barry Song <song.bao.hua@hisilicon.com>:
    Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2:
      scripts/gdb: document lx_current is only supported by x86
      scripts/gdb: add lx_current support for arm64

Subsystem: resource

    David Hildenbrand <david@redhat.com>:
    Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2:
      kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources
      kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources
      kernel/resource: remove first_lvl / siblings_only logic

    Alistair Popple <apopple@nvidia.com>:
      kernel/resource: allow region_intersects users to hold resource_lock
      kernel/resource: refactor __request_region to allow external locking
      kernel/resource: fix locking in request_free_mem_region

Subsystem: selftests

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      selftests: remove duplicate include

Subsystem: async

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      kernel/async.c: stop guarding pr_debug() statements
      kernel/async.c: remove async_unregister_domain()

Subsystem: initramfs

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
    Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3:
      init/initramfs.c: do unpacking asynchronously
      modules: add CONFIG_MODPROBE_PATH

Subsystem: ipc

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ipc/sem.c: mundane typo fixes

Subsystem: mm/cleanups

    Shijie Luo <luoshijie1@huawei.com>:
      mm: fix some typos and code style problems

Subsystem: drivers/char

    David Hildenbrand <david@redhat.com>:
    Patch series "drivers/char: remove /dev/kmem for good":
      drivers/char: remove /dev/kmem for good
      mm: remove xlate_dev_kmem_ptr()
      mm/vmalloc: remove vwrite()

Subsystem: mm/slub

    Maninder Singh <maninder1.s@samsung.com>:
      arm: print alloc free paths for address in registers

Subsystem: spelling

    Drew Fustini <drew@beagleboard.org>:
      scripts/spelling.txt: add "overlfow"

    zuoqilin <zuoqilin@yulong.com>:
      scripts/spelling.txt: Add "diabled" typo

    Drew Fustini <drew@beagleboard.org>:
      scripts/spelling.txt: add "overflw"

    Colin Ian King <colin.king@canonical.com>:
      mm/slab.c: fix spelling mistake "disired" -> "desired"

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      include/linux/pgtable.h: few spelling fixes

    zhouchuangao <zhouchuangao@vivo.com>:
      kernel/umh.c: fix some spelling mistakes

    Xiaofeng Cao <cxfcosmos@gmail.com>:
      kernel/user_namespace.c: fix typos

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      kernel/up.c: fix typo

    Xiaofeng Cao <caoxiaofeng@yulong.com>:
      kernel/sys.c: fix typo

    dingsenjie <dingsenjie@yulong.com>:
      fs: fat: fix spelling typo of values

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ipc/sem.c: spelling fix

    Masahiro Yamada <masahiroy@kernel.org>:
      treewide: remove editor modelines and cruft

    Ingo Molnar <mingo@kernel.org>:
      mm: fix typos in comments

    Lu Jialin <lujialin4@huawei.com>:
      mm: fix typos in comments

 Documentation/admin-guide/devices.txt                         |    2 
 Documentation/admin-guide/kdump/kdump.rst                     |    3 
 Documentation/admin-guide/kernel-parameters.txt               |   18 
 Documentation/dev-tools/gdb-kernel-debugging.rst              |    4 
 MAINTAINERS                                                   |   16 
 arch/Kconfig                                                  |   20 
 arch/alpha/include/asm/io.h                                   |    5 
 arch/alpha/kernel/pc873xx.c                                   |    4 
 arch/alpha/lib/csum_partial_copy.c                            |    1 
 arch/arm/configs/dove_defconfig                               |    1 
 arch/arm/configs/magician_defconfig                           |    1 
 arch/arm/configs/moxart_defconfig                             |    1 
 arch/arm/configs/mps2_defconfig                               |    1 
 arch/arm/configs/mvebu_v5_defconfig                           |    1 
 arch/arm/configs/xcep_defconfig                               |    1 
 arch/arm/include/asm/bug.h                                    |    1 
 arch/arm/include/asm/io.h                                     |    5 
 arch/arm/kernel/process.c                                     |   11 
 arch/arm/kernel/traps.c                                       |    1 
 arch/h8300/include/asm/bitops.h                               |    8 
 arch/hexagon/configs/comet_defconfig                          |    1 
 arch/hexagon/include/asm/io.h                                 |    1 
 arch/ia64/include/asm/io.h                                    |    1 
 arch/ia64/include/asm/uaccess.h                               |   18 
 arch/m68k/atari/time.c                                        |    7 
 arch/m68k/configs/amcore_defconfig                            |    1 
 arch/m68k/include/asm/bitops.h                                |    6 
 arch/m68k/include/asm/io_mm.h                                 |    5 
 arch/mips/include/asm/io.h                                    |    5 
 arch/openrisc/configs/or1ksim_defconfig                       |    1 
 arch/parisc/include/asm/io.h                                  |    5 
 arch/parisc/include/asm/pdc_chassis.h                         |    1 
 arch/powerpc/include/asm/io.h                                 |    5 
 arch/s390/include/asm/io.h                                    |    5 
 arch/sh/configs/edosk7705_defconfig                           |    1 
 arch/sh/configs/se7206_defconfig                              |    1 
 arch/sh/configs/sh2007_defconfig                              |    1 
 arch/sh/configs/sh7724_generic_defconfig                      |    1 
 arch/sh/configs/sh7770_generic_defconfig                      |    1 
 arch/sh/configs/sh7785lcr_32bit_defconfig                     |    1 
 arch/sh/include/asm/bitops.h                                  |    5 
 arch/sh/include/asm/io.h                                      |    5 
 arch/sparc/configs/sparc64_defconfig                          |    1 
 arch/sparc/include/asm/io_64.h                                |    5 
 arch/um/drivers/cow.h                                         |    7 
 arch/xtensa/configs/xip_kc705_defconfig                       |    1 
 block/blk-settings.c                                          |    1 
 drivers/auxdisplay/panel.c                                    |    7 
 drivers/base/firmware_loader/main.c                           |    2 
 drivers/block/brd.c                                           |    1 
 drivers/block/loop.c                                          |    1 
 drivers/char/Kconfig                                          |   10 
 drivers/char/mem.c                                            |  231 --------
 drivers/gpu/drm/qxl/qxl_drv.c                                 |    1 
 drivers/isdn/capi/kcapi_proc.c                                |    1 
 drivers/md/bcache/super.c                                     |    1 
 drivers/media/usb/pwc/pwc-uncompress.c                        |    3 
 drivers/net/ethernet/adaptec/starfire.c                       |    8 
 drivers/net/ethernet/amd/atarilance.c                         |    8 
 drivers/net/ethernet/amd/pcnet32.c                            |    7 
 drivers/net/wireless/intersil/hostap/hostap_proc.c            |    1 
 drivers/net/wireless/intersil/orinoco/orinoco_nortel.c        |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_pci.c           |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_plx.c           |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_tmd.c           |    8 
 drivers/nvdimm/btt.c                                          |    1 
 drivers/nvdimm/pmem.c                                         |    1 
 drivers/parport/parport_ip32.c                                |   12 
 drivers/platform/x86/dell/dell_rbu.c                          |    3 
 drivers/scsi/53c700.c                                         |    1 
 drivers/scsi/53c700.h                                         |    1 
 drivers/scsi/ch.c                                             |    6 
 drivers/scsi/esas2r/esas2r_main.c                             |    1 
 drivers/scsi/ips.c                                            |   20 
 drivers/scsi/ips.h                                            |   20 
 drivers/scsi/lasi700.c                                        |    1 
 drivers/scsi/megaraid/mbox_defs.h                             |    2 
 drivers/scsi/megaraid/mega_common.h                           |    2 
 drivers/scsi/megaraid/megaraid_mbox.c                         |    2 
 drivers/scsi/megaraid/megaraid_mbox.h                         |    2 
 drivers/scsi/qla1280.c                                        |   12 
 drivers/scsi/scsicam.c                                        |    1 
 drivers/scsi/sni_53c710.c                                     |    1 
 drivers/video/fbdev/matrox/matroxfb_base.c                    |    9 
 drivers/video/fbdev/vga16fb.c                                 |   10 
 fs/configfs/configfs_internal.h                               |    4 
 fs/configfs/dir.c                                             |    4 
 fs/configfs/file.c                                            |    4 
 fs/configfs/inode.c                                           |    4 
 fs/configfs/item.c                                            |    4 
 fs/configfs/mount.c                                           |    4 
 fs/configfs/symlink.c                                         |    4 
 fs/eventpoll.c                                                |    6 
 fs/fat/fatent.c                                               |    2 
 fs/hpfs/hpfs.h                                                |    3 
 fs/isofs/rock.c                                               |    1 
 fs/nfs/dir.c                                                  |    7 
 fs/nfs/nfs4proc.c                                             |    6 
 fs/nfs/nfs4renewd.c                                           |    6 
 fs/nfs/nfs4state.c                                            |    6 
 fs/nfs/nfs4xdr.c                                              |    6 
 fs/nfsd/nfs4proc.c                                            |    6 
 fs/nfsd/nfs4xdr.c                                             |    6 
 fs/nfsd/xdr4.h                                                |    6 
 fs/nilfs2/cpfile.c                                            |    2 
 fs/nilfs2/ioctl.c                                             |    4 
 fs/nilfs2/segment.c                                           |    4 
 fs/nilfs2/the_nilfs.c                                         |    2 
 fs/ocfs2/acl.c                                                |    4 
 fs/ocfs2/acl.h                                                |    4 
 fs/ocfs2/alloc.c                                              |    4 
 fs/ocfs2/alloc.h                                              |    4 
 fs/ocfs2/aops.c                                               |    4 
 fs/ocfs2/aops.h                                               |    4 
 fs/ocfs2/blockcheck.c                                         |    4 
 fs/ocfs2/blockcheck.h                                         |    4 
 fs/ocfs2/buffer_head_io.c                                     |    4 
 fs/ocfs2/buffer_head_io.h                                     |    4 
 fs/ocfs2/cluster/heartbeat.c                                  |    4 
 fs/ocfs2/cluster/heartbeat.h                                  |    4 
 fs/ocfs2/cluster/masklog.c                                    |    4 
 fs/ocfs2/cluster/masklog.h                                    |    4 
 fs/ocfs2/cluster/netdebug.c                                   |    4 
 fs/ocfs2/cluster/nodemanager.c                                |    4 
 fs/ocfs2/cluster/nodemanager.h                                |    4 
 fs/ocfs2/cluster/ocfs2_heartbeat.h                            |    4 
 fs/ocfs2/cluster/ocfs2_nodemanager.h                          |    4 
 fs/ocfs2/cluster/quorum.c                                     |    4 
 fs/ocfs2/cluster/quorum.h                                     |    4 
 fs/ocfs2/cluster/sys.c                                        |    4 
 fs/ocfs2/cluster/sys.h                                        |    4 
 fs/ocfs2/cluster/tcp.c                                        |    4 
 fs/ocfs2/cluster/tcp.h                                        |    4 
 fs/ocfs2/cluster/tcp_internal.h                               |    4 
 fs/ocfs2/dcache.c                                             |    4 
 fs/ocfs2/dcache.h                                             |    4 
 fs/ocfs2/dir.c                                                |    4 
 fs/ocfs2/dir.h                                                |    4 
 fs/ocfs2/dlm/dlmapi.h                                         |    4 
 fs/ocfs2/dlm/dlmast.c                                         |    4 
 fs/ocfs2/dlm/dlmcommon.h                                      |    4 
 fs/ocfs2/dlm/dlmconvert.c                                     |    4 
 fs/ocfs2/dlm/dlmconvert.h                                     |    4 
 fs/ocfs2/dlm/dlmdebug.c                                       |    4 
 fs/ocfs2/dlm/dlmdebug.h                                       |    4 
 fs/ocfs2/dlm/dlmdomain.c                                      |    4 
 fs/ocfs2/dlm/dlmdomain.h                                      |    4 
 fs/ocfs2/dlm/dlmlock.c                                        |    4 
 fs/ocfs2/dlm/dlmmaster.c                                      |    4 
 fs/ocfs2/dlm/dlmrecovery.c                                    |    4 
 fs/ocfs2/dlm/dlmthread.c                                      |    4 
 fs/ocfs2/dlm/dlmunlock.c                                      |    4 
 fs/ocfs2/dlmfs/dlmfs.c                                        |    4 
 fs/ocfs2/dlmfs/userdlm.c                                      |    4 
 fs/ocfs2/dlmfs/userdlm.h                                      |    4 
 fs/ocfs2/dlmglue.c                                            |    4 
 fs/ocfs2/dlmglue.h                                            |    4 
 fs/ocfs2/export.c                                             |    4 
 fs/ocfs2/export.h                                             |    4 
 fs/ocfs2/extent_map.c                                         |    4 
 fs/ocfs2/extent_map.h                                         |    4 
 fs/ocfs2/file.c                                               |    4 
 fs/ocfs2/file.h                                               |    4 
 fs/ocfs2/filecheck.c                                          |    4 
 fs/ocfs2/filecheck.h                                          |    4 
 fs/ocfs2/heartbeat.c                                          |    4 
 fs/ocfs2/heartbeat.h                                          |    4 
 fs/ocfs2/inode.c                                              |    4 
 fs/ocfs2/inode.h                                              |    4 
 fs/ocfs2/journal.c                                            |    4 
 fs/ocfs2/journal.h                                            |    4 
 fs/ocfs2/localalloc.c                                         |    4 
 fs/ocfs2/localalloc.h                                         |    4 
 fs/ocfs2/locks.c                                              |    4 
 fs/ocfs2/locks.h                                              |    4 
 fs/ocfs2/mmap.c                                               |    4 
 fs/ocfs2/move_extents.c                                       |    4 
 fs/ocfs2/move_extents.h                                       |    4 
 fs/ocfs2/namei.c                                              |    4 
 fs/ocfs2/namei.h                                              |    4 
 fs/ocfs2/ocfs1_fs_compat.h                                    |    4 
 fs/ocfs2/ocfs2.h                                              |    4 
 fs/ocfs2/ocfs2_fs.h                                           |    4 
 fs/ocfs2/ocfs2_ioctl.h                                        |    4 
 fs/ocfs2/ocfs2_lockid.h                                       |    4 
 fs/ocfs2/ocfs2_lockingver.h                                   |    4 
 fs/ocfs2/refcounttree.c                                       |    4 
 fs/ocfs2/refcounttree.h                                       |    4 
 fs/ocfs2/reservations.c                                       |    4 
 fs/ocfs2/reservations.h                                       |    4 
 fs/ocfs2/resize.c                                             |    4 
 fs/ocfs2/resize.h                                             |    4 
 fs/ocfs2/slot_map.c                                           |    4 
 fs/ocfs2/slot_map.h                                           |    4 
 fs/ocfs2/stack_o2cb.c                                         |    4 
 fs/ocfs2/stack_user.c                                         |    4 
 fs/ocfs2/stackglue.c                                          |    4 
 fs/ocfs2/stackglue.h                                          |    4 
 fs/ocfs2/suballoc.c                                           |    4 
 fs/ocfs2/suballoc.h                                           |    4 
 fs/ocfs2/super.c                                              |    4 
 fs/ocfs2/super.h                                              |    4 
 fs/ocfs2/symlink.c                                            |    4 
 fs/ocfs2/symlink.h                                            |    4 
 fs/ocfs2/sysfile.c                                            |    4 
 fs/ocfs2/sysfile.h                                            |    4 
 fs/ocfs2/uptodate.c                                           |    4 
 fs/ocfs2/uptodate.h                                           |    4 
 fs/ocfs2/xattr.c                                              |    4 
 fs/ocfs2/xattr.h                                              |    4 
 fs/proc/generic.c                                             |   13 
 fs/proc/inode.c                                               |   18 
 fs/proc/proc_sysctl.c                                         |    2 
 fs/reiserfs/procfs.c                                          |   10 
 include/asm-generic/bitops/find.h                             |  108 +++
 include/asm-generic/bitops/le.h                               |   38 +
 include/asm-generic/bitsperlong.h                             |   12 
 include/asm-generic/io.h                                      |   11 
 include/linux/align.h                                         |   15 
 include/linux/async.h                                         |    1 
 include/linux/bitmap.h                                        |   11 
 include/linux/bitops.h                                        |   12 
 include/linux/blkdev.h                                        |    1 
 include/linux/compat.h                                        |    1 
 include/linux/configfs.h                                      |    4 
 include/linux/crc8.h                                          |    2 
 include/linux/cred.h                                          |    1 
 include/linux/delayacct.h                                     |   20 
 include/linux/fs.h                                            |    2 
 include/linux/genl_magic_func.h                               |    1 
 include/linux/genl_magic_struct.h                             |    1 
 include/linux/gfp.h                                           |    2 
 include/linux/init_task.h                                     |    1 
 include/linux/initrd.h                                        |    2 
 include/linux/kernel.h                                        |    9 
 include/linux/mm.h                                            |    2 
 include/linux/mmzone.h                                        |    2 
 include/linux/pgtable.h                                       |   10 
 include/linux/proc_fs.h                                       |    1 
 include/linux/profile.h                                       |    3 
 include/linux/smp.h                                           |    8 
 include/linux/swap.h                                          |    1 
 include/linux/vmalloc.h                                       |    7 
 include/uapi/linux/if_bonding.h                               |   11 
 include/uapi/linux/nfs4.h                                     |    6 
 include/xen/interface/elfnote.h                               |   10 
 include/xen/interface/hvm/hvm_vcpu.h                          |   10 
 include/xen/interface/io/xenbus.h                             |   10 
 init/Kconfig                                                  |   12 
 init/initramfs.c                                              |   38 +
 init/main.c                                                   |    1 
 ipc/sem.c                                                     |   12 
 kernel/async.c                                                |   68 --
 kernel/configs/android-base.config                            |    1 
 kernel/crash_core.c                                           |    7 
 kernel/cred.c                                                 |    2 
 kernel/exit.c                                                 |   67 ++
 kernel/fork.c                                                 |   23 
 kernel/gcov/Kconfig                                           |    1 
 kernel/gcov/base.c                                            |   49 +
 kernel/gcov/clang.c                                           |  282 ----------
 kernel/gcov/fs.c                                              |  146 ++++-
 kernel/gcov/gcc_4_7.c                                         |  173 ------
 kernel/gcov/gcov.h                                            |   14 
 kernel/kexec_core.c                                           |    4 
 kernel/kexec_file.c                                           |    4 
 kernel/kmod.c                                                 |    2 
 kernel/resource.c                                             |  198 ++++---
 kernel/sys.c                                                  |   14 
 kernel/umh.c                                                  |    8 
 kernel/up.c                                                   |    2 
 kernel/user_namespace.c                                       |    6 
 lib/bch.c                                                     |    2 
 lib/crc8.c                                                    |    2 
 lib/decompress_unlzma.c                                       |    2 
 lib/find_bit.c                                                |   68 --
 lib/genalloc.c                                                |    7 
 lib/list_sort.c                                               |    2 
 lib/parser.c                                                  |   61 +-
 lib/percpu_counter.c                                          |    2 
 lib/stackdepot.c                                              |    6 
 mm/balloon_compaction.c                                       |    4 
 mm/compaction.c                                               |    4 
 mm/filemap.c                                                  |    2 
 mm/gup.c                                                      |    2 
 mm/highmem.c                                                  |    2 
 mm/huge_memory.c                                              |    6 
 mm/hugetlb.c                                                  |    6 
 mm/internal.h                                                 |    2 
 mm/kasan/kasan.h                                              |    8 
 mm/kasan/quarantine.c                                         |    4 
 mm/kasan/shadow.c                                             |    4 
 mm/kfence/report.c                                            |    2 
 mm/khugepaged.c                                               |    2 
 mm/ksm.c                                                      |    6 
 mm/madvise.c                                                  |    4 
 mm/memcontrol.c                                               |   18 
 mm/memory-failure.c                                           |    2 
 mm/memory.c                                                   |   18 
 mm/mempolicy.c                                                |    6 
 mm/migrate.c                                                  |    8 
 mm/mmap.c                                                     |    4 
 mm/mprotect.c                                                 |    2 
 mm/mremap.c                                                   |    2 
 mm/nommu.c                                                    |   10 
 mm/oom_kill.c                                                 |    2 
 mm/page-writeback.c                                           |    4 
 mm/page_alloc.c                                               |   16 
 mm/page_owner.c                                               |    2 
 mm/page_vma_mapped.c                                          |    2 
 mm/percpu-internal.h                                          |    2 
 mm/percpu.c                                                   |    2 
 mm/pgalloc-track.h                                            |    6 
 mm/rmap.c                                                     |    2 
 mm/slab.c                                                     |    8 
 mm/slub.c                                                     |    2 
 mm/swap.c                                                     |    4 
 mm/swap_slots.c                                               |    2 
 mm/swap_state.c                                               |    2 
 mm/vmalloc.c                                                  |  124 ----
 mm/vmstat.c                                                   |    2 
 mm/z3fold.c                                                   |    2 
 mm/zpool.c                                                    |    2 
 mm/zsmalloc.c                                                 |    6 
 samples/configfs/configfs_sample.c                            |    2 
 scripts/checkpatch.pl                                         |   15 
 scripts/gdb/linux/cpus.py                                     |   23 
 scripts/gdb/linux/symbols.py                                  |    3 
 scripts/spelling.txt                                          |    3 
 tools/include/asm-generic/bitops/find.h                       |   85 ++-
 tools/include/asm-generic/bitsperlong.h                       |    3 
 tools/include/linux/bitmap.h                                  |   18 
 tools/lib/bitmap.c                                            |    4 
 tools/lib/find_bit.c                                          |   56 -
 tools/scripts/Makefile.include                                |    1 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   44 +
 tools/testing/selftests/kvm/lib/sparsebit.c                   |    1 
 tools/testing/selftests/mincore/mincore_selftest.c            |    1 
 tools/testing/selftests/powerpc/mm/tlbie_test.c               |    1 
 tools/testing/selftests/proc/Makefile                         |    1 
 tools/testing/selftests/proc/proc-subset-pid.c                |  121 ++++
 tools/testing/selftests/proc/read.c                           |    4 
 tools/usb/hcd-tests.sh                                        |    2 
 343 files changed, 1383 insertions(+), 2119 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-05-05 17:44       ` incoming Andrew Morton
@ 2021-05-06  3:19         ` Anshuman Khandual
  0 siblings, 0 replies; 203+ messages in thread
From: Anshuman Khandual @ 2021-05-06  3:19 UTC (permalink / raw)
  To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits



On 5/5/21 11:14 PM, Andrew Morton wrote:
> On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> 
>> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>>> Let me resend right now with the same in-reply-to.  Hopefully they will
>>> land in the correct place.
>> Well, you re-sent it twice, and I have three copies in my own mailbox,
>> bot they still don't show up on the mm-commits mailing list.
>>
>> So the list hates them for some odd reason.
>>
>> I've picked them up locally, but adding Konstantin to the participants
>> to see if he can see what's up.
>>
>> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
>> series of 143. Odd.
> It's weird.  They don't turn up on linux-mm either, and that's running
> at kvack.org, also majordomo.  They don't get through when sent with
> either heirloom-mailx or with sylpheed.
> 
> Also, it seems that when Anshuman originally sent the patch, linux-mm
> and linux-kernel didn't send it back out.  So perhaps a spam filter
> triggered?
> 
> I'm seeing
> 
> https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
> 
> which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
> server massacred that patch series.  Searching
> https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
> email series.

Yeah these patches faced problem from the very beginning getting
into the MM/LKML list for some strange reason.


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-05-05 17:10     ` incoming Linus Torvalds
@ 2021-05-05 17:44       ` Andrew Morton
  2021-05-06  3:19         ` incoming Anshuman Khandual
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits

[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]

On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to.  Hopefully they will
> > land in the correct place.
> 
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
> 
> So the list hates them for some odd reason.
> 
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
> 
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.

It's weird.  They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo.  They don't get through when sent with
either heirloom-mailx or with sylpheed.

Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out.  So perhaps a spam filter
triggered?

I'm seeing

https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/

which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series.  Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.

One of the emails (as sent my me) is attached, if that helps.



[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]

Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
	USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
	by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
	for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
	by localhost.localdomain with IMAP (fetchmail-6.3.26)
	for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
	 by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
	 Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
  by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
	by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
    by mx6.messagingengine.com (Authentication Milter) with ESMTP
    id 14870833D7F;
    Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
    1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
    yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
    djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
    Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
    RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
    tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
    messagingengine.com; h=date:from:to:subject:message-id
    :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
    uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
    gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
    Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
    YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
    zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
    7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
    smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
    header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
    header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
    policy.applied-disposition=none policy.evaluated-disposition=none
    (p=none,d=none,d.eval=none) policy.policy-from=p
    header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
    smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
    (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
    smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
    x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
    header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
    policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
    smtp.bits=256/256;
    x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
      smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
      header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
      header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
      policy.applied-disposition=none policy.evaluated-disposition=none
      (p=none,d=none,d.eval=none) policy.policy-from=p
      header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
      smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
      (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
      smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
      x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
      header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
      policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
      smtp.bits=256/256;
    x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
    fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
    rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
    hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
    peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
    honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
    geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
    enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
    uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
    iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
    ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
    epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
    (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
    receiver=mx6.messagingengine.com;
    identity=mailfrom;
    envelope-from="akpm@linux-foundation.org";
    helo=mail-pg1-f198.google.com;
    client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
	(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
	 key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
	(No client certificate requested)
	by mx6.messagingengine.com (Postfix) with ESMTPS
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
        for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=1e100.net; s=20161025;
        h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
         :in-reply-to:user-agent;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
         NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
         feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
         25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
         ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
         vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
	tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
	xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
        Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
        d=google.com; s=arc-20160816;
        b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
         /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
         50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
         8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
         DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
         pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
        h=user-agent:in-reply-to:message-id:subject:to:from:date
         :dkim-signature;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
         Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
         uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
         XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
         TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
         rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
        by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
        (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
	Wed,  5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
	s=korg; t=1620184587;
	bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
	h=Date:From:To:Subject:In-Reply-To:From;
	b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
	 D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
	 H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)

SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it.  Instead, just make it a generic option which can be
selected on applicable platforms.  Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead.  This reduces code duplication and makes
it cleaner.

Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com>	[riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au>		[powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm/Kconfig                       |    5 +----
 arch/arm64/Kconfig                     |    4 +---
 arch/mips/Kconfig                      |    6 +-----
 arch/parisc/Kconfig                    |    5 +----
 arch/powerpc/Kconfig                   |    3 ---
 arch/powerpc/platforms/Kconfig.cputype |    6 +++---
 arch/riscv/Kconfig                     |    5 +----
 arch/sh/Kconfig                        |    5 +----
 fs/Kconfig                             |    5 ++++-
 9 files changed, 13 insertions(+), 31 deletions(-)

--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
 	select ARCH_USE_QUEUED_SPINLOCKS
 	select ARCH_USE_SYM_ANNOTATIONS
 	select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
 	select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y
-
 config ARCH_HAS_FILTER_PGPROT
 	def_bool y
 
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
 	select ARCH_SUPPORTS_ATOMIC_RMW
+	select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
 	select ARCH_USE_BUILTIN_BSWAP
 	select ARCH_USE_CMPXCHG_LOCKREF
 	select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-       def_bool y
-       depends on ARM_LPAE
-
 config HAVE_ARCH_TRANSPARENT_HUGEPAGE
        def_bool y
        depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
 	select ARCH_USE_MEMTEST
 	select ARCH_USE_QUEUED_RWLOCKS
 	select ARCH_USE_QUEUED_SPINLOCKS
+	select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_IPC_PARSE_VERSION
 	select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
 config SYS_SUPPORTS_LITTLE_ENDIAN
 	bool
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-	depends on CPU_SUPPORTS_HUGEPAGES
-	default y
-
 config MIPS_HUGE_TLB_SUPPORT
 	def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
 
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
 	select ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_HAS_UBSAN_SANITIZE_ALL
 	select ARCH_NO_SG_CHAIN
+	select ARCH_SUPPORTS_HUGETLBFS if PA20
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select DMA_OPS
 	select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
 	default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
 	default 2
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y if PA20
-
-
 menu "Processor type and features"
 
 choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
 	def_bool y
 	depends on PPC_BOOK3S_64
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config ILLEGAL_POINTER_VALUE
 	hex
 	# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
 
 config PPC_8xx
 	bool "Freescale 8xx"
+	select ARCH_SUPPORTS_HUGETLBFS
 	select FSL_SOC
-	select SYS_SUPPORTS_HUGETLBFS
 	select PPC_HAVE_KUEP
 	select PPC_HAVE_KUAP
 	select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
 	bool "Server processors"
 	select PPC_FPU
 	select PPC_HAVE_PMU_SUPPORT
-	select SYS_SUPPORTS_HUGETLBFS
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
 	select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_NUMA_BALANCING
 	select IRQ_WORK
 	select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
 # this is for common code between PPC32 & PPC64 FSL BOOKE
 config PPC_FSL_BOOK3E
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select FSL_EMB_PERFMON
 	select PPC_SMP_MUXED_IPI
-	select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select PPC_DOORBELL
 	default y if FSL_BOOKE
 
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
 	select ARCH_HAS_STRICT_KERNEL_RWX if MMU
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_FRAME_POINTERS
 	select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
 config ARCH_SUPPORTS_UPROBES
 	def_bool y
 
-config SYS_SUPPORTS_HUGETLBFS
-	depends on MMU
-	def_bool y
-
 config STACKTRACE_SUPPORT
 	def_bool y
 
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
 	bool
 	select ARCH_SUSPEND_POSSIBLE
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config SYS_SUPPORTS_SMP
 	bool
 
@@ -175,12 +172,12 @@ config CPU_SH3
 
 config CPU_SH4
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select CPU_HAS_INTEVT
 	select CPU_HAS_SR_RB
 	select CPU_HAS_FPU if !CPU_SH4AL_DSP
 	select SH_INTC
 	select SYS_SUPPORTS_SH_TMU
-	select SYS_SUPPORTS_HUGETLBFS if MMU
 
 config CPU_SH4A
 	bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
 
 	  If unsure, say N.
 
+config ARCH_SUPPORTS_HUGETLBFS
+	def_bool n
+
 config HUGETLBFS
 	bool "HugeTLB file system support"
 	depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
-		   SYS_SUPPORTS_HUGETLBFS || BROKEN
+		   ARCH_SUPPORTS_HUGETLBFS || BROKEN
 	help
 	  hugetlbfs is a filesystem backing for HugeTLB pages, based on
 	  ramfs. For architectures that support it, say Y here and read
_

^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-05-05  3:16   ` incoming Andrew Morton
@ 2021-05-05 17:10     ` Linus Torvalds
  2021-05-05 17:44       ` incoming Andrew Morton
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits

On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Let me resend right now with the same in-reply-to.  Hopefully they will
> land in the correct place.

Well, you re-sent it twice, and I have three copies in my own mailbox,
bot they still don't show up on the mm-commits mailing list.

So the list hates them for some odd reason.

I've picked them up locally, but adding Konstantin to the participants
to see if he can see what's up.

Konstantin: patches 103/106/107 are missing on lore out of Andrew's
series of 143. Odd.

             Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-05-05  1:47 ` incoming Linus Torvalds
@ 2021-05-05  3:16   ` Andrew Morton
  2021-05-05 17:10     ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-05-05  3:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Linux-MM, mm-commits

On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 143 patches
> 
> Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
> 
> Maybe just some mail delay? But at least right now
> 
>    https://lore.kernel.org/mm-commits/
> 
> doesn't show them (and thus 'b4' doesn't work).
> 
> I'll check again later.
> 

Well that's strange.  I see all three via cc:me, but not on linux-mm or
mm-commits.

Let me resend right now with the same in-reply-to.  Hopefully they will
land in the correct place.


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-05-05  1:32 incoming Andrew Morton
@ 2021-05-05  1:47 ` Linus Torvalds
  2021-05-05  3:16   ` incoming Andrew Morton
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2021-05-05  1:47 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 143 patches

Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.

Maybe just some mail delay? But at least right now

   https://lore.kernel.org/mm-commits/

doesn't show them (and thus 'b4' doesn't work).

I'll check again later.

             Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-05-05  1:32 Andrew Morton
  2021-05-05  1:47 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


The remainder of the main mm/ queue.

143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Subsystems affected by this patch series:

  mm/pagecache
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/migration
  mm/cma
  mm/ksm
  mm/vmstat
  mm/mmap
  mm/kconfig
  mm/util
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/highmem
  mm/cleanups
  mm/kfence

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Remove nrexceptional tracking", v2:
      mm: introduce and use mapping_empty()
      mm: stop accounting shadow entries
      dax: account DAX entries as nrpages
      mm: remove nrexceptional from inode

    Hugh Dickins <hughd@google.com>:
      mm: remove nrexceptional from inode: remove BUG_ON

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4:
      hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
      hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
      mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
      hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: generalize HUGETLB_PAGE_SIZE_VARIABLE

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Some cleanups for hugetlb":
      mm/hugetlb: use some helper functions to cleanup code
      mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
      mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
      mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
      mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
    Patch series "Cleanup and fixup for khugepaged", v2:
      khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
      khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
      khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
      khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
      mm/huge_memory.c: remove unnecessary local variable ret2
    Patch series "Some cleanups for huge_memory", v3:
      mm/huge_memory.c: rework the function vma_adjust_trans_huge()
      mm/huge_memory.c: make get_huge_zero_page() return bool
      mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
      mm/huge_memory.c: remove redundant PageCompound() check
      mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
      mm/huge_memory.c: use helper function migration_entry_to_page()

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for khugepaged":
      khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
      khugepaged: remove unnecessary out label in collapse_huge_page()
      khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()

    Zi Yan <ziy@nvidia.com>:
      mm: huge_memory: a new debugfs interface for splitting THP tests
      mm: huge_memory: debugfs for file-backed THP split

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for hugetlb", v2:
      mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
      mm/hugeltb: simplify the return code of __vma_reservation_common()
      mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
      mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
      mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "make hugetlb put_page safe for all calling contexts", v5:
      mm/cma: change cma mutex to irq safe spinlock
      hugetlb: no need to drop hugetlb_lock to call cma_release
      hugetlb: add per-hstate mutex to synchronize user adjustments
      hugetlb: create remove_hugetlb_page() to separate functionality
      hugetlb: call update_and_free_page without hugetlb_lock
      hugetlb: change free_pool_huge_page to remove_pool_huge_page
      hugetlb: make free_huge_page irq safe
      hugetlb: add lockdep_assert_held() calls for hugetlb_lock

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Make alloc_contig_range handle Hugetlb pages", v10:
      mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
      mm,compaction: let isolate_migratepages_{range,block} return error codes
      mm,hugetlb: drop clearing of flag from prep_new_huge_page
      mm,hugetlb: split prep_new_huge_page functionality
      mm: make alloc_contig_range handle free hugetlb pages
      mm: make alloc_contig_range handle in-use hugetlb pages
      mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling", v9:
      userfaultfd: add minor fault registration mode
      userfaultfd: disable huge PMD sharing for MINOR registered VMAs
      userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
      userfaultfd: add UFFDIO_CONTINUE ioctl
      userfaultfd: update documentation to describe minor fault handling
      userfaultfd/selftests: add test exercising minor fault handling

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: move RECLAIM* bits to uapi header
      mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks

    Yang Shi <shy828301@gmail.com>:
    Patch series "Make shrinker's nr_deferred memcg aware", v10:
      mm: vmscan: use nid from shrink_control for tracepoint
      mm: vmscan: consolidate shrinker_maps handling code
      mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
      mm: vmscan: remove memcg_shrinker_map_size
      mm: vmscan: use kvfree_rcu instead of call_rcu
      mm: memcontrol: rename shrinker_map to shrinker_info
      mm: vmscan: add shrinker_info_protected() helper
      mm: vmscan: use a new flag to indicate shrinker is registered
      mm: vmscan: add per memcg shrinker nr_deferred
      mm: vmscan: use per memcg nr_deferred of shrinker
      mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
      mm: memcontrol: reparent nr_deferred when memcg offline
      mm: vmscan: shrink deferred objects proportional to priority

Subsystem: mm/compaction

    Pintu Kumar <pintu@codeaurora.org>:
      mm/compaction: remove unused variable sysctl_compact_memory

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: update the COMPACT[STALL|FAIL] events properly

Subsystem: mm/migration

    Minchan Kim <minchan@kernel.org>:
      mm: disable LRU pagevec during the migration temporarily
      mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
      mm: fs: invalidate BH LRU during page migration

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for mm/migrate.c", v3:
      mm/migrate.c: make putback_movable_page() static
      mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
      mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
      mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
      Revert "mm: migrate: skip shared exec THP for NUMA balancing"

Subsystem: mm/cma

    Minchan Kim <minchan@kernel.org>:
      mm: vmstat: add cma statistics

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: cma: use pr_err_ratelimited for CMA warning

    Liam Mark <lmark@codeaurora.org>:
      mm: cma: add trace events for CMA alloc perf testing

    Minchan Kim <minchan@kernel.org>:
      mm: cma: support sysfs
      mm: cma: add the CMA instance name to cma trace events
      mm: use proper type for cma_[alloc|release]

Subsystem: mm/ksm

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for ksm":
      ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
      ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
      ksm: remove dedicated macro KSM_FLAG_MASK
      ksm: fix potential missing rmap_item for stable_node

    Chengyang Fan <cy.fan@huawei.com>:
      mm/ksm: remove unused parameter from remove_trailing_rmap_items()

Subsystem: mm/vmstat

    Hugh Dickins <hughd@google.com>:
      mm: restore node stat checking in /proc/sys/vm/stat_refresh
      mm: no more EINVAL from /proc/sys/vm/stat_refresh
      mm: /proc/sys/vm/stat_refresh skip checking known negative stats
      mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats

    Saravanan D <saravanand@fb.com>:
      x86/mm: track linear mapping split events

Subsystem: mm/mmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap.c: don't unlock VMAs in remap_file_pages()

Subsystem: mm/kconfig

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm: some config cleanups", v2:
      mm: generalize ARCH_HAS_CACHE_LINE_SIZE
      mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
      mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
      mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
      mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK
      mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE

Subsystem: mm/util

    Joe Perches <joe@perches.com>:
      mm/util.c: reduce mem_dump_obj() object size

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/util.c: fix typo

Subsystem: mm/memory-hotplug

    Pavel Tatashin <pasha.tatashin@soleen.com>:
    Patch series "prohibit pinning pages in ZONE_MOVABLE", v11:
      mm/gup: don't pin migrated cma pages in movable zone
      mm/gup: check every subpage of a compound page during isolation
      mm/gup: return an error on migration failure
      mm/gup: check for isolation errors
      mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
      mm: apply per-task gfp constraints in fast path
      mm: honor PF_MEMALLOC_PIN for all movable pages
      mm/gup: do not migrate zero page
      mm/gup: migrate pinned pages out of movable zone
      memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
      mm/gup: change index type to long as it counts pages
      mm/gup: longterm pin migration cleanup
      selftests/vm: gup_test: fix test flag
      selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages

    Mel Gorman <mgorman@techsingularity.net>:
      mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Allocate memmap from hotadded memory (per device)", v10:
      drivers/base/memory: introduce memory_block_{online,offline}
      mm,memory_hotplug: relax fully spanned sections check

    David Hildenbrand <david@redhat.com>:
      mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: allocate memmap from the added memory range
      acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
      mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
      x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
      arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE

Subsystem: mm/zswap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/zswap.c: switch from strlcpy to strscpy

Subsystem: mm/zsmalloc

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
    Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()":
      iov_iter: lift memzero_page() to highmem.h
      btrfs: use memzero_page() instead of open coded kmap pattern

    songqiang <songqiang@uniontech.com>:
      mm/highmem.c: fix coding style issue

Subsystem: mm/cleanups

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/mempool: minor coding style tweaks

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      mm/process_vm_access.c: remove duplicate include

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: zero guard page after out-of-bounds access
    Patch series "kfence: optimize timer scheduling", v2:
      kfence: await for allocation using wait_event
      kfence: maximize allocation wait timeout duration
      kfence: use power-efficient work queue to run delayed work

 Documentation/ABI/testing/sysfs-kernel-mm-cma     |   25 
 Documentation/admin-guide/kernel-parameters.txt   |   17 
 Documentation/admin-guide/mm/memory-hotplug.rst   |    9 
 Documentation/admin-guide/mm/userfaultfd.rst      |  105 +-
 arch/arc/Kconfig                                  |    9 
 arch/arm/Kconfig                                  |   10 
 arch/arm64/Kconfig                                |   34 
 arch/arm64/mm/hugetlbpage.c                       |    7 
 arch/ia64/Kconfig                                 |   14 
 arch/ia64/mm/hugetlbpage.c                        |    3 
 arch/mips/Kconfig                                 |    6 
 arch/mips/mm/hugetlbpage.c                        |    4 
 arch/parisc/Kconfig                               |    5 
 arch/parisc/mm/hugetlbpage.c                      |    2 
 arch/powerpc/Kconfig                              |   17 
 arch/powerpc/mm/hugetlbpage.c                     |    3 
 arch/powerpc/platforms/Kconfig.cputype            |   16 
 arch/riscv/Kconfig                                |    5 
 arch/s390/Kconfig                                 |   12 
 arch/s390/mm/hugetlbpage.c                        |    2 
 arch/sh/Kconfig                                   |    7 
 arch/sh/mm/Kconfig                                |    8 
 arch/sh/mm/hugetlbpage.c                          |    2 
 arch/sparc/mm/hugetlbpage.c                       |    2 
 arch/x86/Kconfig                                  |   33 
 arch/x86/mm/pat/set_memory.c                      |    8 
 drivers/acpi/acpi_memhotplug.c                    |    5 
 drivers/base/memory.c                             |  105 ++
 fs/Kconfig                                        |    5 
 fs/block_dev.c                                    |    2 
 fs/btrfs/compression.c                            |    5 
 fs/btrfs/extent_io.c                              |   22 
 fs/btrfs/inode.c                                  |   33 
 fs/btrfs/reflink.c                                |    6 
 fs/btrfs/zlib.c                                   |    5 
 fs/btrfs/zstd.c                                   |    5 
 fs/buffer.c                                       |   36 
 fs/dax.c                                          |    8 
 fs/gfs2/glock.c                                   |    3 
 fs/hugetlbfs/inode.c                              |    9 
 fs/inode.c                                        |   11 
 fs/proc/task_mmu.c                                |    3 
 fs/userfaultfd.c                                  |  149 +++
 include/linux/buffer_head.h                       |    4 
 include/linux/cma.h                               |    4 
 include/linux/compaction.h                        |    1 
 include/linux/fs.h                                |    2 
 include/linux/gfp.h                               |    2 
 include/linux/highmem.h                           |    7 
 include/linux/huge_mm.h                           |    3 
 include/linux/hugetlb.h                           |   37 
 include/linux/memcontrol.h                        |   27 
 include/linux/memory.h                            |    8 
 include/linux/memory_hotplug.h                    |   15 
 include/linux/memremap.h                          |    2 
 include/linux/migrate.h                           |   11 
 include/linux/mm.h                                |   28 
 include/linux/mmzone.h                            |   20 
 include/linux/pagemap.h                           |    5 
 include/linux/pgtable.h                           |   12 
 include/linux/sched.h                             |    2 
 include/linux/sched/mm.h                          |   27 
 include/linux/shrinker.h                          |    7 
 include/linux/swap.h                              |   21 
 include/linux/userfaultfd_k.h                     |   55 +
 include/linux/vm_event_item.h                     |    8 
 include/trace/events/cma.h                        |   92 +-
 include/trace/events/migrate.h                    |   25 
 include/trace/events/mmflags.h                    |    7 
 include/uapi/linux/mempolicy.h                    |    7 
 include/uapi/linux/userfaultfd.h                  |   36 
 init/Kconfig                                      |    5 
 kernel/sysctl.c                                   |    2 
 lib/Kconfig.kfence                                |    1 
 lib/iov_iter.c                                    |    8 
 mm/Kconfig                                        |   28 
 mm/Makefile                                       |    6 
 mm/cma.c                                          |   70 +
 mm/cma.h                                          |   25 
 mm/cma_debug.c                                    |    8 
 mm/cma_sysfs.c                                    |  112 ++
 mm/compaction.c                                   |  113 ++
 mm/filemap.c                                      |   24 
 mm/frontswap.c                                    |   12 
 mm/gup.c                                          |  264 +++---
 mm/gup_test.c                                     |   29 
 mm/gup_test.h                                     |    3 
 mm/highmem.c                                      |   11 
 mm/huge_memory.c                                  |  326 +++++++-
 mm/hugetlb.c                                      |  843 ++++++++++++++--------
 mm/hugetlb_cgroup.c                               |    9 
 mm/internal.h                                     |   10 
 mm/kfence/core.c                                  |   61 +
 mm/khugepaged.c                                   |   63 -
 mm/ksm.c                                          |   17 
 mm/list_lru.c                                     |    6 
 mm/memcontrol.c                                   |  137 ---
 mm/memory_hotplug.c                               |  220 +++++
 mm/mempolicy.c                                    |   16 
 mm/mempool.c                                      |    2 
 mm/migrate.c                                      |  103 --
 mm/mlock.c                                        |    4 
 mm/mmap.c                                         |   18 
 mm/oom_kill.c                                     |    2 
 mm/page_alloc.c                                   |   83 +-
 mm/process_vm_access.c                            |    1 
 mm/shmem.c                                        |    2 
 mm/sparse.c                                       |    4 
 mm/swap.c                                         |   69 +
 mm/swap_state.c                                   |    4 
 mm/swapfile.c                                     |    4 
 mm/truncate.c                                     |   19 
 mm/userfaultfd.c                                  |   39 -
 mm/util.c                                         |   26 
 mm/vmalloc.c                                      |    2 
 mm/vmscan.c                                       |  543 +++++++++-----
 mm/vmstat.c                                       |   45 -
 mm/workingset.c                                   |    1 
 mm/zsmalloc.c                                     |    6 
 mm/zswap.c                                        |    2 
 tools/testing/selftests/vm/.gitignore             |    1 
 tools/testing/selftests/vm/Makefile               |    1 
 tools/testing/selftests/vm/gup_test.c             |   38 
 tools/testing/selftests/vm/split_huge_page_test.c |  400 ++++++++++
 tools/testing/selftests/vm/userfaultfd.c          |  164 ++++
 125 files changed, 3596 insertions(+), 1668 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-04-30  5:52 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-04-30  5:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A few misc subsystems and some of MM.


178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0.

Subsystems affected by this patch series:

  ia64
  kbuild
  scripts
  sh
  ocfs2
  kfifo
  vfs
  kernel/watchdog
  mm/slab-generic
  mm/slub
  mm/kmemleak
  mm/debug
  mm/pagecache
  mm/msync
  mm/gup
  mm/memremap
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/dma
  mm/sparsemem
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/memory-failure

Subsystem: ia64

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      arch/ia64/kernel/head.S: remove duplicate include

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      arch/ia64/kernel/fsys.S: fix typos
      arch/ia64/include/asm/pgtable.h: minor typo fixes

    Valentin Schneider <valentin.schneider@arm.com>:
      ia64: ensure proper NUMA distance and possible map initialization

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: drop unused IA64_FW_EMU ifdef
      ia64: simplify code flow around swiotlb init

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ia64: trivial spelling fixes

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix EFI_DEBUG build
      ia64: mca: always make IA64_MCA_DEBUG an expression
      ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP
      ia64: module: fix symbolizer crash on fdescr

Subsystem: kbuild

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*()

Subsystem: scripts

    Tom Saeger <tom.saeger@oracle.com>:
      scripts/spelling.txt: add entries for recent discoveries

    Wan Jiabing <wanjiabing@vivo.com>:
      scripts: a new script for checking duplicate struct declaration

Subsystem: sh

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      arch/sh/include/asm/tlb.h: remove duplicate include

Subsystem: ocfs2

    Yang Li <yang.lee@linux.alibaba.com>:
      ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: map flags directly in flags_to_o2dlm()

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ocfs2: fix a typo

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      ocfs2/dlm: remove unused function

Subsystem: kfifo

    Dan Carpenter <dan.carpenter@oracle.com>:
      kfifo: fix ternary sign extension bugs

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      vfs: fs_parser: clean up kernel-doc warnings

Subsystem: kernel/watchdog

    Petr Mladek <pmladek@suse.com>:
    Patch series "watchdog/softlockup: Report overall time and some cleanup", v2:
      watchdog: rename __touch_watchdog() to a better descriptive name
      watchdog: explicitly update timestamp when reporting softlockup
      watchdog/softlockup: report the overall time of softlockups
      watchdog/softlockup: remove logic that tried to prevent repeated reports
      watchdog: fix barriers when printing backtraces from all CPUs
      watchdog: cleanup handling of false positives

Subsystem: mm/slab-generic

    Rafael Aquini <aquini@redhat.com>:
      mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: enable slub_debug static key when creating cache with explicit debug flags

    Oliver Glitta <glittao@gmail.com>:
      kunit: add a KUnit test for SLUB debugging functionality
      slub: remove resiliency_test() function

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/slub.c: trivial typo fixes

Subsystem: mm/kmemleak

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/kmemleak.c: fix a typo

Subsystem: mm/debug

    Georgi Djakov <georgi.djakov@linaro.org>:
      mm/page_owner: record the timestamp of all pages during free

    zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
      mm, page_owner: remove unused parameter in __set_page_owner_handle

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_owner: fetch backtrace only for tracked pages
      mm: page_owner: use kstrtobool() to parse bool option
      mm: page_owner: detect page_owner recursion via task_struct
      mm: page_poison: print page info when corruption is caught

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memtest: add ARCH_USE_MEMTEST

Subsystem: mm/pagecache

    Jens Axboe <axboe@kernel.dk>:
    Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3:
      mm: provide filemap_range_needs_writeback() helper
      mm: use filemap_range_needs_writeback() for O_DIRECT reads
      iomap: use filemap_range_needs_writeback() for O_DIRECT reads

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap: use filemap_read_page in filemap_fault
      mm/filemap: drop check for truncated page after I/O

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page-writeback: simplify memcg handling in test_clear_page_writeback()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move page_mapping_file to pagemap.h

    Rui Sun <sunrui26@huawei.com>:
      mm/filemap: update stale comment

Subsystem: mm/msync

    Nikita Ermakov <sh1r4s3@mail.si-head.nl>:
      mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start

Subsystem: mm/gup

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm/gup: page unpining improvements", v4:
      mm/gup: add compound page list iterator
      mm/gup: decrement head page once for group of subpages
      mm/gup: add a range variant of unpin_user_pages_dirty_lock()
      RDMA/umem: batch page unpin in __ib_umem_release()

    Yang Shi <shy828301@gmail.com>:
      mm: gup: remove FOLL_SPLIT

Subsystem: mm/memremap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/memremap.c: fix improper SPDX comment style

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix kernel stack account

    Shakeel Butt <shakeelb@google.com>:
      memcg: cleanup root memcg checks
      memcg: enable memcg oom-kill for __GFP_NOFAIL

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "mm: memcontrol: switch to rstat", v3:
      mm: memcontrol: fix cpuhotplug statistics flushing
      mm: memcontrol: kill mem_cgroup_nodeinfo()
      mm: memcontrol: privatize memcg_page_state query functions
      cgroup: rstat: support cgroup1
      cgroup: rstat: punt root-level optimization to individual controllers
      mm: memcontrol: switch to rstat
      mm: memcontrol: consolidate lruvec stat flushing
      kselftests: cgroup: update kmem test for new vmstat implementation

    Shakeel Butt <shakeelb@google.com>:
      memcg: charge before adding to swapcache on swapin

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Use obj_cgroup APIs to charge kmem pages", v5:
      mm: memcontrol: slab: fix obtain a reference to a freeing memcg
      mm: memcontrol: introduce obj_cgroup_{un}charge_pages
      mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c
      mm: memcontrol: change ug->dummy_page only if memcg changed
      mm: memcontrol: use obj_cgroup APIs to charge kmem pages
      mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages()
      mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM

    Wan Jiabing <wanjiabing@vivo.com>:
      linux/memcontrol.h: remove duplicate struct declaration

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page_counter: mitigate consequences of a page_counter underflow

Subsystem: mm/pagemap

    Wang Qing <wangqing@vivo.com>:
      mm/memory.c: do_numa_page(): delete bool "migrated"

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/interval_tree: add comments to improve code readability

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Cleanup and fixups for vmemmap handling", v6:
      x86/vmemmap: drop handling of 4K unaligned vmemmap range
      x86/vmemmap: drop handling of 1GB vmemmap ranges
      x86/vmemmap: handle unpopulated sub-pmd ranges
      x86/vmemmap: optimize for consecutive sections in partial populated PMDs

    Ovidiu Panait <ovidiu.panait@windriver.com>:
      mm, tracing: improve rss_stat tracepoint message

    Christoph Hellwig <hch@lst.de>:
    Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2:
      mm: add remap_pfn_range_notrack
      mm: add a io_mapping_map_user helper
      i915: use io_mapping_map_user
      i915: fix remap_io_sg to verify the pgprot

    Huang Ying <ying.huang@intel.com>:
      NUMA balancing: reduce TLB flush via delaying mapping on hint page fault

Subsystem: mm/mremap

    Brian Geffon <bgeffon@google.com>:
    Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5:
      mm: extend MREMAP_DONTUNMAP to non-anonymous mappings
      Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio"
      selftests: add a MREMAP_DONTUNMAP selftest for shmem

Subsystem: mm/dma

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/dmapool: switch from strlcpy to strscpy

Subsystem: mm/sparsemem

    Wang Wensheng <wangwensheng4@huawei.com>:
      mm/sparse: add the missing sparse_buffer_fini() in error branch

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
    Patch series "remap_vmalloc_range cleanups":
      samples/vfio-mdev/mdpy: use remap_vmalloc_range
      mm: unexport remap_vmalloc_range_partial

    Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>:
      mm/vmalloc: use rb_tree instead of list for vread() lookups

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "huge vmalloc mappings", v13:
      ARM: mm: add missing pud_page define to 2-level page tables
      mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page
      mm: apply_to_pte_range warn and fail if a large pte is encountered
      mm/vmalloc: rename vmap_*_range vmap_pages_*_range
      mm/ioremap: rename ioremap_*_range to vmap_*_range
      mm: HUGE_VMAP arch support cleanup
      powerpc: inline huge vmap supported functions
      arm64: inline huge vmap supported functions
      x86: inline huge vmap supported functions
      mm/vmalloc: provide fallback arch huge vmap support functions
      mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c
      mm/vmalloc: add vmap_range_noflush variant
      mm/vmalloc: hugepage vmalloc mappings
    Patch series "mm/vmalloc: cleanup after hugepage series", v2:
      mm/vmalloc: remove map_kernel_range
      kernel/dma: remove unnecessary unmap_kernel_range
      powerpc/xive: remove unnecessary unmap_kernel_range
      mm/vmalloc: remove unmap_kernel_range
      mm/vmalloc: improve allocation failure error messages

    Vijayanand Jitta <vjitta@codeaurora.org>:
      mm: vmalloc: prevent use after free in _vm_unmap_aliases

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      lib/test_vmalloc.c: remove two kvfree_rcu() tests
      lib/test_vmalloc.c: add a new 'nr_threads' parameter
      vm/test_vmalloc.sh: adapt for updated driver interface
      mm/vmalloc: refactor the preloading loagic
      mm/vmalloc: remove an empty line

Subsystem: mm/documentation

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/doc: fix fault_flag_allow_retry_first kerneldoc
      mm/doc: fix page_maybe_dma_pinned kerneldoc
      mm/doc: turn fault flags into an enum
      mm/doc: add mm.h and mm_types.h to the mm-api document

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
    Patch series "kernel-doc and MAINTAINERS clean-up":
      MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT
      pagewalk: prefix struct kernel-doc descriptions

Subsystem: mm/kasan

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/kasan: switch from strlcpy to strscpy

    Peter Collingbourne <pcc@google.com>:
      kasan: fix kasan_byte_accessible() to be consistent with actual checks

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: initialize shadow to TAG_INVALID for SW_TAGS
      mm, kasan: don't poison boot memory with tag-based modes
    Patch series "kasan: integrate with init_on_alloc/free", v3:
      arm64: kasan: allow to init memory when setting tags
      kasan: init memory in kasan_(un)poison for HW_TAGS
      kasan, mm: integrate page_alloc init with HW_TAGS
      kasan, mm: integrate slab init_on_alloc with HW_TAGS
      kasan, mm: integrate slab init_on_free with HW_TAGS
      kasan: docs: clean up sections
      kasan: docs: update overview section
      kasan: docs: update usage section
      kasan: docs: update error reports section
      kasan: docs: update boot parameters section
      kasan: docs: update GENERIC implementation details section
      kasan: docs: update SW_TAGS implementation details section
      kasan: docs: update HW_TAGS implementation details section
      kasan: docs: update shadow memory section
      kasan: docs: update ignoring accesses section
      kasan: docs: update tests section

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: record task_work_add() call stack

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: detect false-positives in tests

    Zqiang <qiang.zhang@windriver.com>:
      irq_work: record irq_work_queue() call stack

Subsystem: mm/initialization

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: move mem_init_print_info() into mm_init()

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range()

    Minchan Kim <minchan@kernel.org>:
      mm: remove lru_add_drain_all in alloc_contig_range

    Yu Zhao <yuzhao@google.com>:
      include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH
      include/linux/page-flags-layout.h: cleanups

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Rationalise __alloc_pages wrappers", v3:
      mm/page_alloc: rename alloc_mask to alloc_gfp
      mm/page_alloc: rename gfp_mask to gfp
      mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask
      mm/mempolicy: rename alloc_pages_current to alloc_pages
      mm/mempolicy: rewrite alloc_pages documentation
      mm/mempolicy: rewrite alloc_pages_vma documentation
      mm/mempolicy: fix mpol_misplaced kernel-doc

    Minchan Kim <minchan@kernel.org>:
      mm: page_alloc: dump migrate-failed pages

    Geert Uytterhoeven <geert@linux-m68k.org>:
      mm/Kconfig: remove default DISCONTIGMEM_MANUAL

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm, page_alloc: avoid page_to_pfn() in move_freepages()

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/page_alloc: duplicate include linux/vmalloc.h

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6:
      mm/page_alloc: rename alloced to allocated
      mm/page_alloc: add a bulk page allocator
      mm/page_alloc: add an array-based interface to the bulk page allocator

    Jesper Dangaard Brouer <brouer@redhat.com>:
      mm/page_alloc: optimize code layout for __alloc_pages_bulk
      mm/page_alloc: inline __rmqueue_pcplist

    Chuck Lever <chuck.lever@oracle.com>:
    Patch series "SUNRPC consumer for the bulk page allocator":
      SUNRPC: set rq_page_end differently
      SUNRPC: refresh rq_pages using a bulk page allocator

    Jesper Dangaard Brouer <brouer@redhat.com>:
      net: page_pool: refactor dma_map into own function page_pool_dma_map
      net: page_pool: use alloc_pages_bulk in refill code path

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1

    huxiang <huxiang@uniontech.com>:
      mm/page_alloc: redundant definition variables of pfn in for loop

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/mmzone.h: fix existing kernel-doc comments and link them to core-api

Subsystem: mm/memory-failure

    Jane Chu <jane.chu@oracle.com>:
      mm/memory-failure: unnecessary amount of unmapping

 Documentation/admin-guide/kernel-parameters.txt |    7 
 Documentation/admin-guide/mm/transhuge.rst      |    2 
 Documentation/core-api/cachetlb.rst             |    4 
 Documentation/core-api/mm-api.rst               |    6 
 Documentation/dev-tools/kasan.rst               |  355 +++++-----
 Documentation/vm/page_owner.rst                 |    2 
 Documentation/vm/transhuge.rst                  |    5 
 MAINTAINERS                                     |    1 
 arch/Kconfig                                    |   11 
 arch/alpha/mm/init.c                            |    1 
 arch/arc/mm/init.c                              |    1 
 arch/arm/Kconfig                                |    1 
 arch/arm/include/asm/pgtable-3level.h           |    2 
 arch/arm/include/asm/pgtable.h                  |    3 
 arch/arm/mm/copypage-v4mc.c                     |    1 
 arch/arm/mm/copypage-v6.c                       |    1 
 arch/arm/mm/copypage-xscale.c                   |    1 
 arch/arm/mm/init.c                              |    2 
 arch/arm64/Kconfig                              |    1 
 arch/arm64/include/asm/memory.h                 |    4 
 arch/arm64/include/asm/mte-kasan.h              |   39 -
 arch/arm64/include/asm/vmalloc.h                |   38 -
 arch/arm64/mm/init.c                            |    4 
 arch/arm64/mm/mmu.c                             |   36 -
 arch/csky/abiv1/cacheflush.c                    |    1 
 arch/csky/mm/init.c                             |    1 
 arch/h8300/mm/init.c                            |    2 
 arch/hexagon/mm/init.c                          |    1 
 arch/ia64/Kconfig                               |   23 
 arch/ia64/configs/bigsur_defconfig              |    1 
 arch/ia64/include/asm/meminit.h                 |   11 
 arch/ia64/include/asm/module.h                  |    6 
 arch/ia64/include/asm/page.h                    |   25 
 arch/ia64/include/asm/pgtable.h                 |    7 
 arch/ia64/kernel/Makefile                       |    2 
 arch/ia64/kernel/acpi.c                         |    7 
 arch/ia64/kernel/efi.c                          |   11 
 arch/ia64/kernel/fsys.S                         |    4 
 arch/ia64/kernel/head.S                         |    6 
 arch/ia64/kernel/ia64_ksyms.c                   |   12 
 arch/ia64/kernel/machine_kexec.c                |    2 
 arch/ia64/kernel/mca.c                          |    4 
 arch/ia64/kernel/module.c                       |   29 
 arch/ia64/kernel/pal.S                          |    6 
 arch/ia64/mm/Makefile                           |    1 
 arch/ia64/mm/contig.c                           |    4 
 arch/ia64/mm/discontig.c                        |   21 
 arch/ia64/mm/fault.c                            |   15 
 arch/ia64/mm/init.c                             |  221 ------
 arch/m68k/mm/init.c                             |    1 
 arch/microblaze/mm/init.c                       |    1 
 arch/mips/Kconfig                               |    1 
 arch/mips/loongson64/numa.c                     |    1 
 arch/mips/mm/cache.c                            |    1 
 arch/mips/mm/init.c                             |    1 
 arch/mips/sgi-ip27/ip27-memory.c                |    1 
 arch/nds32/mm/init.c                            |    1 
 arch/nios2/mm/cacheflush.c                      |    1 
 arch/nios2/mm/init.c                            |    1 
 arch/openrisc/mm/init.c                         |    2 
 arch/parisc/mm/init.c                           |    2 
 arch/powerpc/Kconfig                            |    1 
 arch/powerpc/include/asm/vmalloc.h              |   34 -
 arch/powerpc/kernel/isa-bridge.c                |    4 
 arch/powerpc/kernel/pci_64.c                    |    2 
 arch/powerpc/mm/book3s64/radix_pgtable.c        |   29 
 arch/powerpc/mm/ioremap.c                       |    2 
 arch/powerpc/mm/mem.c                           |    1 
 arch/powerpc/sysdev/xive/common.c               |    4 
 arch/riscv/mm/init.c                            |    1 
 arch/s390/mm/init.c                             |    2 
 arch/sh/include/asm/tlb.h                       |   10 
 arch/sh/mm/cache-sh4.c                          |    1 
 arch/sh/mm/cache-sh7705.c                       |    1 
 arch/sh/mm/init.c                               |    1 
 arch/sparc/include/asm/pgtable_32.h             |    3 
 arch/sparc/mm/init_32.c                         |    2 
 arch/sparc/mm/init_64.c                         |    1 
 arch/sparc/mm/tlb.c                             |    1 
 arch/um/kernel/mem.c                            |    1 
 arch/x86/Kconfig                                |    1 
 arch/x86/include/asm/vmalloc.h                  |   42 -
 arch/x86/kernel/cpu/resctrl/pseudo_lock.c       |    2 
 arch/x86/mm/init_32.c                           |    2 
 arch/x86/mm/init_64.c                           |  222 ++++--
 arch/x86/mm/ioremap.c                           |   33 
 arch/x86/mm/pgtable.c                           |   13 
 arch/xtensa/Kconfig                             |    1 
 arch/xtensa/mm/init.c                           |    1 
 block/blk-cgroup.c                              |   17 
 drivers/gpu/drm/i915/Kconfig                    |    1 
 drivers/gpu/drm/i915/gem/i915_gem_mman.c        |    9 
 drivers/gpu/drm/i915/i915_drv.h                 |    3 
 drivers/gpu/drm/i915/i915_mm.c                  |  117 ---
 drivers/infiniband/core/umem.c                  |   12 
 drivers/pci/pci.c                               |    2 
 fs/aio.c                                        |    5 
 fs/fs_parser.c                                  |    2 
 fs/iomap/direct-io.c                            |   24 
 fs/ocfs2/blockcheck.c                           |    2 
 fs/ocfs2/dlm/dlmrecovery.c                      |    7 
 fs/ocfs2/stack_o2cb.c                           |   36 -
 fs/ocfs2/stackglue.c                            |    2 
 include/linux/compiler-gcc.h                    |    8 
 include/linux/fs.h                              |    2 
 include/linux/gfp.h                             |   45 -
 include/linux/io-mapping.h                      |    3 
 include/linux/io.h                              |    9 
 include/linux/kasan.h                           |   51 +
 include/linux/memcontrol.h                      |  271 ++++----
 include/linux/mm.h                              |   50 -
 include/linux/mmzone.h                          |   43 -
 include/linux/page-flags-layout.h               |   64 -
 include/linux/pagemap.h                         |   10 
 include/linux/pagewalk.h                        |    4 
 include/linux/sched.h                           |    4 
 include/linux/slab.h                            |    2 
 include/linux/slub_def.h                        |    2 
 include/linux/vmalloc.h                         |   73 +-
 include/linux/vmstat.h                          |   24 
 include/net/page_pool.h                         |    2 
 include/trace/events/kmem.h                     |   24 
 init/main.c                                     |    2 
 kernel/cgroup/cgroup.c                          |   34 -
 kernel/cgroup/rstat.c                           |   61 +
 kernel/dma/remap.c                              |    1 
 kernel/fork.c                                   |   13 
 kernel/irq_work.c                               |    7 
 kernel/task_work.c                              |    3 
 kernel/watchdog.c                               |  102 +--
 lib/Kconfig.debug                               |   14 
 lib/Makefile                                    |    1 
 lib/test_kasan.c                                |   59 -
 lib/test_slub.c                                 |  124 +++
 lib/test_vmalloc.c                              |  128 +--
 mm/Kconfig                                      |    4 
 mm/Makefile                                     |    1 
 mm/debug_vm_pgtable.c                           |    4 
 mm/dmapool.c                                    |    2 
 mm/filemap.c                                    |   61 +
 mm/gup.c                                        |  145 +++-
 mm/hugetlb.c                                    |    2 
 mm/internal.h                                   |   25 
 mm/interval_tree.c                              |    2 
 mm/io-mapping.c                                 |   29 
 mm/ioremap.c                                    |  361 ++--------
 mm/kasan/common.c                               |   53 -
 mm/kasan/generic.c                              |   12 
 mm/kasan/kasan.h                                |   28 
 mm/kasan/report_generic.c                       |    2 
 mm/kasan/shadow.c                               |   10 
 mm/kasan/sw_tags.c                              |   12 
 mm/kmemleak.c                                   |    2 
 mm/memcontrol.c                                 |  798 ++++++++++++------------
 mm/memory-failure.c                             |    2 
 mm/memory.c                                     |  191 +++--
 mm/mempolicy.c                                  |   78 --
 mm/mempool.c                                    |    4 
 mm/memremap.c                                   |    2 
 mm/migrate.c                                    |    2 
 mm/mm_init.c                                    |    4 
 mm/mmap.c                                       |    6 
 mm/mremap.c                                     |    6 
 mm/msync.c                                      |    6 
 mm/page-writeback.c                             |    9 
 mm/page_alloc.c                                 |  430 +++++++++---
 mm/page_counter.c                               |    8 
 mm/page_owner.c                                 |   68 --
 mm/page_poison.c                                |    6 
 mm/percpu-vm.c                                  |    7 
 mm/slab.c                                       |   43 -
 mm/slab.h                                       |   24 
 mm/slab_common.c                                |   10 
 mm/slub.c                                       |  215 ++----
 mm/sparse.c                                     |    1 
 mm/swap_state.c                                 |   13 
 mm/util.c                                       |   10 
 mm/vmalloc.c                                    |  728 ++++++++++++++++-----
 net/core/page_pool.c                            |  127 ++-
 net/sunrpc/svc_xprt.c                           |   38 -
 samples/kfifo/bytestream-example.c              |    8 
 samples/kfifo/inttype-example.c                 |    8 
 samples/kfifo/record-example.c                  |    8 
 samples/vfio-mdev/mdpy.c                        |    4 
 scripts/checkdeclares.pl                        |   53 +
 scripts/spelling.txt                            |   26 
 tools/testing/selftests/cgroup/test_kmem.c      |   22 
 tools/testing/selftests/vm/mremap_dontunmap.c   |   52 +
 tools/testing/selftests/vm/test_vmalloc.sh      |   21 
 189 files changed, 3642 insertions(+), 3013 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-04-23 21:28 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966.

Subsystems affected by this patch series:

  coda
  overlayfs
  mm/pagecache
  mm/memcg

Subsystem: coda

    Christian König <christian.koenig@amd.com>:
      coda: fix reference counting in coda_file_mmap error path

Subsystem: overlayfs

    Christian König <christian.koenig@amd.com>:
      ovl: fix reference counting in ovl_mmap error path

Subsystem: mm/pagecache

    Hugh Dickins <hughd@google.com>:
      mm/filemap: fix find_lock_entries hang on 32-bit THP
      mm/filemap: fix mapping_seek_hole_data on THP & 32-bit

Subsystem: mm/memcg

    Vasily Averin <vvs@virtuozzo.com>:
      tools/cgroup/slabinfo.py: updated to work on current kernel

 fs/coda/file.c                 |    6 +++---
 fs/overlayfs/file.c            |   11 +----------
 mm/filemap.c                   |   31 +++++++++++++++++++------------
 tools/cgroup/memcg_slabinfo.py |    8 ++++----
 4 files changed, 27 insertions(+), 29 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-04-16 22:45 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7.

Subsystems affected by this patch series:

  mm/documentation
  mm/kasan
  csky
  ia64
  mm/pagemap
  gcov
  lib

Subsystem: mm/documentation

    Randy Dunlap <rdunlap@infradead.org>:
      mm: eliminate "expecting prototype" kernel-doc warnings

Subsystem: mm/kasan

    Arnd Bergmann <arnd@arndb.de>:
      kasan: fix hwasan build for gcc

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: csky

    Randy Dunlap <rdunlap@infradead.org>:
      csky: change a Kconfig symbol name to fix e1000 build error

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: remove duplicate entries in generic_defconfig
      ia64: fix discontig.c section mismatches

    John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>:
      ia64: tools: remove inclusion of ia64-specific version of errno.h header

    John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>:
      ia64: tools: remove duplicate definition of ia64_mf() on ia64

Subsystem: mm/pagemap

    Zack Rusin <zackr@vmware.com>:
      mm/mapping_dirty_helpers: guard hugepage pud's usage

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: ptdump: fix build failure

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      gcov: clang: fix clang-11+ build

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: remove "expecting prototype" kernel-doc warnings

 arch/arm64/kernel/sleep.S             |    2 +-
 arch/csky/Kconfig                     |    2 +-
 arch/csky/include/asm/page.h          |    2 +-
 arch/ia64/configs/generic_defconfig   |    2 --
 arch/ia64/mm/discontig.c              |    6 +++---
 arch/x86/kernel/acpi/wakeup_64.S      |    2 +-
 include/linux/kasan.h                 |    2 +-
 kernel/gcov/clang.c                   |    2 +-
 lib/Kconfig.kasan                     |    9 ++-------
 lib/earlycpio.c                       |    4 ++--
 lib/lru_cache.c                       |    3 ++-
 lib/parman.c                          |    4 ++--
 lib/radix-tree.c                      |   11 ++++++-----
 mm/kasan/common.c                     |    2 +-
 mm/kasan/kasan.h                      |    2 +-
 mm/kasan/report_generic.c             |    2 +-
 mm/mapping_dirty_helpers.c            |    2 ++
 mm/mmu_gather.c                       |   29 +++++++++++++++++++----------
 mm/oom_kill.c                         |    2 +-
 mm/ptdump.c                           |    2 +-
 mm/shuffle.c                          |    4 ++--
 scripts/Makefile.kasan                |   22 ++++++++++++++--------
 security/Kconfig.hardening            |    4 ++--
 tools/arch/ia64/include/asm/barrier.h |    3 ---
 tools/include/uapi/asm/errno.h        |    2 --
 25 files changed, 67 insertions(+), 60 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-04-09 20:26 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9.

Subsystems affected by this patch series:

  MAINTAINERS
  mailmap
  mm/kasan
  mm/gup
  nds32
  gcov
  ocfs2
  ia64
  mm/pagecache
  mm/kasan
  mm/kfence
  lib

Subsystem: MAINTAINERS

    Marek Behún <kabel@kernel.org>:
      MAINTAINERS: update CZ.NIC's Turris information
      treewide: change my e-mail address, fix my name

Subsystem: mailmap

    Jordan Crouse <jordan@cosmicpenguin.net>:
      mailmap: update email address for Jordan Crouse

    Matthew Wilcox <willy@infradead.org>:
      .mailmap: fix old email addresses

Subsystem: mm/kasan

    Arnd Bergmann <arnd@arndb.de>:
      kasan: fix hwasan build for gcc

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: mm/gup

    Aili Yao <yaoaili@kingsoft.com>:
      mm/gup: check page posion status for coredump.

Subsystem: nds32

    Mike Rapoport <rppt@linux.ibm.com>:
      nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: re-fix clang-11+ support

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: fix deadlock between setattr and dio_end_io_write

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix user_stack_pointer() for ptrace()

Subsystem: mm/pagecache

    Jack Qiu <jack.qiu@huawei.com>:
      fs: direct-io: fix missing sdio->boundary

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix conflict with page poisoning

    Andrew Morton <akpm@linux-foundation.org>:
      lib/test_kasan_module.c: suppress unused var warning

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence, x86: fix preemptible warning on KPTI-enabled systems

Subsystem: lib

    Julian Braha <julianbraha@gmail.com>:
      lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS

 .mailmap                                                            |    7 ++
 Documentation/ABI/testing/debugfs-moxtet                            |    4 -
 Documentation/ABI/testing/debugfs-turris-mox-rwtm                   |    2 
 Documentation/ABI/testing/sysfs-bus-moxtet-devices                  |    6 +-
 Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia       |    2 
 Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm            |   10 +--
 Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml |    2 
 MAINTAINERS                                                         |   13 +++-
 arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts              |    2 
 arch/arm64/kernel/sleep.S                                           |    2 
 arch/ia64/include/asm/ptrace.h                                      |    8 --
 arch/nds32/mm/cacheflush.c                                          |    2 
 arch/x86/include/asm/kfence.h                                       |    7 ++
 arch/x86/kernel/acpi/wakeup_64.S                                    |    2 
 drivers/bus/moxtet.c                                                |    4 -
 drivers/firmware/turris-mox-rwtm.c                                  |    4 -
 drivers/gpio/gpio-moxtet.c                                          |    4 -
 drivers/leds/leds-turris-omnia.c                                    |    4 -
 drivers/mailbox/armada-37xx-rwtm-mailbox.c                          |    4 -
 drivers/watchdog/armada_37xx_wdt.c                                  |    4 -
 fs/direct-io.c                                                      |    5 +
 fs/ocfs2/aops.c                                                     |   11 ---
 fs/ocfs2/file.c                                                     |    8 ++
 include/dt-bindings/bus/moxtet.h                                    |    2 
 include/linux/armada-37xx-rwtm-mailbox.h                            |    2 
 include/linux/kasan.h                                               |    2 
 include/linux/moxtet.h                                              |    2 
 kernel/gcov/clang.c                                                 |   29 ++++++----
 lib/Kconfig.debug                                                   |    6 +-
 lib/Kconfig.kasan                                                   |    9 ---
 lib/test_kasan_module.c                                             |    2 
 mm/gup.c                                                            |    4 +
 mm/internal.h                                                       |   20 ++++++
 mm/kasan/common.c                                                   |    2 
 mm/kasan/kasan.h                                                    |    2 
 mm/kasan/report_generic.c                                           |    2 
 mm/page_poison.c                                                    |    4 +
 scripts/Makefile.kasan                                              |   18 ++++--
 security/Kconfig.hardening                                          |    4 -
 39 files changed, 136 insertions(+), 91 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-03-25  4:36 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-03-25  4:36 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/kasan
  mm/gup
  mm/selftests
  mm/z3fold
  squashfs
  ia64
  gcov
  mm/kfence
  mm/memblock
  mm/highmem
  mailmap

Subsystem: mm/hugetlb

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix per-page tags for non-page_alloc pages

Subsystem: mm/gup

    Sean Christopherson <seanjc@google.com>:
      mm/mmu_notifiers: ensure range_end() is paired with range_start()

Subsystem: mm/selftests

    Rong Chen <rong.a.chen@intel.com>:
      selftests/vm: fix out-of-tree build

Subsystem: mm/z3fold

    Thomas Hebb <tommyhebb@gmail.com>:
      z3fold: prevent reclaim/free race for headless pages

Subsystem: squashfs

    Sean Nyekjaer <sean@geanix.com>:
      squashfs: fix inode lookup sanity checks

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix xattr id and id lookup sanity checks

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: mca: allocate early mca with GFP_ATOMIC
      ia64: fix format strings for err_inject

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: fix clang-11+ support

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: make compatible with kmemleak

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      mm: memblock: fix section mismatch warning again

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP

Subsystem: mailmap

    Andrey Konovalov <andreyknvl@google.com>:
      mailmap: update Andrey Konovalov's email address

 .mailmap                            |    1 
 arch/ia64/kernel/err_inject.c       |   22 +++++------
 arch/ia64/kernel/mca.c              |    2 -
 fs/squashfs/export.c                |    8 +++-
 fs/squashfs/id.c                    |    6 ++-
 fs/squashfs/squashfs_fs.h           |    1 
 fs/squashfs/xattr_id.c              |    6 ++-
 include/linux/hugetlb_cgroup.h      |   15 ++++++-
 include/linux/memblock.h            |    4 +-
 include/linux/mm.h                  |   18 +++++++--
 include/linux/mmu_notifier.h        |   10 ++---
 kernel/gcov/clang.c                 |   69 ++++++++++++++++++++++++++++++++++++
 mm/highmem.c                        |    4 +-
 mm/hugetlb.c                        |   41 +++++++++++++++++++--
 mm/hugetlb_cgroup.c                 |   10 ++++-
 mm/kfence/core.c                    |    9 ++++
 mm/kmemleak.c                       |    3 +
 mm/mmu_notifier.c                   |   23 ++++++++++++
 mm/z3fold.c                         |   16 +++++++-
 tools/testing/selftests/vm/Makefile |    4 +-
 20 files changed, 230 insertions(+), 42 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-03-13  5:06 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-03-13  5:06 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50.

Subsystems affected by this patch series:

  mm/memblock
  core-kernel
  kconfig
  mm/pagealloc
  fork
  mm/hugetlb
  mm/highmem
  binfmt
  MAINTAINERS
  kbuild
  mm/kfence
  mm/oom-kill
  mm/madvise
  mm/kasan
  mm/userfaultfd
  mm/memory-failure
  ia64
  mm/memcg
  mm/zram

Subsystem: mm/memblock

    Arnd Bergmann <arnd@arndb.de>:
      memblock: fix section mismatch warning

Subsystem: core-kernel

    Arnd Bergmann <arnd@arndb.de>:
      stop_machine: mark helpers __always_inline

Subsystem: kconfig

    Masahiro Yamada <masahiroy@kernel.org>:
      init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc.c: refactor initialization of struct page for holes in memory layout

Subsystem: fork

    Fenghua Yu <fenghua.yu@intel.com>:
      mm/fork: clear PASID for new mm

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5:
      hugetlb: dedup the code to add a new file_region
      hugetlb: break earlier in add_reservation_in_range() when we can
      mm: introduce page_needs_cow_for_dma() for deciding whether cow
      mm: use is_cow_mapping() across tree where proper
      hugetlb: do early cow when page pinned on src mm

Subsystem: mm/highmem

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      mm/highmem.c: fix zero_user_segments() with start > end

Subsystem: binfmt

    Lior Ribak <liorribak@gmail.com>:
      binfmt_misc: fix possible deadlock in bm_register_write

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: exclude uapi directories in API/ABI section

Subsystem: kbuild

    Arnd Bergmann <arnd@arndb.de>:
      linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP*

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: fix printk format for ptrdiff_t
      kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations
      kfence: fix reports if constant function prefixes exist

Subsystem: mm/oom-kill

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include/linux/sched/mm.h: use rcu_dereference in in_vfork()

Subsystem: mm/madvise

    Suren Baghdasaryan <surenb@google.com>:
      mm/madvise: replace ptrace attach requirement for process_madvise

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC
      kasan: fix KASAN_STACK dependency for HW_TAGS

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
      mm/userfaultfd: fix memory corruption due to writeprotect

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm, hwpoison: do not lock page again when me_huge_page() successfully recovers

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls
      ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign

Subsystem: mm/memcg

    Zhou Guanghui <zhouguanghui1@huawei.com>:
      mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument
      mm/memcg: set memcg when splitting page

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      zram: fix return value on writeback_store
      zram: fix broken page writeback

 MAINTAINERS                                |    4 
 arch/ia64/include/asm/syscall.h            |    2 
 arch/ia64/kernel/ptrace.c                  |   24 +++-
 drivers/block/zram/zram_drv.c              |   17 +-
 drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c |    4 
 drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c   |    2 
 fs/binfmt_misc.c                           |   29 ++---
 fs/proc/task_mmu.c                         |    2 
 include/linux/compiler-clang.h             |    6 +
 include/linux/memblock.h                   |    4 
 include/linux/memcontrol.h                 |    6 -
 include/linux/mm.h                         |   21 +++
 include/linux/mm_types.h                   |    1 
 include/linux/sched/mm.h                   |    3 
 include/linux/stop_machine.h               |   11 +
 init/Kconfig                               |    3 
 kernel/fork.c                              |    8 +
 lib/Kconfig.kasan                          |    1 
 mm/highmem.c                               |   17 ++
 mm/huge_memory.c                           |   10 -
 mm/hugetlb.c                               |  123 +++++++++++++++------
 mm/internal.h                              |    5 
 mm/kfence/report.c                         |   30 +++--
 mm/madvise.c                               |   13 ++
 mm/memcontrol.c                            |   15 +-
 mm/memory-failure.c                        |    4 
 mm/memory.c                                |   16 +-
 mm/page_alloc.c                            |  167 ++++++++++++++---------------
 mm/slab.c                                  |    2 
 29 files changed, 334 insertions(+), 216 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-02-26 17:55 ` incoming Linus Torvalds
@ 2021-02-26 19:16   ` Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, Linux-MM

On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - The rest of MM.
> >
> >   Includes kfence - another runtime memory validator.  Not as
> >   thorough as KASAN, but it has unmeasurable overhead and is intended
> >   to be usable in production builds.
> >
> > - Everything else
> 
> Just to clarify: you have nothing else really pending?

Yes, that's it from me for -rc1.




^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-02-26  1:14 incoming Andrew Morton
@ 2021-02-26 17:55 ` Linus Torvalds
  2021-02-26 19:16   ` incoming Andrew Morton
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - The rest of MM.
>
>   Includes kfence - another runtime memory validator.  Not as
>   thorough as KASAN, but it has unmeasurable overhead and is intended
>   to be usable in production builds.
>
> - Everything else

Just to clarify: you have nothing else really pending?

I'm hoping to just do -rc1 this weekend after all - despite my late
start due to loss of power for several days.

I'll allow late stragglers with good reason through, but the fewer of
those there are, the better, of course.

Thanks,
                   Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-02-26  1:14 Andrew Morton
  2021-02-26 17:55 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-02-26  1:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- The rest of MM.

  Includes kfence - another runtime memory validator.  Not as
  thorough as KASAN, but it has unmeasurable overhead and is intended
  to be usable in production builds.

- Everything else


118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab.

Subsystems affected by this patch series:

  mm/thp
  mm/cma
  mm/vmstat
  mm/memory-hotplug
  mm/mlock
  mm/rmap
  mm/zswap
  mm/zsmalloc
  mm/cleanups
  mm/kfence
  mm/kasan2
  alpha
  procfs
  sysctl
  misc
  core-kernel
  MAINTAINERS
  lib
  bitops
  checkpatch
  init
  coredump
  seq_file
  gdb
  ubsan
  initramfs
  mm/pagemap2

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Overhaul multi-page lookups for THP", v4:
      mm: make pagecache tagged lookups return only head pages
      mm/shmem: use pagevec_lookup in shmem_unlock_mapping
      mm/swap: optimise get_shadow_from_swap_cache
      mm: add FGP_ENTRY
      mm/filemap: rename find_get_entry to mapping_get_entry
      mm/filemap: add helper for finding pages
      mm/filemap: add mapping_seek_hole_data
      iomap: use mapping_seek_hole_data
      mm: add and use find_lock_entries
      mm: add an 'end' parameter to find_get_entries
      mm: add an 'end' parameter to pagevec_lookup_entries
      mm: remove nr_entries parameter from pagevec_lookup_entries
      mm: pass pvec directly to find_get_entries
      mm: remove pagevec_lookup_entries

    Rik van Riel <riel@surriel.com>:
    Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6:
      mm,thp,shmem: limit shmem THP alloc gfp_mask
      mm,thp,shm: limit gfp mask to no more than specified
      mm,thp,shmem: make khugepaged obey tmpfs mount flags
      mm,shmem,thp: limit shmem THP allocations to requested zones

Subsystem: mm/cma

    Roman Gushchin <guro@fb.com>:
      mm: cma: allocate cma areas bottom-up

    David Hildenbrand <david@redhat.com>:
      mm/cma: expose all pages to the buddy if activation of an area fails
      mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo

    Patrick Daly <pdaly@codeaurora.org>:
      mm: cma: print region name on failure

Subsystem: mm/vmstat

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: vmstat: fix NOHZ wakeups for node stat changes
      mm: vmstat: add some comments on internal storage of byte items

    Jiang Biao <benbjiang@tencent.com>:
      mm/vmstat.c: erase latency in vmstat_shepherd

Subsystem: mm/memory-hotplug

    Dan Williams <dan.j.williams@intel.com>:
    Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4:
      mm: move pfn_to_online_page() out of line
      mm: teach pfn_to_online_page() to consider subsection validity
      mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions
      mm: fix memory_failure() handling of dax-namespace metadata

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memory_hotplug: rename all existing 'memhp' into 'mhp'

    David Hildenbrand <david@redhat.com>:
      mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: don't store phys_device in memory blocks
      Documentation: sysfs/memory: clarify some memory block device properties

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5:
      mm/memory_hotplug: prevalidate the address range being added with platform
      arm64/mm: define arch_get_mappable_range()
      s390/mm: define arch_get_mappable_range()

    David Hildenbrand <david@redhat.com>:
      virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug

Subsystem: mm/mlock

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mlock: stop counting mlocked pages when none vma is found

Subsystem: mm/rmap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/rmap: correct some obsolete comments of anon_vma
      mm/rmap: remove unneeded semicolon in page_not_mapped()
      mm/rmap: fix obsolete comment in __page_check_anon_rmap()
      mm/rmap: use page_not_mapped in try_to_unmap()
      mm/rmap: correct obsolete comment of page_get_anon_vma()
      mm/rmap: fix potential pte_unmap on an not mapped pte

Subsystem: mm/zswap

    Randy Dunlap <rdunlap@infradead.org>:
      mm: zswap: clean up confusing comment

    Tian Tao <tiantao6@hisilicon.com>:
    Patch series "Fix the compatibility of zsmalloc and zswap":
      mm/zswap: add the flag can_sleep_mapped
      mm: set the sleep_mapped to true for zbud and z3fold

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage()

    Rokudo Yan <wu-yan@tcl.com>:
      zsmalloc: account the number of compacted pages correctly

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: use page_private() to access page->private

Subsystem: mm/cleanups

    Guo Ren <guoren@linux.alibaba.com>:
      mm: page-flags.h: Typo fix (It -> If)

    Daniel Vetter <daniel.vetter@ffwll.ch>:
      mm/dmapool: use might_alloc()
      mm/backing-dev.c: use might_alloc()

    Stephen Zhang <stephenzhangzsd@gmail.com>:
      mm/early_ioremap.c: use __func__ instead of function name

Subsystem: mm/kfence

    Alexander Potapenko <glider@google.com>:
    Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7:
      mm: add Kernel Electric-Fence infrastructure
      x86, kfence: enable KFENCE for x86

    Marco Elver <elver@google.com>:
      arm64, kfence: enable KFENCE for ARM64
      kfence: use pt_regs to generate stack trace on faults

    Alexander Potapenko <glider@google.com>:
      mm, kfence: insert KFENCE hooks for SLAB
      mm, kfence: insert KFENCE hooks for SLUB
      kfence, kasan: make KFENCE compatible with KASAN

    Marco Elver <elver@google.com>:
      kfence, Documentation: add KFENCE documentation
      kfence: add test suite
      MAINTAINERS: add entry for KFENCE
      kfence: report sensitive information based on no_hash_pointers

    Alexander Potapenko <glider@google.com>:
    Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3:
      tracing: add error_report_end trace point
      kfence: use error_report_end tracepoint
      kasan: use error_report_end tracepoint

Subsystem: mm/kasan2

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: optimizations and fixes for HW_TAGS", v4:
      kasan, mm: don't save alloc stacks twice
      kasan, mm: optimize kmalloc poisoning
      kasan: optimize large kmalloc poisoning
      kasan: clean up setting free info in kasan_slab_free
      kasan: unify large kfree checks
      kasan: rework krealloc tests
      kasan, mm: fail krealloc on freed objects
      kasan, mm: optimize krealloc poisoning
      kasan: ensure poisoning size alignment
      arm64: kasan: simplify and inline MTE functions
      kasan: inline HW_TAGS helper functions
      kasan: clarify that only first bug is reported in HW_TAGS

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: remove CONFIG_EXPERIMENTAL from defconfigs

Subsystem: procfs

    Helge Deller <deller@gmx.de>:
      proc/wchan: use printk format instead of lookup_symbol_name()

    Josef Bacik <josef@toxicpanda.com>:
      proc: use kvzalloc for our kernel buffer

Subsystem: sysctl

    Lin Feng <linf@wangsu.com>:
      sysctl.c: fix underflow value setting risk in vm_table

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      include/linux: remove repeated words

    Miguel Ojeda <ojeda@kernel.org>:
      treewide: Miguel has moved

Subsystem: core-kernel

    Hubert Jasudowicz <hubert.jasudowicz@gmail.com>:
      groups: use flexible-array member in struct group_info
      groups: simplify struct group_info allocation

    Randy Dunlap <rdunlap@infradead.org>:
      kernel: delete repeated words in comments

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: add uapi directories to API/ABI section

Subsystem: lib

    Huang Shijie <sjhuang@iluvatar.ai>:
      lib/genalloc.c: change return type to unsigned long for bitmap_set_ll

    Francis Laniel <laniel_francis@privacyrequired.com>:
      string.h: move fortified functions definitions in a dedicated header.

    Yogesh Lal <ylal@codeaurora.org>:
      lib: stackdepot: add support to configure STACK_HASH_SIZE

    Vijayanand Jitta <vjitta@codeaurora.org>:
      lib: stackdepot: add support to disable stack depot
      lib: stackdepot: fix ignoring return value warning

    Masahiro Yamada <masahiroy@kernel.org>:
      lib/cmdline: remove an unneeded local variable in next_arg()

Subsystem: bitops

    Geert Uytterhoeven <geert+renesas@glider.be>:
      include/linux/bitops.h: spelling s/synomyn/synonym/

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: improve blank line after declaration test

    Peng Wang <rocking@linux.alibaba.com>:
      checkpatch: ignore warning designated initializers using NR_CPUS

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: trivial style fixes

    Joe Perches <joe@perches.com>:
      checkpatch: prefer ftrace over function entry/exit printks
      checkpatch: improve TYPECAST_INT_CONSTANT test message

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add warning for avoiding .L prefix symbols in assembly files

    Joe Perches <joe@perches.com>:
      checkpatch: add kmalloc_array_node to unnecessary OOM message check

    Chris Down <chris@chrisdown.name>:
      checkpatch: don't warn about colon termination in linker scripts

    Song Liu <songliubraving@fb.com>:
      checkpatch: do not apply "initialise globals to 0" check to BPF progs

Subsystem: init

    Masahiro Yamada <masahiroy@kernel.org>:
      init/version.c: remove Version_<LINUX_VERSION_CODE> symbol
      init: clean up early_param_on_off() macro

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      init/Kconfig: fix a typo in CC_VERSION_TEXT help text

Subsystem: coredump

    Ira Weiny <ira.weiny@intel.com>:
      fs/coredump: use kmap_local_page()

Subsystem: seq_file

    NeilBrown <neilb@suse.de>:
    Patch series "Fix some seq_file users that were recently broken":
      seq_file: document how per-entry resources are managed.
      x86: fix seq_file iteration for pat/memtype.c

Subsystem: gdb

    George Prekas <prekageo@amazon.com>:
      scripts/gdb: fix list_for_each

    Sumit Garg <sumit.garg@linaro.org>:
      kgdb: fix to kill breakpoints on initmem after boot

Subsystem: ubsan

    Andrey Ryabinin <ryabinin.a.a@gmail.com>:
      ubsan: remove overflow checks

Subsystem: initramfs

    Florian Fainelli <f.fainelli@gmail.com>:
      initramfs: panic with memory information

Subsystem: mm/pagemap2

    Huang Pei <huangpei@loongson.cn>:
      MIPS: make userspace mapping young by default

 .mailmap                                            |    1 
 CREDITS                                             |    9 
 Documentation/ABI/testing/sysfs-devices-memory      |   58 -
 Documentation/admin-guide/auxdisplay/cfag12864b.rst |    2 
 Documentation/admin-guide/auxdisplay/ks0108.rst     |    2 
 Documentation/admin-guide/kernel-parameters.txt     |    6 
 Documentation/admin-guide/mm/memory-hotplug.rst     |   20 
 Documentation/dev-tools/index.rst                   |    1 
 Documentation/dev-tools/kasan.rst                   |    8 
 Documentation/dev-tools/kfence.rst                  |  318 +++++++
 Documentation/filesystems/seq_file.rst              |    6 
 MAINTAINERS                                         |   26 
 arch/alpha/configs/defconfig                        |    1 
 arch/arm64/Kconfig                                  |    1 
 arch/arm64/include/asm/cache.h                      |    1 
 arch/arm64/include/asm/kasan.h                      |    1 
 arch/arm64/include/asm/kfence.h                     |   26 
 arch/arm64/include/asm/mte-def.h                    |    2 
 arch/arm64/include/asm/mte-kasan.h                  |   65 +
 arch/arm64/include/asm/mte.h                        |    2 
 arch/arm64/kernel/mte.c                             |   46 -
 arch/arm64/lib/mte.S                                |   16 
 arch/arm64/mm/fault.c                               |    8 
 arch/arm64/mm/mmu.c                                 |   23 
 arch/mips/mm/cache.c                                |   30 
 arch/s390/mm/init.c                                 |    1 
 arch/s390/mm/vmem.c                                 |   14 
 arch/x86/Kconfig                                    |    1 
 arch/x86/include/asm/kfence.h                       |   76 +
 arch/x86/mm/fault.c                                 |   10 
 arch/x86/mm/pat/memtype.c                           |    4 
 drivers/auxdisplay/cfag12864b.c                     |    4 
 drivers/auxdisplay/cfag12864bfb.c                   |    4 
 drivers/auxdisplay/ks0108.c                         |    4 
 drivers/base/memory.c                               |   35 
 drivers/block/zram/zram_drv.c                       |    2 
 drivers/hv/hv_balloon.c                             |    2 
 drivers/virtio/virtio_mem.c                         |   43 
 drivers/xen/balloon.c                               |    2 
 fs/coredump.c                                       |    4 
 fs/iomap/seek.c                                     |  125 --
 fs/proc/base.c                                      |   21 
 fs/proc/proc_sysctl.c                               |    4 
 include/linux/bitops.h                              |    2 
 include/linux/cfag12864b.h                          |    2 
 include/linux/cred.h                                |    2 
 include/linux/fortify-string.h                      |  302 ++++++
 include/linux/gfp.h                                 |    2 
 include/linux/init.h                                |    4 
 include/linux/kasan.h                               |   25 
 include/linux/kfence.h                              |  230 +++++
 include/linux/kgdb.h                                |    2 
 include/linux/khugepaged.h                          |    2 
 include/linux/ks0108.h                              |    2 
 include/linux/mdev.h                                |    2 
 include/linux/memory.h                              |    3 
 include/linux/memory_hotplug.h                      |   33 
 include/linux/memremap.h                            |    6 
 include/linux/mmzone.h                              |   49 -
 include/linux/page-flags.h                          |    4 
 include/linux/pagemap.h                             |   10 
 include/linux/pagevec.h                             |   10 
 include/linux/pgtable.h                             |    8 
 include/linux/ptrace.h                              |    2 
 include/linux/rmap.h                                |    3 
 include/linux/slab_def.h                            |    3 
 include/linux/slub_def.h                            |    3 
 include/linux/stackdepot.h                          |    9 
 include/linux/string.h                              |  282 ------
 include/linux/vmstat.h                              |    6 
 include/linux/zpool.h                               |    3 
 include/linux/zsmalloc.h                            |    2 
 include/trace/events/error_report.h                 |   74 +
 include/uapi/linux/firewire-cdev.h                  |    2 
 include/uapi/linux/input.h                          |    2 
 init/Kconfig                                        |    2 
 init/initramfs.c                                    |   19 
 init/main.c                                         |    6 
 init/version.c                                      |    8 
 kernel/debug/debug_core.c                           |   11 
 kernel/events/core.c                                |    8 
 kernel/events/uprobes.c                             |    2 
 kernel/groups.c                                     |    7 
 kernel/locking/rtmutex.c                            |    4 
 kernel/locking/rwsem.c                              |    2 
 kernel/locking/semaphore.c                          |    2 
 kernel/sched/fair.c                                 |    2 
 kernel/sched/membarrier.c                           |    2 
 kernel/sysctl.c                                     |    8 
 kernel/trace/Makefile                               |    1 
 kernel/trace/error_report-traces.c                  |   12 
 lib/Kconfig                                         |    9 
 lib/Kconfig.debug                                   |    1 
 lib/Kconfig.kfence                                  |   84 +
 lib/Kconfig.ubsan                                   |   17 
 lib/cmdline.c                                       |    7 
 lib/genalloc.c                                      |    3 
 lib/stackdepot.c                                    |   41 
 lib/test_kasan.c                                    |  111 ++
 lib/test_ubsan.c                                    |   49 -
 lib/ubsan.c                                         |   68 -
 mm/Makefile                                         |    1 
 mm/backing-dev.c                                    |    3 
 mm/cma.c                                            |   64 -
 mm/dmapool.c                                        |    3 
 mm/early_ioremap.c                                  |   12 
 mm/filemap.c                                        |  361 +++++---
 mm/huge_memory.c                                    |    6 
 mm/internal.h                                       |    6 
 mm/kasan/common.c                                   |  213 +++-
 mm/kasan/generic.c                                  |    3 
 mm/kasan/hw_tags.c                                  |    2 
 mm/kasan/kasan.h                                    |   97 +-
 mm/kasan/report.c                                   |    8 
 mm/kasan/shadow.c                                   |   78 +
 mm/kfence/Makefile                                  |    6 
 mm/kfence/core.c                                    |  875 +++++++++++++++++++-
 mm/kfence/kfence.h                                  |  126 ++
 mm/kfence/kfence_test.c                             |  860 +++++++++++++++++++
 mm/kfence/report.c                                  |  350 ++++++--
 mm/khugepaged.c                                     |   22 
 mm/memory-failure.c                                 |    6 
 mm/memory.c                                         |    4 
 mm/memory_hotplug.c                                 |  178 +++-
 mm/memremap.c                                       |   23 
 mm/mlock.c                                          |    2 
 mm/page_alloc.c                                     |    1 
 mm/rmap.c                                           |   24 
 mm/shmem.c                                          |  160 +--
 mm/slab.c                                           |   38 
 mm/slab_common.c                                    |   29 
 mm/slub.c                                           |   63 +
 mm/swap.c                                           |   54 -
 mm/swap_state.c                                     |    7 
 mm/truncate.c                                       |  141 ---
 mm/vmstat.c                                         |   35 
 mm/z3fold.c                                         |    1 
 mm/zbud.c                                           |    1 
 mm/zpool.c                                          |   13 
 mm/zsmalloc.c                                       |   22 
 mm/zswap.c                                          |   57 +
 samples/auxdisplay/cfag12864b-example.c             |    2 
 scripts/Makefile.ubsan                              |    2 
 scripts/checkpatch.pl                               |  152 ++-
 scripts/gdb/linux/lists.py                          |    5 
 145 files changed, 5046 insertions(+), 1682 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-02-25  9:12       ` incoming Andrey Ryabinin
@ 2021-02-25 11:07         ` Walter Wu
  0 siblings, 0 replies; 203+ messages in thread
From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw)
  To: Andrey Ryabinin
  Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov,
	Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
	mm-commits, Andrey Ryabinin, Alexander Potapenko

Hi Andrey,

On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote:
> On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > > <torvalds@linux-foundation.org> wrote:
> > > >
> > > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > > the KASAN patches. With this all applied, I get:
> > > >
> > > >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > and
> > > >
> > > >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > > larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > > cause issues.
> > >
> > > A quick bisect shoes that this was introduced by "[patch 101/173]
> > > kasan: remove redundant config option".
> > >
> > > I didn't check what part of that patch screws up, but it's definitely
> > > doing something bad.
> >
> > I'm not sure why that patch surfaced the bug, but it's worth pointing
> > out that the underlying problem is asan-stack in combination
> > with the structleak plugin. This will happen for every user of kunit.
> >
> 
> The patch didn't update KASAN_STACK dependency in kconfig:
>         config GCC_PLUGIN_STRUCTLEAK_BYREF
> ....
>                depends on !(KASAN && KASAN_STACK=1)
> 
> This 'depends on'  stopped working with the patch

Thanks for pointing out this problem. I will re-send that patch.


Walter

^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-02-25  8:53     ` incoming Arnd Bergmann
@ 2021-02-25  9:12       ` Andrey Ryabinin
  2021-02-25 11:07         ` incoming Walter Wu
  0 siblings, 1 reply; 203+ messages in thread
From: Andrey Ryabinin @ 2021-02-25  9:12 UTC (permalink / raw)
  To: Arnd Bergmann
  Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov,
	Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
	mm-commits, Andrey Ryabinin, Alexander Potapenko

On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
>
> On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > the KASAN patches. With this all applied, I get:
> > >
> > >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > and
> > >
> > >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > cause issues.
> >
> > A quick bisect shoes that this was introduced by "[patch 101/173]
> > kasan: remove redundant config option".
> >
> > I didn't check what part of that patch screws up, but it's definitely
> > doing something bad.
>
> I'm not sure why that patch surfaced the bug, but it's worth pointing
> out that the underlying problem is asan-stack in combination
> with the structleak plugin. This will happen for every user of kunit.
>

The patch didn't update KASAN_STACK dependency in kconfig:
        config GCC_PLUGIN_STRUCTLEAK_BYREF
....
               depends on !(KASAN && KASAN_STACK=1)

This 'depends on'  stopped working with the patch


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-02-24 21:37   ` incoming Linus Torvalds
@ 2021-02-25  8:53     ` Arnd Bergmann
  2021-02-25  9:12       ` incoming Andrey Ryabinin
  0 siblings, 1 reply; 203+ messages in thread
From: Arnd Bergmann @ 2021-02-25  8:53 UTC (permalink / raw)
  To: Linus Torvalds
  Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
	Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits,
	Andrey Ryabinin, Alexander Potapenko

On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I haven't bisected things yet, but I suspect it's something with
> > the KASAN patches. With this all applied, I get:
> >
> >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> >
> > and
> >
> >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > larger than 2048 bytes [-Wframe-larger-than=]
> >
> > which is obviously not really acceptable. A 11kB stack frame _will_
> > cause issues.
>
> A quick bisect shoes that this was introduced by "[patch 101/173]
> kasan: remove redundant config option".
>
> I didn't check what part of that patch screws up, but it's definitely
> doing something bad.

I'm not sure why that patch surfaced the bug, but it's worth pointing
out that the underlying problem is asan-stack in combination
with the structleak plugin. This will happen for every user of kunit.

I sent a series[1] out earlier this year to turn off the structleak
plugin as an alternative workaround, but need to follow up on
the remaining patches. Someone suggested adding a more
generic way to turn off the plugin for a file instead of open-coding
the CLFAGS_REMOVE_*.o Makefile bit, which would help.

I am also still hoping that someone can come up with a way
to make kunit work better with the structleak plugin, as there
shouldn't be a fundamental reason why it can't work, just that
it the code pattern triggers a particularly bad case in the compiler.

      Arnd

[1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-02-24 21:30 ` incoming Linus Torvalds
@ 2021-02-24 21:37   ` Linus Torvalds
  2021-02-25  8:53     ` incoming Arnd Bergmann
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw)
  To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
	Arnd Bergmann, Andrey Konovalov
  Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko

On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Hmm. I haven't bisected things yet, but I suspect it's something with
> the KASAN patches. With this all applied, I get:
>
>   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
>   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
>
> and
>
>   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
>   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> larger than 2048 bytes [-Wframe-larger-than=]
>
> which is obviously not really acceptable. A 11kB stack frame _will_
> cause issues.

A quick bisect shoes that this was introduced by "[patch 101/173]
kasan: remove redundant config option".

I didn't check what part of that patch screws up, but it's definitely
doing something bad.

I will drop that patch.

               Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-02-24 19:58 incoming Andrew Morton
@ 2021-02-24 21:30 ` Linus Torvalds
  2021-02-24 21:37   ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> A few small subsystems and some of MM.

Hmm. I haven't bisected things yet, but I suspect it's something with
the KASAN patches. With this all applied, I get:

  lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
  lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]

and

  lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
  lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
larger than 2048 bytes [-Wframe-larger-than=]

which is obviously not really acceptable. A 11kB stack frame _will_
cause issues.

              Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-02-24 19:58 Andrew Morton
  2021-02-24 21:30 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A few small subsystems and some of MM.


173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194.

Subsystems affected by this patch series:

  hexagon
  scripts
  ntfs
  ocfs2
  vfs
  mm/slab-generic
  mm/slab
  mm/slub
  mm/debug
  mm/pagecache
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/mremap
  mm/page-reporting
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/compaction
  mm/mempolicy
  mm/oom-kill
  mm/hugetlbfs
  mm/migration

Subsystem: hexagon

    Randy Dunlap <rdunlap@infradead.org>:
      hexagon: remove CONFIG_EXPERIMENTAL from defconfigs

Subsystem: scripts

    tangchunyou <tangchunyou@yulong.com>:
      scripts/spelling.txt: increase error-prone spell checking

    zuoqilin <zuoqilin@yulong.com>:
      scripts/spelling.txt: check for "exeeds"

    dingsenjie <dingsenjie@yulong.com>:
      scripts/spelling.txt: add "allocted" and "exeeds" typo

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Randy Dunlap <rdunlap@infradead.org>:
      ntfs: layout.h: delete duplicated words

    Rustam Kovhaev <rkovhaev@gmail.com>:
      ntfs: check for valid standard information attribute

Subsystem: ocfs2

    Yi Li <yili@winhong.com>:
      ocfs2: remove redundant conditional before iput

    guozh <guozh88@chinatelecom.cn>:
      ocfs2: clean up some definitions which are not used any more

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: fix a use after free on error

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      ocfs2: simplify the calculation of variables

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      fs: delete repeated words in comments

    Alexey Dobriyan <adobriyan@gmail.com>:
      ramfs: support O_TMPFILE

Subsystem: mm/slab-generic

    Jacob Wen <jian.w.wen@oracle.com>:
      mm, tracing: record slab name for kmem_cache_free()

    Nikolay Borisov <nborisov@suse.com>:
      mm/sl?b.c: remove ctor argument from kmem_cache_flags

Subsystem: mm/slab

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/slab: minor coding style tweaks

Subsystem: mm/slub

    Johannes Berg <johannes.berg@intel.com>:
      mm/slub: disable user tracing for kmemleak caches by default

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "mm, slab, slub: remove cpu and memory hotplug locks":
      mm, slub: stop freeing kmem_cache_node structures on node offline
      mm, slab, slub: stop taking memory hotplug lock
      mm, slab, slub: stop taking cpu hotplug lock
      mm, slub: splice cpu and page freelists in deactivate_slab()
      mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/slub: minor coding style tweaks

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug: improve memcg debugging

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/debug_vm_pgtable: Some minor updates", v3:
      mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect
      mm/debug_vm_pgtable/basic: iterate over entire protection_map[]

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_owner: use helper function zone_end_pfn() to get end_pfn

Subsystem: mm/pagecache

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/filemap: remove unused parameter and change to void type for replace_page_cache_page()

    Pavel Begunkov <asml.silence@gmail.com>:
      mm/filemap: don't revert iter on -EIOCBQUEUED

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Refactor generic_file_buffered_read", v5:
      mm/filemap: rename generic_file_buffered_read subfunctions
      mm/filemap: remove dynamically allocated array from filemap_read
      mm/filemap: convert filemap_get_pages to take a pagevec
      mm/filemap: use head pages in generic_file_buffered_read
      mm/filemap: pass a sleep state to put_and_wait_on_page_locked
      mm/filemap: support readpage splitting a page
      mm/filemap: inline __wait_on_page_locked_async into caller
      mm/filemap: don't call ->readpage if IOCB_WAITQ is set
      mm/filemap: change filemap_read_page calling conventions
      mm/filemap: change filemap_create_page calling conventions
      mm/filemap: convert filemap_update_page to return an errno
      mm/filemap: move the iocb checks into filemap_update_page
      mm/filemap: add filemap_range_uptodate
      mm/filemap: split filemap_readahead out of filemap_get_pages
      mm/filemap: restructure filemap_get_pages
      mm/filemap: don't relock the page after calling readpage

    Christoph Hellwig <hch@lst.de>:
      mm/filemap: rename generic_file_buffered_read to filemap_read
      mm/filemap: simplify generic_file_read_iter

    Yang Guo <guoyang2@huawei.com>:
      fs/buffer.c: add checking buffer head stat before clear

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: backing-dev: Remove duplicated macro definition

Subsystem: mm/swap

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      mm/swap_slots.c: remove redundant NULL check

    Stephen Zhang <stephenzhangzsd@gmail.com>:
      mm/swapfile.c: fix debugging information problem

    Georgi Djakov <georgi.djakov@linaro.org>:
      mm/page_io: use pr_alert_ratelimited for swap read/write errors

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      mm/swap_state: constify static struct attribute_group

    Yu Zhao <yuzhao@google.com>:
      mm/swap: don't SetPageWorkingset unconditionally during swapin

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: optimize per-lruvec stats counter memory usage
    Patch series "Convert all THP vmstat counters to pages", v6:
      mm: memcontrol: fix NR_ANON_THPS accounting in charge moving
      mm: memcontrol: convert NR_ANON_THPS account to pages
      mm: memcontrol: convert NR_FILE_THPS account to pages
      mm: memcontrol: convert NR_SHMEM_THPS account to pages
      mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages
      mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages
      mm: memcontrol: make the slab calculation consistent

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: revise the using condition of lock_page_lruvec function series
      mm/memcg: remove rcu locking for lock_page_lruvec function series

    Shakeel Butt <shakeelb@google.com>:
      mm: memcg: add swapcache stat for memcg v2

    Roman Gushchin <guro@fb.com>:
      mm: kmem: make __memcg_kmem_(un)charge static

    Feng Tang <feng.tang@intel.com>:
      mm: page_counter: re-layout structure to reduce false sharing

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      mm/memcontrol: remove redundant NULL check

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: replace the loop with a list_for_each_entry()

    Shakeel Butt <shakeelb@google.com>:
      mm/list_lru.c: remove kvfree_rcu_local()

    Johannes Weiner <hannes@cmpxchg.org>:
      fs: buffer: use raw page_memcg() on locked page

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix swap undercounting in cgroup2
      mm: memcontrol: fix get_active_memcg return value
      mm: memcontrol: fix slub memory accounting

Subsystem: mm/pagemap

    Adrian Huang <ahuang12@lenovo.com>:
      mm/mmap.c: remove unnecessary local variable

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory.c: fix potential pte_unmap_unlock pte error
      mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush()
      mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush()
      mm/memory.c: fix potential pte_unmap_unlock pte error

Subsystem: mm/mprotect

    Tianjia Zhang <tianjia.zhang@linux.alibaba.com>:
      mm/mprotect.c: optimize error detection in do_mprotect_pkey()

Subsystem: mm/mremap

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas()
      mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success

Subsystem: mm/page-reporting

    sh <sh_def@163.com>:
      mm/page_reporting: use list_entry_is_head() in page_reporting_cycle()

Subsystem: mm/vmalloc

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      vmalloc: remove redundant NULL check

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: HW_TAGS tests support and fixes", v4:
      kasan: prefix global functions with kasan_
      kasan: clarify HW_TAGS impact on TBI
      kasan: clean up comments in tests
      kasan: add macros to simplify checking test constraints
      kasan: add match-all tag tests
      kasan, arm64: allow using KUnit tests with HW_TAGS mode
      kasan: rename CONFIG_TEST_KASAN_MODULE
      kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL
      kasan: adapt kmalloc_uaf2 test to HW_TAGS mode
      kasan: fix memory corruption in kasan_bitops_tags test
      kasan: move _RET_IP_ to inline wrappers
      kasan: fix bug detection via ksize for HW_TAGS mode
      kasan: add proper page allocator tests
      kasan: add a test for kmem_cache_alloc/free_bulk
      kasan: don't run tests when KASAN is not enabled

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: mm/pagealloc

    Baoquan He <bhe@redhat.com>:
    Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5:
      mm: fix prototype warning from kernel test robot
      mm: rename memmap_init() and memmap_init_zone()
      mm: simplify parater of function memmap_init_zone()
      mm: simplify parameter of setup_usemap()
      mm: remove unneeded local variable in free_area_init_core

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: simplify free_highmem_page() and free_reserved_page()":
      video: fbdev: acornfb: remove free_unused_pages()
      mm: simplify free_highmem_page() and free_reserved_page()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/gfp: add kernel-doc for gfp_t

Subsystem: mm/memory-failure

    Aili Yao <yaoaili@kingsoft.com>:
      mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events

Subsystem: mm/hugetlb

    Bibo Mao <maobibo@loongson.cn>:
      mm/huge_memory.c: update tlb entry if pmd is changed
      MIPS: do not call flush_tlb_all when setting pmd entry

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix potential double free in hugetlb_register_node() error path

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb.c: fix unnecessary address expansion of pmd sharing

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call
      mm/hugetlb: use helper huge_page_order and pages_per_huge_page
      mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled

    Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>:
      mm/hugetlb: simplify the calculation of variables

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2:
      mm/hugetlb: grab head page refcount once for group of subpages
      mm/hugetlb: refactor subpage recording

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix some comment typos

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/hugetlb: remove redundant check in preparing and destroying gigantic page

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/hugetlb.c: fix typos in comments

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/huge_memory.c: remove unused return value of set_huge_zero_page()

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup
      mm/hugetlb: use helper function range_in_vma() in page_table_shareable()
      mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage()
      mm/hugetlb: use helper huge_page_size() to get hugepage size

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: fix update_and_free_page contig page struct assumption
      hugetlb: fix copy_huge_page_from_user contig page struct assumption

    Chen Wandun <chenwandun@huawei.com>:
      mm/hugetlb: suppress wrong warning info when alloc gigantic page

Subsystem: mm/vmscan

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmscan: __isolate_lru_page_prepare() cleanup

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes()

    Yu Zhao <yuzhao@google.com>:
    Patch series "mm: lru related cleanups", v2:
      mm/vmscan.c: use add_page_to_lru_list()
      include/linux/mm_inline.h: shuffle lru list addition and deletion functions
      mm: don't pass "enum lru_list" to lru list addition functions
      mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion()
      mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list()
      mm: add __clear_page_lru_flags() to replace page_off_lru()
      mm: VM_BUG_ON lru page flags
      include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller
      include/linux/mm_inline.h: fold __update_lru_size() into its sole caller
      mm/vmscan.c: make lruvec_lru_size() static

    Oscar Salvador <osalvador@suse.de>:
      mm: workingset: clarify eviction order and distance calculation

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "create hugetlb flags to consolidate state", v3:
      hugetlb: use page.private for hugetlb specific page flags
      hugetlb: convert page_huge_active() HPageMigratable flag
      hugetlb: convert PageHugeTemporary() to HPageTemporary flag
      hugetlb: convert PageHugeFreed to HPageFreed flag
      include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags
      hugetlb: fix uninitialized subpool pointer

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: restore zone_reclaim_mode ABI

Subsystem: mm/z3fold

    Miaohe Lin <linmiaohe@huawei.com>:
      z3fold: remove unused attribute for release_z3fold_page
      z3fold: simplify the zhdr initialization code in init_z3fold_page()

Subsystem: mm/compaction

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/compaction: remove rcu_read_lock during page compaction

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked

    Charan Teja Reddy <charante@codeaurora.org>:
      mm/compaction: correct deferral logic for proactive compaction

    Wonhyuk Yang <vvghjk1234@gmail.com>:
      mm/compaction: fix misbehaviors of fast_find_migrateblock()

    Vlastimil Babka <vbabka@suse.cz>:
      mm, compaction: make fast_isolate_freepages() stay within zone

Subsystem: mm/mempolicy

    Huang Ying <ying.huang@intel.com>:
      numa balancing: migrate on fault among multiple bound nodes

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk()

Subsystem: mm/oom-kill

    Tang Yizhou <tangyizhou@huawei.com>:
      mm, oom: fix a comment in dump_task()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: change hugetlb_reserve_pages() to type bool
      hugetlbfs: remove special hugetlbfs_set_page_dirty()

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr()
      hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs
      hugetlbfs: correct obsolete function name in hugetlbfs_read_iter()
      hugetlbfs: remove meaningless variable avoid_reserve
      hugetlbfs: make hugepage size conversion more readable
      hugetlbfs: correct some obsolete comments about inode i_mutex
      hugetlbfs: fix some comment typos
      hugetlbfs: remove unneeded return value of hugetlb_vmtruncate()

Subsystem: mm/migration

    Chengyang Fan <cy.fan@huawei.com>:
      mm/migrate: remove unneeded semicolons

 Documentation/admin-guide/cgroup-v2.rst         |    4 
 Documentation/admin-guide/kernel-parameters.txt |    8 
 Documentation/admin-guide/sysctl/vm.rst         |   10 
 Documentation/core-api/mm-api.rst               |    7 
 Documentation/dev-tools/kasan.rst               |   24 
 Documentation/vm/arch_pgtable_helpers.rst       |    8 
 arch/arm64/include/asm/memory.h                 |    1 
 arch/arm64/include/asm/mte-kasan.h              |   12 
 arch/arm64/kernel/mte.c                         |   12 
 arch/arm64/kernel/sleep.S                       |    2 
 arch/arm64/mm/fault.c                           |   20 
 arch/hexagon/configs/comet_defconfig            |    1 
 arch/ia64/include/asm/pgtable.h                 |    6 
 arch/ia64/mm/init.c                             |   18 
 arch/mips/mm/pgtable-32.c                       |    1 
 arch/mips/mm/pgtable-64.c                       |    1 
 arch/x86/kernel/acpi/wakeup_64.S                |    2 
 drivers/base/node.c                             |   33 
 drivers/video/fbdev/acornfb.c                   |   34 
 fs/block_dev.c                                  |    2 
 fs/btrfs/file.c                                 |    2 
 fs/buffer.c                                     |    7 
 fs/dcache.c                                     |    4 
 fs/direct-io.c                                  |    4 
 fs/exec.c                                       |    4 
 fs/fhandle.c                                    |    2 
 fs/fuse/dev.c                                   |    6 
 fs/hugetlbfs/inode.c                            |   72 --
 fs/ntfs/inode.c                                 |    6 
 fs/ntfs/layout.h                                |    4 
 fs/ocfs2/cluster/heartbeat.c                    |    8 
 fs/ocfs2/dlm/dlmast.c                           |   10 
 fs/ocfs2/dlm/dlmcommon.h                        |    4 
 fs/ocfs2/refcounttree.c                         |    2 
 fs/ocfs2/super.c                                |    2 
 fs/pipe.c                                       |    2 
 fs/proc/meminfo.c                               |   10 
 fs/proc/vmcore.c                                |    7 
 fs/ramfs/inode.c                                |   13 
 include/linux/fs.h                              |    4 
 include/linux/gfp.h                             |   14 
 include/linux/highmem-internal.h                |    5 
 include/linux/huge_mm.h                         |   15 
 include/linux/hugetlb.h                         |   98 ++
 include/linux/kasan-checks.h                    |    6 
 include/linux/kasan.h                           |   39 -
 include/linux/memcontrol.h                      |   43 -
 include/linux/migrate.h                         |    2 
 include/linux/mm.h                              |   28 
 include/linux/mm_inline.h                       |  123 +--
 include/linux/mmzone.h                          |   30 
 include/linux/page-flags.h                      |    6 
 include/linux/page_counter.h                    |    9 
 include/linux/pagemap.h                         |    5 
 include/linux/swap.h                            |    8 
 include/trace/events/kmem.h                     |   24 
 include/trace/events/pagemap.h                  |   11 
 include/uapi/linux/mempolicy.h                  |    4 
 init/Kconfig                                    |   14 
 lib/Kconfig.kasan                               |   14 
 lib/Makefile                                    |    2 
 lib/test_kasan.c                                |  446 ++++++++----
 lib/test_kasan_module.c                         |    5 
 mm/backing-dev.c                                |    6 
 mm/compaction.c                                 |   73 +-
 mm/debug.c                                      |   10 
 mm/debug_vm_pgtable.c                           |   86 ++
 mm/filemap.c                                    |  859 +++++++++++-------------
 mm/gup.c                                        |    5 
 mm/huge_memory.c                                |   28 
 mm/hugetlb.c                                    |  376 ++++------
 mm/hugetlb_cgroup.c                             |    6 
 mm/kasan/common.c                               |   60 -
 mm/kasan/generic.c                              |   40 -
 mm/kasan/hw_tags.c                              |   16 
 mm/kasan/kasan.h                                |   87 +-
 mm/kasan/quarantine.c                           |   22 
 mm/kasan/report.c                               |   15 
 mm/kasan/report_generic.c                       |   10 
 mm/kasan/report_hw_tags.c                       |    8 
 mm/kasan/report_sw_tags.c                       |    8 
 mm/kasan/shadow.c                               |   27 
 mm/kasan/sw_tags.c                              |   22 
 mm/khugepaged.c                                 |    6 
 mm/list_lru.c                                   |   12 
 mm/memcontrol.c                                 |  309 ++++----
 mm/memory-failure.c                             |   34 
 mm/memory.c                                     |   24 
 mm/memory_hotplug.c                             |   11 
 mm/mempolicy.c                                  |   18 
 mm/mempool.c                                    |    2 
 mm/migrate.c                                    |   10 
 mm/mlock.c                                      |    3 
 mm/mmap.c                                       |    4 
 mm/mprotect.c                                   |    7 
 mm/mremap.c                                     |    8 
 mm/oom_kill.c                                   |    5 
 mm/page_alloc.c                                 |   70 -
 mm/page_io.c                                    |   12 
 mm/page_owner.c                                 |    4 
 mm/page_reporting.c                             |    2 
 mm/pgtable-generic.c                            |    9 
 mm/rmap.c                                       |   35 
 mm/shmem.c                                      |    2 
 mm/slab.c                                       |   21 
 mm/slab.h                                       |   20 
 mm/slab_common.c                                |   40 -
 mm/slob.c                                       |    2 
 mm/slub.c                                       |  169 ++--
 mm/swap.c                                       |   54 -
 mm/swap_slots.c                                 |    3 
 mm/swap_state.c                                 |   31 
 mm/swapfile.c                                   |    8 
 mm/vmscan.c                                     |  100 +-
 mm/vmstat.c                                     |   14 
 mm/workingset.c                                 |    7 
 mm/z3fold.c                                     |   11 
 scripts/Makefile.kasan                          |   10 
 scripts/spelling.txt                            |   30 
 tools/objtool/check.c                           |    2 
 120 files changed, 2249 insertions(+), 1954 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-02-13  4:52 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-02-13  4:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749.

Subsystems affected by this patch series:

  mm/pagemap
  scripts
  MAINTAINERS
  h8300

Subsystem: mm/pagemap

    Mike Rapoport <rppt@linux.ibm.com>:
      m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU

Subsystem: scripts

    Rong Chen <rong.a.chen@intel.com>:
      scripts/recordmcount.pl: support big endian for ARCH sh

Subsystem: MAINTAINERS

    Andrey Konovalov <andreyknvl@google.com>:
      MAINTAINERS: update KASAN file list
      MAINTAINERS: update Andrey Konovalov's email address
      MAINTAINERS: add Andrey Konovalov to KASAN reviewers

Subsystem: h8300

    Randy Dunlap <rdunlap@infradead.org>:
      h8300: fix PREEMPTION build, TI_PRE_COUNT undefined

 MAINTAINERS                     |    8 +++++---
 arch/h8300/kernel/asm-offsets.c |    3 +++
 arch/m68k/include/asm/page.h    |    2 +-
 scripts/recordmcount.pl         |    6 +++++-
 4 files changed, 14 insertions(+), 5 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-02-09 21:41 incoming Andrew Morton
@ 2021-02-10 19:30 ` Linus Torvalds
  0 siblings, 0 replies; 203+ messages in thread
From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

Hah. This series shows a small deficiency in your scripting wrt the diffstat:

On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
>  .mailmap                          |    1
...
>  mm/slub.c                         |   18 +++++++++-
>  17 files changed, 172 insertions(+), 49 deletions(-)

It actually has 18 files changed, but one of them is a pure rename (no
change to the content), and apparently your diffstat tool can't handle
that case.

It *should* have ended with

 ...
 mm/slub.c                                          | 18 +++++-
 .../selftests/vm/{run_vmtests => run_vmtests.sh}   |  0
 18 files changed, 172 insertions(+), 49 deletions(-)
 rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%)

if you'd done a proper "git diff -M --stat --summary" of the series.

[ Ok, by default git would actually have said

    18 files changed, 171 insertions(+), 48 deletions(-)

  but it looks like you use the patience diff option, which gives that
extra insertion/deletion line because it generates the diff a bit
differently ]

Not a big deal,, but it made me briefly wonder "why doesn't my
diffstat match yours".

           Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-02-09 21:41 Andrew Morton
  2021-02-10 19:30 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6.

Subsystems affected by this patch series:

  squashfs
  mm/kasan
  firmware
  mm/mremap
  mm/tmpfs
  mm/selftests
  MAINTAINERS
  mm/memcg
  mm/slub
  nilfs2

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
    Patch series "Squashfs: fix BIO migration regression and add sanity checks":
      squashfs: avoid out of bounds writes in decompressors
      squashfs: add more sanity checks in id lookup
      squashfs: add more sanity checks in inode lookup
      squashfs: add more sanity checks in xattr id lookup

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix stack traces dependency for HW_TAGS

Subsystem: firmware

    Fangrui Song <maskray@google.com>:
      firmware_loader: align .builtin_fw to 8

Subsystem: mm/mremap

    Arnd Bergmann <arnd@arndb.de>:
      mm/mremap: fix BUILD_BUG_ON() error in get_extent

Subsystem: mm/tmpfs

    Seth Forshee <seth.forshee@canonical.com>:
      tmpfs: disallow CONFIG_TMPFS_INODE64 on s390
      tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha

Subsystem: mm/selftests

    Rong Chen <rong.a.chen@intel.com>:
      selftests/vm: rename file run_vmtests to run_vmtests.sh

Subsystem: MAINTAINERS

    Andrey Ryabinin <ryabinin.a.a@gmail.com>:
      MAINTAINERS: update Andrey Ryabinin's email address

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      Revert "mm: memcontrol: avoid workload stalls when lowering memory.high"

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: better heuristic for number of cpus when calculating slab order

Subsystem: nilfs2

    Joachim Henke <joachim.henke@t-systems.com>:
      nilfs2: make splice write available again

 .mailmap                          |    1 
 Documentation/dev-tools/kasan.rst |    3 -
 MAINTAINERS                       |    2 -
 fs/Kconfig                        |    4 +-
 fs/nilfs2/file.c                  |    1 
 fs/squashfs/block.c               |    8 ++++
 fs/squashfs/export.c              |   41 +++++++++++++++++++----
 fs/squashfs/id.c                  |   40 ++++++++++++++++++-----
 fs/squashfs/squashfs_fs_sb.h      |    1 
 fs/squashfs/super.c               |    6 +--
 fs/squashfs/xattr.h               |   10 +++++
 fs/squashfs/xattr_id.c            |   66 ++++++++++++++++++++++++++++++++------
 include/asm-generic/vmlinux.lds.h |    2 -
 mm/kasan/hw_tags.c                |    8 +---
 mm/memcontrol.c                   |    5 +-
 mm/mremap.c                       |    5 +-
 mm/slub.c                         |   18 +++++++++-
 17 files changed, 172 insertions(+), 49 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-02-05  2:31 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-02-05  2:31 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/compaction
  mm/vmalloc
  gcov
  mm/shmem
  mm/memblock
  mailmap
  mm/pagecache
  mm/kasan
  ubsan
  mm/hugetlb
  MAINTAINERS

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page
      mm: hugetlb: fix a race between freeing and dissolving the page
      mm: hugetlb: fix a race between isolating and freeing page
      mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active
      mm: migrate: do not migrate HugeTLB page whose refcount is one

Subsystem: mm/compaction

    Rokudo Yan <wu-yan@tcl.com>:
      mm, compaction: move high_pfn to the for loop scope

Subsystem: mm/vmalloc

    Rick Edgecombe <rick.p.edgecombe@intel.com>:
      mm/vmalloc: separate put pages and flush VM flags

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov

Subsystem: mm/shmem

    Hugh Dickins <hughd@google.com>:
      mm: thp: fix MADV_REMOVE deadlock on shmem THP

Subsystem: mm/memblock

    Roman Gushchin <guro@fb.com>:
      memblock: do not start bottom-up allocations with kernel_end

Subsystem: mailmap

    Viresh Kumar <viresh.kumar@linaro.org>:
      mailmap: fix name/email for Viresh Kumar

    Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>:
      mailmap: add entries for Manivannan Sadhasivam

Subsystem: mm/pagecache

    Waiman Long <longman@redhat.com>:
      mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked()

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
    Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5:
      kasan: add explicit preconditions to kasan_report()
      kasan: make addr_has_metadata() return true for valid addresses

Subsystem: ubsan

    Nathan Chancellor <nathan@kernel.org>:
      ubsan: implement __ubsan_handle_alignment_assumption

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm: hugetlb: fix missing put_page in gather_surplus_pages()

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS/.mailmap: use my @kernel.org address

 .mailmap                |    5 ++++
 MAINTAINERS             |    2 -
 fs/hugetlbfs/inode.c    |    3 +-
 include/linux/hugetlb.h |    2 +
 include/linux/kasan.h   |    7 ++++++
 include/linux/vmalloc.h |    9 +-------
 init/Kconfig            |    1 
 init/main.c             |    8 ++++++-
 kernel/gcov/Kconfig     |    2 -
 lib/ubsan.c             |   31 ++++++++++++++++++++++++++++
 lib/ubsan.h             |    6 +++++
 mm/compaction.c         |    3 +-
 mm/filemap.c            |    4 +++
 mm/huge_memory.c        |   37 ++++++++++++++++++++-------------
 mm/hugetlb.c            |   53 ++++++++++++++++++++++++++++++++++++++++++------
 mm/kasan/kasan.h        |    2 -
 mm/memblock.c           |   49 +++++---------------------------------------
 mm/migrate.c            |    6 +++++
 18 files changed, 153 insertions(+), 77 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-01-24  5:00 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2021-01-24  5:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1.

Subsystems affected by this patch series:

  mm/pagealloc
  mm/memcg
  mm/kasan
  ubsan
  mm/memory-failure
  mm/highmem
  proc
  MAINTAINERS

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: fix initialization of struct page for holes in memory layout", v3:
      x86/setup: don't remove E820_TYPE_RAM for pfn 0
      mm: fix initialization of struct page for holes in memory layout

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: optimize objcg stock draining

    Shakeel Butt <shakeelb@google.com>:
      mm: memcg: fix memcg file_dirty numa stat
      mm: fix numa stats for thp migration

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: prevent starvation when writing memory.high

Subsystem: mm/kasan

    Lecopzer Chen <lecopzer@gmail.com>:
      kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow
      kasan: fix incorrect arguments passing in kasan_add_zero_shadow

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix HW_TAGS boot parameters
      kasan, mm: fix conflicts with init_on_alloc/free
      kasan, mm: fix resetting page_alloc tags for HW_TAGS

Subsystem: ubsan

    Arnd Bergmann <arnd@arndb.de>:
      ubsan: disable unsigned-overflow check for i386

Subsystem: mm/memory-failure

    Dan Williams <dan.j.williams@intel.com>:
      mm: fix page reference leak in soft_offline_page()

Subsystem: mm/highmem

    Thomas Gleixner <tglx@linutronix.de>:
    Patch series "mm/highmem: Fix fallout from generic kmap_local conversions":
      sparc/mm/highmem: flush cache and TLB
      mm/highmem: prepare for overriding set_pte_at()
      mips/mm/highmem: use set_pte() for kmap_local()
      powerpc/mm/highmem: use __set_pte_at() for kmap_local()

Subsystem: proc

    Xiaoming Ni <nixiaoming@huawei.com>:
      proc_sysctl: fix oops caused by incorrect command parameters

Subsystem: MAINTAINERS

    Nathan Chancellor <natechancellor@gmail.com>:
      MAINTAINERS: add a couple more files to the Clang/LLVM section

 Documentation/dev-tools/kasan.rst  |   27 ++---------
 MAINTAINERS                        |    2 
 arch/mips/include/asm/highmem.h    |    1 
 arch/powerpc/include/asm/highmem.h |    2 
 arch/sparc/include/asm/highmem.h   |    9 ++-
 arch/x86/kernel/setup.c            |   20 +++-----
 fs/proc/proc_sysctl.c              |    7 ++-
 lib/Kconfig.ubsan                  |    1 
 mm/highmem.c                       |    7 ++-
 mm/kasan/hw_tags.c                 |   77 +++++++++++++--------------------
 mm/kasan/init.c                    |   23 +++++----
 mm/memcontrol.c                    |   11 +---
 mm/memory-failure.c                |   20 ++++++--
 mm/migrate.c                       |   27 ++++++-----
 mm/page_alloc.c                    |   86 ++++++++++++++++++++++---------------
 mm/slub.c                          |    7 +--
 16 files changed, 173 insertions(+), 154 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2021-01-12 23:48 incoming Andrew Morton
@ 2021-01-15 23:32 ` Linus Torvalds
  0 siblings, 0 replies; 203+ messages in thread
From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.

Whee. I had completely dropped the ball on this - I had built my usual
"akpm" branch with the patches, but then had completely forgotten
about it after doing my basic build tests.

I tend to leave it for a while to see if people send belated ACK/NAK's
for the patches, but that "for a while" is typically "overnight", not
several days.

So if you ever notice that I haven't merged your patch submission, and
you haven't seen me comment on them, feel free to ping me to remind
me.

Because it might just have gotten lost in the shuffle for some random
reason. Admittedly it's rare - I think this is the first time I just
randomly noticed three days later that I'd never done the actual merge
of the patch-series).

               Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2021-01-12 23:48 Andrew Morton
  2021-01-15 23:32 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.

Subsystems affected by this patch series:

  mm/slub
  mm/pagealloc
  mm/memcg
  mm/kasan
  mm/vmalloc
  mm/migration
  mm/hugetlb
  MAINTAINERS
  mm/memory-failure
  mm/process_vm_access

Subsystem: mm/slub

    Jann Horn <jannh@google.com>:
      mm, slub: consider rest of partial list if acquire_slab() fails

Subsystem: mm/pagealloc

    Hailong liu <liu.hailong6@zte.com.cn>:
      mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint

Subsystem: mm/memcg

    Hugh Dickins <hughd@google.com>:
      mm/memcontrol: fix warning in mem_cgroup_page_lruvec()

Subsystem: mm/kasan

    Hailong Liu <liu.hailong6@zte.com.cn>:
      arm/kasan: fix the array size of kasan_early_shadow_pte[]

Subsystem: mm/vmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmalloc.c: fix potential memory leak

Subsystem: mm/migration

    Jan Stancek <jstancek@redhat.com>:
      mm: migrate: initialize err in do_migrate_pages

Subsystem: mm/hugetlb

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix potential missing huge page size info

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: add Vlastimil as slab allocators maintainer

Subsystem: mm/memory-failure

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: fix printing of page flags

Subsystem: mm/process_vm_access

    Andrew Morton <akpm@linux-foundation.org>:
      mm/process_vm_access.c: include compat.h

 MAINTAINERS                |    1 +
 include/linux/kasan.h      |    6 +++++-
 include/linux/memcontrol.h |    2 +-
 mm/hugetlb.c               |    2 +-
 mm/kasan/init.c            |    3 ++-
 mm/memory-failure.c        |    2 +-
 mm/mempolicy.c             |    2 +-
 mm/page_alloc.c            |   31 ++++++++++++++++---------------
 mm/process_vm_access.c     |    1 +
 mm/slub.c                  |    2 +-
 mm/vmalloc.c               |    4 +++-
 11 files changed, 33 insertions(+), 23 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-12-29 23:13 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3.

Subsystems affected by this patch series:

  mm/selftests
  mm/hugetlb
  kbuild
  checkpatch
  mm/pagecache
  mm/mremap
  mm/kasan
  misc
  lib
  mm/slub

Subsystem: mm/selftests

    Harish <harish@linux.ibm.com>:
      selftests/vm: fix building protection keys test

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: fix deadlock in hugetlb_cow error path

Subsystem: kbuild

    Masahiro Yamada <masahiroy@kernel.org>:
      Revert "kbuild: avoid static_assert for genksyms"

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: prefer strscpy to strlcpy

Subsystem: mm/pagecache

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm: add prototype for __add_to_page_cache_locked()

    Baoquan He <bhe@redhat.com>:
      mm: memmap defer init doesn't work as expected

Subsystem: mm/mremap

    Kalesh Singh <kaleshsingh@google.com>:
      mm/mremap.c: fix extent calculation

    Nicholas Piggin <npiggin@gmail.com>:
      mm: generalise COW SMC TLB flushing race comment

Subsystem: mm/kasan

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: fix null pointer dereference in kasan_record_aux_stack

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      local64.h: make <asm/local64.h> mandatory

    Huang Shijie <sjhuang@iluvatar.ai>:
      sizes.h: add SZ_8G/SZ_16G/SZ_32G macros

    Josh Poimboeuf <jpoimboe@redhat.com>:
      kdev_t: always inline major/minor helper functions

Subsystem: lib

    Huang Shijie <sjhuang@iluvatar.ai>:
      lib/genalloc: fix the overflow when size is too big

    Ilya Leoshkevich <iii@linux.ibm.com>:
      lib/zlib: fix inflating zlib streams on s390

    Randy Dunlap <rdunlap@infradead.org>:
      zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c

Subsystem: mm/slub

    Roman Gushchin <guro@fb.com>:
      mm: slub: call account_slab_page() after slab page initialization

 arch/alpha/include/asm/local64.h    |    1 -
 arch/arc/include/asm/Kbuild         |    1 -
 arch/arm/include/asm/Kbuild         |    1 -
 arch/arm64/include/asm/Kbuild       |    1 -
 arch/csky/include/asm/Kbuild        |    1 -
 arch/h8300/include/asm/Kbuild       |    1 -
 arch/hexagon/include/asm/Kbuild     |    1 -
 arch/ia64/include/asm/local64.h     |    1 -
 arch/ia64/mm/init.c                 |    4 ++--
 arch/m68k/include/asm/Kbuild        |    1 -
 arch/microblaze/include/asm/Kbuild  |    1 -
 arch/mips/include/asm/Kbuild        |    1 -
 arch/nds32/include/asm/Kbuild       |    1 -
 arch/openrisc/include/asm/Kbuild    |    1 -
 arch/parisc/include/asm/Kbuild      |    1 -
 arch/powerpc/include/asm/Kbuild     |    1 -
 arch/riscv/include/asm/Kbuild       |    1 -
 arch/s390/include/asm/Kbuild        |    1 -
 arch/sh/include/asm/Kbuild          |    1 -
 arch/sparc/include/asm/Kbuild       |    1 -
 arch/x86/include/asm/local64.h      |    1 -
 arch/xtensa/include/asm/Kbuild      |    1 -
 include/asm-generic/Kbuild          |    1 +
 include/linux/build_bug.h           |    5 -----
 include/linux/kdev_t.h              |   22 +++++++++++-----------
 include/linux/mm.h                  |   12 ++++++++++--
 include/linux/sizes.h               |    3 +++
 lib/genalloc.c                      |   25 +++++++++++++------------
 lib/zlib_dfltcc/Makefile            |    2 +-
 lib/zlib_dfltcc/dfltcc.c            |    6 +++++-
 lib/zlib_dfltcc/dfltcc_deflate.c    |    3 +++
 lib/zlib_dfltcc/dfltcc_inflate.c    |    4 ++--
 lib/zlib_dfltcc/dfltcc_syms.c       |   17 -----------------
 mm/hugetlb.c                        |   22 +++++++++++++++++++++-
 mm/kasan/generic.c                  |    2 ++
 mm/memory.c                         |    8 +++++---
 mm/memory_hotplug.c                 |    2 +-
 mm/mremap.c                         |    4 +++-
 mm/page_alloc.c                     |    8 +++++---
 mm/slub.c                           |    5 ++---
 scripts/checkpatch.pl               |    6 ++++++
 tools/testing/selftests/vm/Makefile |   10 +++++-----
 42 files changed, 101 insertions(+), 91 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2020-12-22 19:58 incoming Andrew Morton
@ 2020-12-22 21:43 ` Linus Torvalds
  0 siblings, 0 replies; 203+ messages in thread
From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.

I see that you enabled renaming in the patches. Lovely.

Can you also enable it in the diffstat?

>  74 files changed, 2869 insertions(+), 1553 deletions(-)

With -M in the diffstat, you should have seen

 72 files changed, 2775 insertions(+), 1460 deletions(-)

and if you add "--summary", you'll also see the rename part ofthe file
create/delete summary:

 rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%)

which is often nice to see in addition to the line stats..

           Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-12-22 19:58 Andrew Morton
  2020-12-22 21:43 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.

Subsystems affected by this patch series:

  mm/kasan

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: add hardware tag-based mode for arm64", v11:
      kasan: drop unnecessary GPL text from comment headers
      kasan: KASAN_VMALLOC depends on KASAN_GENERIC
      kasan: group vmalloc code
      kasan: shadow declarations only for software modes
      kasan: rename (un)poison_shadow to (un)poison_range
      kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
      kasan: only build init.c for software modes
      kasan: split out shadow.c from common.c
      kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
      kasan: rename report and tags files
      kasan: don't duplicate config dependencies
      kasan: hide invalid free check implementation
      kasan: decode stack frame only with KASAN_STACK_ENABLE
      kasan, arm64: only init shadow for software modes
      kasan, arm64: only use kasan_depth for software modes
      kasan, arm64: move initialization message
      kasan, arm64: rename kasan_init_tags and mark as __init
      kasan: rename addr_has_shadow to addr_has_metadata
      kasan: rename print_shadow_for_address to print_memory_metadata
      kasan: rename SHADOW layout macros to META
      kasan: separate metadata_fetch_row for each mode
      kasan: introduce CONFIG_KASAN_HW_TAGS

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      arm64: enable armv8.5-a asm-arch option
      arm64: mte: add in-kernel MTE helpers
      arm64: mte: reset the page tag in page->flags
      arm64: mte: add in-kernel tag fault handler
      arm64: kasan: allow enabling in-kernel MTE
      arm64: mte: convert gcr_user into an exclude mask
      arm64: mte: switch GCR_EL1 in kernel entry and exit
      kasan, mm: untag page address in free_reserved_area

    Andrey Konovalov <andreyknvl@google.com>:
      arm64: kasan: align allocations for HW_TAGS
      arm64: kasan: add arch layer for memory tagging helpers
      kasan: define KASAN_GRANULE_SIZE for HW_TAGS
      kasan, x86, s390: update undef CONFIG_KASAN
      kasan, arm64: expand CONFIG_KASAN checks
      kasan, arm64: implement HW_TAGS runtime
      kasan, arm64: print report from tag fault handler
      kasan, mm: reset tags when accessing metadata
      kasan, arm64: enable CONFIG_KASAN_HW_TAGS
      kasan: add documentation for hardware tag-based mode

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kselftest/arm64: check GCR_EL1 after context switch

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: boot parameters for hardware tag-based mode", v4:
      kasan: simplify quarantine_put call site
      kasan: rename get_alloc/free_info
      kasan: introduce set_alloc_info
      kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
      kasan: allow VMAP_STACK for HW_TAGS mode
      kasan: remove __kasan_unpoison_stack
      kasan: inline kasan_reset_tag for tag-based modes
      kasan: inline random_tag for HW_TAGS
      kasan: open-code kasan_unpoison_slab
      kasan: inline (un)poison_range and check_invalid_free
      kasan: add and integrate kasan boot parameters
      kasan, mm: check kasan_enabled in annotations
      kasan, mm: rename kasan_poison_kfree
      kasan: don't round_up too much
      kasan: simplify assign_tag and set_tag calls
      kasan: clarify comment in __kasan_kfree_large
      kasan: sanitize objects when metadata doesn't fit
      kasan, mm: allow cache merging with no metadata
      kasan: update documentation

 Documentation/dev-tools/kasan.rst                         |  274 ++-
 arch/Kconfig                                              |    8 
 arch/arm64/Kconfig                                        |    9 
 arch/arm64/Makefile                                       |    7 
 arch/arm64/include/asm/assembler.h                        |    2 
 arch/arm64/include/asm/cache.h                            |    3 
 arch/arm64/include/asm/esr.h                              |    1 
 arch/arm64/include/asm/kasan.h                            |   17 
 arch/arm64/include/asm/memory.h                           |   15 
 arch/arm64/include/asm/mte-def.h                          |   16 
 arch/arm64/include/asm/mte-kasan.h                        |   67 
 arch/arm64/include/asm/mte.h                              |   22 
 arch/arm64/include/asm/processor.h                        |    2 
 arch/arm64/include/asm/string.h                           |    5 
 arch/arm64/include/asm/uaccess.h                          |   23 
 arch/arm64/kernel/asm-offsets.c                           |    3 
 arch/arm64/kernel/cpufeature.c                            |    3 
 arch/arm64/kernel/entry.S                                 |   41 
 arch/arm64/kernel/head.S                                  |    2 
 arch/arm64/kernel/hibernate.c                             |    5 
 arch/arm64/kernel/image-vars.h                            |    2 
 arch/arm64/kernel/kaslr.c                                 |    3 
 arch/arm64/kernel/module.c                                |    6 
 arch/arm64/kernel/mte.c                                   |  124 +
 arch/arm64/kernel/setup.c                                 |    2 
 arch/arm64/kernel/sleep.S                                 |    2 
 arch/arm64/kernel/smp.c                                   |    2 
 arch/arm64/lib/mte.S                                      |   16 
 arch/arm64/mm/copypage.c                                  |    9 
 arch/arm64/mm/fault.c                                     |   59 
 arch/arm64/mm/kasan_init.c                                |   41 
 arch/arm64/mm/mteswap.c                                   |    9 
 arch/arm64/mm/proc.S                                      |   23 
 arch/arm64/mm/ptdump.c                                    |    6 
 arch/s390/boot/string.c                                   |    1 
 arch/x86/boot/compressed/misc.h                           |    1 
 arch/x86/kernel/acpi/wakeup_64.S                          |    2 
 include/linux/kasan-checks.h                              |    2 
 include/linux/kasan.h                                     |  423 ++++-
 include/linux/mm.h                                        |   24 
 include/linux/moduleloader.h                              |    3 
 include/linux/page-flags-layout.h                         |    2 
 include/linux/sched.h                                     |    2 
 include/linux/string.h                                    |    2 
 init/init_task.c                                          |    2 
 kernel/fork.c                                             |    4 
 lib/Kconfig.kasan                                         |   71 
 lib/test_kasan.c                                          |    2 
 lib/test_kasan_module.c                                   |    2 
 mm/kasan/Makefile                                         |   33 
 mm/kasan/common.c                                         | 1006 +++-----------
 mm/kasan/generic.c                                        |   72 -
 mm/kasan/generic_report.c                                 |   13 
 mm/kasan/hw_tags.c                                        |  276 +++
 mm/kasan/init.c                                           |   25 
 mm/kasan/kasan.h                                          |  195 ++
 mm/kasan/quarantine.c                                     |   35 
 mm/kasan/report.c                                         |  363 +----
 mm/kasan/report_generic.c                                 |  169 ++
 mm/kasan/report_hw_tags.c                                 |   44 
 mm/kasan/report_sw_tags.c                                 |   22 
 mm/kasan/shadow.c                                         |  528 +++++++
 mm/kasan/sw_tags.c                                        |   34 
 mm/kasan/tags.c                                           |    7 
 mm/kasan/tags_report.c                                    |    7 
 mm/mempool.c                                              |    4 
 mm/page_alloc.c                                           |    9 
 mm/page_poison.c                                          |    2 
 mm/ptdump.c                                               |   13 
 mm/slab_common.c                                          |    5 
 mm/slub.c                                                 |   29 
 scripts/Makefile.lib                                      |    2 
 tools/testing/selftests/arm64/mte/Makefile                |    2 
 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c |  155 ++
 74 files changed, 2869 insertions(+), 1553 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-12-18 22:00 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87.

Subsystems affected by this patch series:

  mm/memcg
  epoll
  mm/kasan
  mm/cleanups
  epoll

Subsystem: mm/memcg

    Alex Shi <alex.shi@linux.alibaba.com>:
    Patch series "bail out early for memcg disable":
      mm/memcg: bail early from swap accounting if memcg disabled
      mm/memcg: warning on !memcg after readahead page charged

    Wei Yang <richard.weiyang@gmail.com>:
      mm/memcg: remove unused definitions

    Shakeel Butt <shakeelb@google.com>:
      mm, kvm: account kvm_vcpu_mmap to kmemcg

    Hui Su <sh_def@163.com>:
      mm/memcontrol:rewrite mem_cgroup_page_lruvec()

Subsystem: epoll

    Soheil Hassas Yeganeh <soheil@google.com>:
    Patch series "simplify ep_poll":
      epoll: check for events when removing a timed out thread from the wait queue
      epoll: simplify signal handling
      epoll: pull fatal signal checks into ep_send_events()
      epoll: move eavail next to the list_empty_careful check
      epoll: simplify and optimize busy loop logic
      epoll: pull all code between fetch_events and send_event into the loop
      epoll: replace gotos with a proper loop
      epoll: eliminate unnecessary lock for zero timeout

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: add hardware tag-based mode for arm64", v11:
      kasan: drop unnecessary GPL text from comment headers
      kasan: KASAN_VMALLOC depends on KASAN_GENERIC
      kasan: group vmalloc code
      kasan: shadow declarations only for software modes
      kasan: rename (un)poison_shadow to (un)poison_range
      kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
      kasan: only build init.c for software modes
      kasan: split out shadow.c from common.c
      kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
      kasan: rename report and tags files
      kasan: don't duplicate config dependencies
      kasan: hide invalid free check implementation
      kasan: decode stack frame only with KASAN_STACK_ENABLE
      kasan, arm64: only init shadow for software modes
      kasan, arm64: only use kasan_depth for software modes
      kasan, arm64: move initialization message
      kasan, arm64: rename kasan_init_tags and mark as __init
      kasan: rename addr_has_shadow to addr_has_metadata
      kasan: rename print_shadow_for_address to print_memory_metadata
      kasan: rename SHADOW layout macros to META
      kasan: separate metadata_fetch_row for each mode
      kasan: introduce CONFIG_KASAN_HW_TAGS

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      arm64: enable armv8.5-a asm-arch option
      arm64: mte: add in-kernel MTE helpers
      arm64: mte: reset the page tag in page->flags
      arm64: mte: add in-kernel tag fault handler
      arm64: kasan: allow enabling in-kernel MTE
      arm64: mte: convert gcr_user into an exclude mask
      arm64: mte: switch GCR_EL1 in kernel entry and exit
      kasan, mm: untag page address in free_reserved_area

    Andrey Konovalov <andreyknvl@google.com>:
      arm64: kasan: align allocations for HW_TAGS
      arm64: kasan: add arch layer for memory tagging helpers
      kasan: define KASAN_GRANULE_SIZE for HW_TAGS
      kasan, x86, s390: update undef CONFIG_KASAN
      kasan, arm64: expand CONFIG_KASAN checks
      kasan, arm64: implement HW_TAGS runtime
      kasan, arm64: print report from tag fault handler
      kasan, mm: reset tags when accessing metadata
      kasan, arm64: enable CONFIG_KASAN_HW_TAGS
      kasan: add documentation for hardware tag-based mode

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kselftest/arm64: check GCR_EL1 after context switch

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: boot parameters for hardware tag-based mode", v4:
      kasan: simplify quarantine_put call site
      kasan: rename get_alloc/free_info
      kasan: introduce set_alloc_info
      kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
      kasan: allow VMAP_STACK for HW_TAGS mode
      kasan: remove __kasan_unpoison_stack
      kasan: inline kasan_reset_tag for tag-based modes
      kasan: inline random_tag for HW_TAGS
      kasan: open-code kasan_unpoison_slab
      kasan: inline (un)poison_range and check_invalid_free
      kasan: add and integrate kasan boot parameters
      kasan, mm: check kasan_enabled in annotations
      kasan, mm: rename kasan_poison_kfree
      kasan: don't round_up too much
      kasan: simplify assign_tag and set_tag calls
      kasan: clarify comment in __kasan_kfree_large
      kasan: sanitize objects when metadata doesn't fit
      kasan, mm: allow cache merging with no metadata
      kasan: update documentation

Subsystem: mm/cleanups

    Colin Ian King <colin.king@canonical.com>:
      mm/Kconfig: fix spelling mistake "whats" -> "what's"

Subsystem: epoll

    Willem de Bruijn <willemb@google.com>:
    Patch series "add epoll_pwait2 syscall", v4:
      epoll: convert internal api to timespec64
      epoll: add syscall epoll_pwait2
      epoll: wire up syscall epoll_pwait2
      selftests/filesystems: expand epoll with epoll_pwait2

 Documentation/dev-tools/kasan.rst                             |  274 +-
 arch/Kconfig                                                  |    8 
 arch/alpha/kernel/syscalls/syscall.tbl                        |    1 
 arch/arm/tools/syscall.tbl                                    |    1 
 arch/arm64/Kconfig                                            |    9 
 arch/arm64/Makefile                                           |    7 
 arch/arm64/include/asm/assembler.h                            |    2 
 arch/arm64/include/asm/cache.h                                |    3 
 arch/arm64/include/asm/esr.h                                  |    1 
 arch/arm64/include/asm/kasan.h                                |   17 
 arch/arm64/include/asm/memory.h                               |   15 
 arch/arm64/include/asm/mte-def.h                              |   16 
 arch/arm64/include/asm/mte-kasan.h                            |   67 
 arch/arm64/include/asm/mte.h                                  |   22 
 arch/arm64/include/asm/processor.h                            |    2 
 arch/arm64/include/asm/string.h                               |    5 
 arch/arm64/include/asm/uaccess.h                              |   23 
 arch/arm64/include/asm/unistd.h                               |    2 
 arch/arm64/include/asm/unistd32.h                             |    2 
 arch/arm64/kernel/asm-offsets.c                               |    3 
 arch/arm64/kernel/cpufeature.c                                |    3 
 arch/arm64/kernel/entry.S                                     |   41 
 arch/arm64/kernel/head.S                                      |    2 
 arch/arm64/kernel/hibernate.c                                 |    5 
 arch/arm64/kernel/image-vars.h                                |    2 
 arch/arm64/kernel/kaslr.c                                     |    3 
 arch/arm64/kernel/module.c                                    |    6 
 arch/arm64/kernel/mte.c                                       |  124 +
 arch/arm64/kernel/setup.c                                     |    2 
 arch/arm64/kernel/sleep.S                                     |    2 
 arch/arm64/kernel/smp.c                                       |    2 
 arch/arm64/lib/mte.S                                          |   16 
 arch/arm64/mm/copypage.c                                      |    9 
 arch/arm64/mm/fault.c                                         |   59 
 arch/arm64/mm/kasan_init.c                                    |   41 
 arch/arm64/mm/mteswap.c                                       |    9 
 arch/arm64/mm/proc.S                                          |   23 
 arch/arm64/mm/ptdump.c                                        |    6 
 arch/ia64/kernel/syscalls/syscall.tbl                         |    1 
 arch/m68k/kernel/syscalls/syscall.tbl                         |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl                   |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl                     |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl                     |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl                     |    1 
 arch/parisc/kernel/syscalls/syscall.tbl                       |    1 
 arch/powerpc/kernel/syscalls/syscall.tbl                      |    1 
 arch/s390/boot/string.c                                       |    1 
 arch/s390/kernel/syscalls/syscall.tbl                         |    1 
 arch/sh/kernel/syscalls/syscall.tbl                           |    1 
 arch/sparc/kernel/syscalls/syscall.tbl                        |    1 
 arch/x86/boot/compressed/misc.h                               |    1 
 arch/x86/entry/syscalls/syscall_32.tbl                        |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                        |    1 
 arch/x86/kernel/acpi/wakeup_64.S                              |    2 
 arch/x86/kvm/x86.c                                            |    2 
 arch/xtensa/kernel/syscalls/syscall.tbl                       |    1 
 fs/eventpoll.c                                                |  359 ++-
 include/linux/compat.h                                        |    6 
 include/linux/kasan-checks.h                                  |    2 
 include/linux/kasan.h                                         |  423 ++--
 include/linux/memcontrol.h                                    |  137 -
 include/linux/mm.h                                            |   24 
 include/linux/mmdebug.h                                       |   13 
 include/linux/moduleloader.h                                  |    3 
 include/linux/page-flags-layout.h                             |    2 
 include/linux/sched.h                                         |    2 
 include/linux/string.h                                        |    2 
 include/linux/syscalls.h                                      |    5 
 include/uapi/asm-generic/unistd.h                             |    4 
 init/init_task.c                                              |    2 
 kernel/fork.c                                                 |    4 
 kernel/sys_ni.c                                               |    2 
 lib/Kconfig.kasan                                             |   71 
 lib/test_kasan.c                                              |    2 
 lib/test_kasan_module.c                                       |    2 
 mm/Kconfig                                                    |    2 
 mm/kasan/Makefile                                             |   33 
 mm/kasan/common.c                                             | 1006 ++--------
 mm/kasan/generic.c                                            |   72 
 mm/kasan/generic_report.c                                     |   13 
 mm/kasan/hw_tags.c                                            |  294 ++
 mm/kasan/init.c                                               |   25 
 mm/kasan/kasan.h                                              |  204 +-
 mm/kasan/quarantine.c                                         |   35 
 mm/kasan/report.c                                             |  363 +--
 mm/kasan/report_generic.c                                     |  169 +
 mm/kasan/report_hw_tags.c                                     |   44 
 mm/kasan/report_sw_tags.c                                     |   22 
 mm/kasan/shadow.c                                             |  541 +++++
 mm/kasan/sw_tags.c                                            |   34 
 mm/kasan/tags.c                                               |    7 
 mm/kasan/tags_report.c                                        |    7 
 mm/memcontrol.c                                               |   53 
 mm/mempool.c                                                  |    4 
 mm/page_alloc.c                                               |    9 
 mm/page_poison.c                                              |    2 
 mm/ptdump.c                                                   |   13 
 mm/slab_common.c                                              |    5 
 mm/slub.c                                                     |   29 
 scripts/Makefile.lib                                          |    2 
 tools/testing/selftests/arm64/mte/Makefile                    |    2 
 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c     |  155 +
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   72 
 virt/kvm/coalesced_mmio.c                                     |    2 
 virt/kvm/kvm_main.c                                           |    2 
 105 files changed, 3268 insertions(+), 1873 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-12-16  4:41 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-12-16  4:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- lots of little subsystems

- a few post-linux-next MM material.  Most of this awaits more merging
  of other trees.


95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4.

Subsystems affected by this patch series:

  mm/swap
  mm/memory-hotplug
  alpha
  procfs
  misc
  core-kernel
  bitmap
  lib
  lz4
  bitops
  checkpatch
  nilfs
  kdump
  rapidio
  gcov
  bfs
  relay
  resource
  ubsan
  reboot
  fault-injection
  lzo
  apparmor
  mm/pagemap
  mm/cleanups
  mm/gup

Subsystem: mm/swap

    Zhaoyang Huang <huangzhaoyang@gmail.com>:
      mm: fix a race on nr_swap_pages

Subsystem: mm/memory-hotplug

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm/memory_hotplug: quieting offline operation

Subsystem: alpha

    Thomas Gleixner <tglx@linutronix.de>:
      alpha: replace bogus in_interrupt()

Subsystem: procfs

    Randy Dunlap <rdunlap@infradead.org>:
      procfs: delete duplicated words + other fixes

    Anand K Mistry <amistry@google.com>:
      proc: provide details on indirect branch speculation

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: fix lookup in /proc/net subdirectories after setns(2)

    Hui Su <sh_def@163.com>:
      fs/proc: make pde_get() return nothing

Subsystem: misc

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      asm-generic: force inlining of get_order() to work around gcc10 poor decision

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out mathematical helpers

Subsystem: core-kernel

    Hui Su <sh_def@163.com>:
      kernel/acct.c: use #elif instead of #end and #elif

Subsystem: bitmap

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean

    "Ma, Jianpeng" <jianpeng.ma@intel.com>:
      bitmap: remove unused function declaration

Subsystem: lib

    Geert Uytterhoeven <geert@linux-m68k.org>:
      lib/test_free_pages.c: add basic progress indicators

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
    Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member":
      lib/stackdepot.c: replace one-element array with flexible-array member
      lib/stackdepot.c: use flex_array_size() helper in memcpy()
      lib/stackdepot.c: use array_size() helper in jhash2()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      lib/list_kunit: follow new file name convention for KUnit tests
      lib/linear_ranges_kunit: follow new file name convention for KUnit tests
      lib/bits_kunit: follow new file name convention for KUnit tests
      lib/cmdline: fix get_option() for strings starting with hyphen
      lib/cmdline: allow NULL to be an output for get_option()
      lib/cmdline_kunit: add a new test suite for cmdline API

    Jakub Jelinek <jakub@redhat.com>:
      ilog2: improve ilog2 for constant arguments

    Nick Desaulniers <ndesaulniers@google.com>:
      lib/string: remove unnecessary #undefs

    Daniel Axtens <dja@axtens.net>:
    Patch series "Fortify strscpy()", v7:
      lib: string.h: detect intra-object overflow in fortified string functions
      lkdtm: tests for FORTIFY_SOURCE

    Francis Laniel <laniel_francis@privacyrequired.com>:
      string.h: add FORTIFY coverage for strscpy()
      drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy
      drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: cleanup kstrto*() usage

Subsystem: lz4

    Gao Xiang <hsiangkao@redhat.com>:
      lib/lz4: explicitly support in-place decompression

Subsystem: bitops

    Syed Nayyar Waris <syednwaris@gmail.com>:
    Patch series "Introduce the for_each_set_clump macro", v12:
      bitops: introduce the for_each_set_clump macro
      lib/test_bitmap.c: add for_each_set_clump test cases
      gpio: thunderx: utilize for_each_set_clump macro
      gpio: xilinx: utilize generic bitmap_get_value and _set_value

Subsystem: checkpatch

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add new exception to repeated word check

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: fix false positives in REPEATED_WORD warning

    Łukasz Stelmach <l.stelmach@samsung.com>:
      checkpatch: ignore generated CamelCase defines and enum values

    Joe Perches <joe@perches.com>:
      checkpatch: prefer static const declarations
      checkpatch: allow --fix removal of unnecessary break statements

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: extend attributes check to handle more patterns

    Tom Rix <trix@redhat.com>:
      checkpatch: add a fixer for missing newline at eof

    Joe Perches <joe@perches.com>:
      checkpatch: update __attribute__((section("name"))) quote removal

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add fix option for GERRIT_CHANGE_ID

    Joe Perches <joe@perches.com>:
      checkpatch: add __alias and __weak to suggested __attribute__ conversions

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: improve email parsing
      checkpatch: fix spelling errors and remove repeated word

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: fix unescaped left brace

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS
      checkpatch: add fix option for LOGICAL_CONTINUATIONS
      checkpatch: add fix and improve warning msg for non-standard signature

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi]
      checkpatch: add warning for lines starting with a '#' in commit log
      checkpatch: fix TYPO_SPELLING check for words with apostrophe

    Joe Perches <joe@perches.com>:
      checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning

Subsystem: nilfs

    Alex Shi <alex.shi@linux.alibaba.com>:
      fs/nilfs2: remove some unused macros to tame gcc

Subsystem: kdump

    Alexander Egorenkov <egorenar@linux.ibm.com>:
      kdump: append uts_namespace.name offset to VMCOREINFO

Subsystem: rapidio

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      rapidio: remove unused rio_get_asm() and rio_get_device()

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: remove support for GCC < 4.9

    Alex Shi <alex.shi@linux.alibaba.com>:
      gcov: fix kernel-doc markup issue

Subsystem: bfs

    Randy Dunlap <rdunlap@infradead.org>:
      bfs: don't use WARNING: string when it's just info.

Subsystem: relay

    Jani Nikula <jani.nikula@intel.com>:
    Patch series "relay: cleanup and const callbacks", v2:
      relay: remove unused buf_mapped and buf_unmapped callbacks
      relay: require non-NULL callbacks in relay_open()
      relay: make create_buf_file and remove_buf_file callbacks mandatory
      relay: allow the use of const callback structs
      drm/i915: make relay callbacks const
      ath10k: make relay callbacks const
      ath11k: make relay callbacks const
      ath9k: make relay callbacks const
      blktrace: make relay callbacks const

Subsystem: resource

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      kernel/resource.c: fix kernel-doc markups

Subsystem: ubsan

    Kees Cook <keescook@chromium.org>:
    Patch series "Clean up UBSAN Makefile", v2:
      ubsan: remove redundant -Wno-maybe-uninitialized
      ubsan: move cc-option tests into Kconfig
      ubsan: disable object-size sanitizer under GCC
      ubsan: disable UBSAN_TRAP for all*config
      ubsan: enable for all*config builds
      ubsan: remove UBSAN_MISC in favor of individual options
      ubsan: expand tests and reporting

    Dmitry Vyukov <dvyukov@google.com>:
      kcov: don't instrument with UBSAN

    Zou Wei <zou_wei@huawei.com>:
      lib/ubsan.c: mark type_check_kinds with static keyword

Subsystem: reboot

    Matteo Croce <mcroce@microsoft.com>:
      reboot: refactor and comment the cpu selection code
      reboot: allow to specify reboot mode via sysfs
      reboot: remove cf9_safe from allowed types and rename cf9_force
    Patch series "reboot: sysfs improvements":
      reboot: allow to override reboot type if quirks are found
      reboot: hide from sysfs not applicable settings

Subsystem: fault-injection

    Barnabás Pőcze <pobrn@protonmail.com>:
      fault-injection: handle EI_ETYPE_TRUE

Subsystem: lzo

    Jason Yan <yanaijie@huawei.com>:
      lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static

Subsystem: apparmor

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      apparmor: remove duplicate macro list_entry_is_head()

Subsystem: mm/pagemap

    Christoph Hellwig <hch@lst.de>:
    Patch series "simplify follow_pte a bit":
      mm: unexport follow_pte_pmd
      mm: simplify follow_pte{,pmd}

Subsystem: mm/cleanups

    Haitao Shi <shihaitao1@huawei.com>:
      mm: fix some spelling mistakes in comments

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mmap locking API: don't check locking if the mm isn't live yet
      mm/gup: assert that the mmap lock is held in __get_user_pages()

 Documentation/ABI/testing/sysfs-kernel-reboot    |   32 
 Documentation/admin-guide/kdump/vmcoreinfo.rst   |    6 
 Documentation/dev-tools/ubsan.rst                |    1 
 Documentation/filesystems/proc.rst               |    2 
 MAINTAINERS                                      |    5 
 arch/alpha/kernel/process.c                      |    2 
 arch/powerpc/kernel/vmlinux.lds.S                |    4 
 arch/s390/pci/pci_mmio.c                         |    4 
 drivers/gpio/gpio-thunderx.c                     |   11 
 drivers/gpio/gpio-xilinx.c                       |   61 -
 drivers/gpu/drm/i915/gt/uc/intel_guc_log.c       |    2 
 drivers/misc/lkdtm/Makefile                      |    1 
 drivers/misc/lkdtm/bugs.c                        |   50 +
 drivers/misc/lkdtm/core.c                        |    3 
 drivers/misc/lkdtm/fortify.c                     |   82 ++
 drivers/misc/lkdtm/lkdtm.h                       |   19 
 drivers/net/wireless/ath/ath10k/spectral.c       |    2 
 drivers/net/wireless/ath/ath11k/spectral.c       |    2 
 drivers/net/wireless/ath/ath9k/common-spectral.c |    2 
 drivers/rapidio/rio.c                            |   81 --
 fs/bfs/inode.c                                   |    2 
 fs/dax.c                                         |    9 
 fs/exec.c                                        |    8 
 fs/nfs/callback_proc.c                           |    5 
 fs/nilfs2/segment.c                              |    5 
 fs/proc/array.c                                  |   28 
 fs/proc/base.c                                   |    2 
 fs/proc/generic.c                                |   24 
 fs/proc/internal.h                               |   10 
 fs/proc/proc_net.c                               |   20 
 include/asm-generic/bitops/find.h                |   19 
 include/asm-generic/getorder.h                   |    2 
 include/linux/bitmap.h                           |   67 +-
 include/linux/bitops.h                           |   24 
 include/linux/dcache.h                           |    1 
 include/linux/iommu-helper.h                     |    4 
 include/linux/kernel.h                           |  173 -----
 include/linux/log2.h                             |    3 
 include/linux/math.h                             |  177 +++++
 include/linux/mm.h                               |    6 
 include/linux/mm_types.h                         |   10 
 include/linux/mmap_lock.h                        |   16 
 include/linux/proc_fs.h                          |    8 
 include/linux/rcu_node_tree.h                    |    2 
 include/linux/relay.h                            |   29 
 include/linux/rio_drv.h                          |    3 
 include/linux/string.h                           |   75 +-
 include/linux/units.h                            |    2 
 kernel/Makefile                                  |    3 
 kernel/acct.c                                    |    7 
 kernel/crash_core.c                              |    1 
 kernel/fail_function.c                           |    6 
 kernel/gcov/gcc_4_7.c                            |   10 
 kernel/reboot.c                                  |  308 ++++++++-
 kernel/relay.c                                   |  111 ---
 kernel/resource.c                                |   24 
 kernel/trace/blktrace.c                          |    2 
 lib/Kconfig.debug                                |   11 
 lib/Kconfig.ubsan                                |  154 +++-
 lib/Makefile                                     |    7 
 lib/bits_kunit.c                                 |   75 ++
 lib/cmdline.c                                    |   20 
 lib/cmdline_kunit.c                              |  100 +++
 lib/errname.c                                    |    1 
 lib/error-inject.c                               |    2 
 lib/errseq.c                                     |    1 
 lib/find_bit.c                                   |   17 
 lib/linear_ranges_kunit.c                        |  228 +++++++
 lib/list-test.c                                  |  748 -----------------------
 lib/list_kunit.c                                 |  748 +++++++++++++++++++++++
 lib/lz4/lz4_decompress.c                         |    6 
 lib/lz4/lz4defs.h                                |    1 
 lib/lzo/lzo1x_compress.c                         |    2 
 lib/math/div64.c                                 |    4 
 lib/math/int_pow.c                               |    2 
 lib/math/int_sqrt.c                              |    3 
 lib/math/reciprocal_div.c                        |    9 
 lib/stackdepot.c                                 |   11 
 lib/string.c                                     |    4 
 lib/test_bitmap.c                                |  143 ++++
 lib/test_bits.c                                  |   75 --
 lib/test_firmware.c                              |    9 
 lib/test_free_pages.c                            |    5 
 lib/test_kmod.c                                  |   26 
 lib/test_linear_ranges.c                         |  228 -------
 lib/test_lockup.c                                |   16 
 lib/test_ubsan.c                                 |   74 ++
 lib/ubsan.c                                      |    2 
 mm/filemap.c                                     |    2 
 mm/gup.c                                         |    2 
 mm/huge_memory.c                                 |    2 
 mm/khugepaged.c                                  |    2 
 mm/memblock.c                                    |    2 
 mm/memory.c                                      |   36 -
 mm/memory_hotplug.c                              |    2 
 mm/migrate.c                                     |    2 
 mm/page_ext.c                                    |    2 
 mm/swapfile.c                                    |   11 
 scripts/Makefile.ubsan                           |   49 -
 scripts/checkpatch.pl                            |  495 +++++++++++----
 security/apparmor/apparmorfs.c                   |    3 
 tools/testing/selftests/lkdtm/tests.txt          |    1 
 102 files changed, 3022 insertions(+), 1899 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2020-12-15 22:49   ` incoming Linus Torvalds
@ 2020-12-15 22:55     ` Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Linux-MM, mm-commits

On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > I will try to apply it on top of my merge of your previous series instead.
> 
> Yes, then it applies cleanly. So apparently we just have different
> concepts of what really constitutes a "base" for applying your series.
> 

oop, sorry, yes, the "based on" thing was wrong because I had two
series in flight simultaneously.  I've never tried that before..


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2020-12-15 22:48 ` incoming Linus Torvalds
@ 2020-12-15 22:49   ` Linus Torvalds
  2020-12-15 22:55     ` incoming Andrew Morton
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> I will try to apply it on top of my merge of your previous series instead.

Yes, then it applies cleanly. So apparently we just have different
concepts of what really constitutes a "base" for applying your series.

              Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2020-12-15 20:32 incoming Andrew Morton
  2020-12-15 21:00 ` incoming Linus Torvalds
@ 2020-12-15 22:48 ` Linus Torvalds
  2020-12-15 22:49   ` incoming Linus Torvalds
  1 sibling, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

With your re-send, I get all patches, but they don't actually apply cleanly.

Is that base correct?

I get

  error: patch failed: mm/huge_memory.c:2750
  error: mm/huge_memory.c: patch does not apply
  Patch failed at 0004 mm/thp: narrow lru locking

for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's
definitely true: the patch fragment has

@@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page
                                __dec_lruvec_page_state(head, NR_FILE_THPS);
                }

-               __split_huge_page(page, list, end, flags);
+               __split_huge_page(page, list, end);
                ret = 0;
        } else {
                if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) {

but that __dec_lruvec_page_state() conversion was done by your
previous commit series.

So I have the feeling that what you actually mean by "base" isn't
actually really the base for that series at all..

I will try to apply it on top of my merge of your previous series instead.

              Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2020-12-15 20:32 incoming Andrew Morton
@ 2020-12-15 21:00 ` Linus Torvalds
  2020-12-15 22:48 ` incoming Linus Torvalds
  1 sibling, 0 replies; 203+ messages in thread
From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

I'm not seeing patch 10/19 at all.

And patch 19/19 is corrupted and has an attachment with a '^P'
character in it. I could fix it up, but with the missing patch in the
middle I'm not going to even try. 'b4' is also very unhappy about that
patch 19/19.

I don't know what went wrong, but I'll ignore this send - please
re-send the series at your leisure, ok?

            Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-12-15 20:32 Andrew Morton
  2020-12-15 21:00 ` incoming Linus Torvalds
  2020-12-15 22:48 ` incoming Linus Torvalds
  0 siblings, 2 replies; 203+ messages in thread
From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


- more MM work: a memcg scalability improvememt

19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

Subsystems affected by this patch series:


    Alex Shi <alex.shi@linux.alibaba.com>:
    Patch series "per memcg lru lock", v21:
      mm/thp: move lru_add_page_tail() to huge_memory.c
      mm/thp: use head for head page in lru_add_page_tail()
      mm/thp: simplify lru_add_page_tail()
      mm/thp: narrow lru locking
      mm/vmscan: remove unnecessary lruvec adding
      mm/rmap: stop store reordering issue on page->mapping

    Hugh Dickins <hughd@google.com>:
      mm: page_idle_get_page() does not need lru_lock

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: add debug checking in lock_page_memcg
      mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn
      mm/lru: move lock into lru_note_cost
      mm/vmscan: remove lruvec reget in move_pages_to_lru
      mm/mlock: remove lru_lock on TestClearPageMlocked
      mm/mlock: remove __munlock_isolate_lru_page()
      mm/lru: introduce TestClearPageLRU()
      mm/compaction: do page isolation first in compaction
      mm/swap.c: serialize memcg changes in pagevec_lru_move_fn
      mm/lru: replace pgdat lru_lock with lruvec lock

    Alexander Duyck <alexander.h.duyck@linux.intel.com>:
      mm/lru: introduce relock_page_lruvec()

    Hugh Dickins <hughd@google.com>:
      mm/lru: revise the comments of lru_lock

 Documentation/admin-guide/cgroup-v1/memcg_test.rst |   15 -
 Documentation/admin-guide/cgroup-v1/memory.rst     |   23 -
 Documentation/trace/events-kmem.rst                |    2 
 Documentation/vm/unevictable-lru.rst               |   22 -
 include/linux/memcontrol.h                         |  110 +++++++
 include/linux/mm_types.h                           |    2 
 include/linux/mmzone.h                             |    6 
 include/linux/page-flags.h                         |    1 
 include/linux/swap.h                               |    4 
 mm/compaction.c                                    |   98 ++++---
 mm/filemap.c                                       |    4 
 mm/huge_memory.c                                   |  109 ++++---
 mm/memcontrol.c                                    |   84 +++++-
 mm/mlock.c                                         |   93 ++----
 mm/mmzone.c                                        |    1 
 mm/page_alloc.c                                    |    1 
 mm/page_idle.c                                     |    4 
 mm/rmap.c                                          |   12 
 mm/swap.c                                          |  292 ++++++++-------------
 mm/vmscan.c                                        |  239 ++++++++---------
 mm/workingset.c                                    |    2 
 21 files changed, 644 insertions(+), 480 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2020-12-15  3:30   ` incoming Linus Torvalds
@ 2020-12-15 14:04     ` Konstantin Ryabitsev
  0 siblings, 0 replies; 203+ messages in thread
From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote:
> > All the patches except for _one_ get a nice little green check-mark
> > next to them when I use 'git am' on this series.
> >
> > The one that did not was [patch 192/200].
> >
> > I have no idea why
> 
> Hmm. It looks like that patch is the only one in the series with the
> ">From" marker in the commit message, from the silly "clarify that
> this isn't the first line in a new message in mbox format".
> 
> And "b4 am" has turned the single ">" into two, making the stupid
> marker worse, and actually corrupting the end result.

It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted 
.mbox files, while Python's mailbox.mbox consumes mboxo only. The main 
distinction between the two is precisely that mboxrd will convert 
">From " into ">>From " in an attempt to avoid corruption during
escape/unescape (it didn't end up fixing the problem 100% and mostly 
introduced incompatibilities like this one).

I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the 
end of the week.

Thanks for the report.

-K


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2020-12-15  3:25 ` incoming Linus Torvalds
@ 2020-12-15  3:30   ` Linus Torvalds
  2020-12-15 14:04     ` incoming Konstantin Ryabitsev
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2020-12-15  3:30 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> All the patches except for _one_ get a nice little green check-mark
> next to them when I use 'git am' on this series.
>
> The one that did not was [patch 192/200].
>
> I have no idea why

Hmm. It looks like that patch is the only one in the series with the
">From" marker in the commit message, from the silly "clarify that
this isn't the first line in a new message in mbox format".

And "b4 am" has turned the single ">" into two, making the stupid
marker worse, and actually corrupting the end result.

Coincidence? Or cause?

            Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* Re: incoming
  2020-12-15  3:02 incoming Andrew Morton
@ 2020-12-15  3:25 ` Linus Torvalds
  2020-12-15  3:30   ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Linus Torvalds @ 2020-12-15  3:25 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.

I haven't actually processed the patches yet, but I have a question
for Konstantin wrt b4.

All the patches except for _one_ get a nice little green check-mark
next to them when I use 'git am' on this series.

The one that did not was [patch 192/200].

I have no idea why - and it doesn't matter a lot to me, it just stood
out as being different. I'm assuming Andrew has started doing patch
attestation, and that patch failed. But if so, maybe Konstantin wants
to know what went wrong.

Konstantin?

            Linus


^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-12-15  3:02 Andrew Morton
  2020-12-15  3:25 ` incoming Linus Torvalds
  0 siblings, 1 reply; 203+ messages in thread
From: Andrew Morton @ 2020-12-15  3:02 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- a few random little subsystems

- almost all of the MM patches which are staged ahead of linux-next
  material.  I'll trickle to post-linux-next work in as the dependents
  get merged up.


200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.

Subsystems affected by this patch series:

  kthread
  kbuild
  ide
  ntfs
  ocfs2
  arch
  mm/slab-generic
  mm/slab
  mm/slub
  mm/dax
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/hmm
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/compaction
  mm/oom-kill
  mm/migration
  mm/cma
  mm/page-poison
  mm/userfaultfd
  mm/zswap
  mm/zsmalloc
  mm/uaccess
  mm/zram
  mm/cleanups

Subsystem: kthread

    Rob Clark <robdclark@chromium.org>:
      kthread: add kthread_work tracepoints

    Petr Mladek <pmladek@suse.com>:
      kthread_worker: document CPU hotplug handling

Subsystem: kbuild

    Petr Vorel <petr.vorel@gmail.com>:
      uapi: move constants from <linux/kernel.h> to <linux/const.h>

Subsystem: ide

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      ide/falcon: remove in_interrupt() usage
      ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()

Subsystem: ntfs

    Alex Shi <alex.shi@linux.alibaba.com>:
      fs/ntfs: remove unused varibles
      fs/ntfs: remove unused variable attr_len

Subsystem: ocfs2

    Tom Rix <trix@redhat.com>:
      fs/ocfs2/cluster/tcp.c: remove unneeded break

    Mauricio Faria de Oliveira <mfo@canonical.com>:
      ocfs2: ratelimit the 'max lookup times reached' notice

Subsystem: arch

    Colin Ian King <colin.king@canonical.com>:
      arch/Kconfig: fix spelling mistakes

Subsystem: mm/slab-generic

    Hui Su <sh_def@163.com>:
      mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
    Patch series "slab: provide and use krealloc_array()", v3:
      mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
      mm: slab: provide krealloc_array()
      ALSA: pcm: use krealloc_array()
      vhost: vringh: use krealloc_array()
      pinctrl: use krealloc_array()
      edac: ghes: use krealloc_array()
      drm: atomic: use krealloc_array()
      hwtracing: intel: use krealloc_array()
      dma-buf: use krealloc_array()

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slab, slub: clear the slab_cache field when freeing page

Subsystem: mm/slab

    Alexander Popov <alex.popov@linux.com>:
      mm/slab: rerform init_on_free earlier

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: use kmem_cache_debug_flags() in deactivate_slab()

    Bharata B Rao <bharata@linux.ibm.com>:
      mm/slub: let number of online CPUs determine the slub page order

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
      device-dax/kmem: use struct_size()

Subsystem: mm/debug

    Zhenhua Huang <zhenhuah@codeaurora.org>:
      mm: fix page_owner initializing issue for arm32

    Liam Mark <lmark@codeaurora.org>:
      mm/page_owner: record timestamp and pid

Subsystem: mm/pagecache

    Kent Overstreet <kent.overstreet@gmail.com>:
    Patch series "generic_file_buffered_read() improvements", v2:
      mm/filemap/c: break generic_file_buffered_read up into multiple functions
      mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/truncate: add parameter explanation for invalidate_mapping_pagevec

    Hailong Liu <carver4lio@163.com>:
      mm/filemap.c: remove else after a return

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3:
      mm/gup_benchmark: rename to mm/gup_test
      selftests/vm: use a common gup_test.h
      selftests/vm: rename run_vmtests --> run_vmtests.sh
      selftests/vm: minor cleanup: Makefile and gup_test.c
      selftests/vm: only some gup_test items are really benchmarks
      selftests/vm: gup_test: introduce the dump_pages() sub-test
      selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
      selftests/vm: hmm-tests: remove the libhugetlbfs dependency
      selftests/vm: 2x speedup for run_vmtests.sh

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/gup_test.c: mark gup_test_init as __init function
      mm/gup_test: GUP_TEST depends on DEBUG_FS

    Jason Gunthorpe <jgg@nvidia.com>:
    Patch series "Add a seqcount between gup_fast and copy_page_range()", v4:
      mm/gup: reorganize internal_get_user_pages_fast()
      mm/gup: prevent gup_fast from racing with COW during fork
      mm/gup: remove the vma allocation from gup_longterm_locked()
      mm/gup: combine put_compound_head() and unpin_user_page()

Subsystem: mm/swap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: handle zone device pages in release_pages()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
      mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
      mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
      mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE

    Jeff Layton <jlayton@kernel.org>:
      mm: remove pagevec_lookup_range_nr_tag()

Subsystem: mm/shmem

    Hui Su <sh_def@163.com>:
      mm/shmem.c: make shmem_mapping() inline

    Randy Dunlap <rdunlap@infradead.org>:
      tmpfs: fix Documentation nits

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: add file_thp, shmem_thp to memory.stat

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: remove unused mod_memcg_obj_state()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix return of child memcg objcg for root memcg
      mm: memcg/slab: fix use after free in obj_cgroup_charge

    Shakeel Butt <shakeelb@google.com>:
      mm/rmap: always do TTU_IGNORE_ACCESS

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: update page struct member in comments

    Roman Gushchin <guro@fb.com>:
      mm: memcg: fix obsolete code comments
    Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1:
      mm: memcg: deprecate the non-hierarchical mode
      docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
      cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy

    Hui Su <sh_def@163.com>:
      mm/page_counter: use page_counter_read in page_counter_set_max

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      mm: memcg: remove obsolete memcg_has_children()

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state

    Kaixu Xia <kaixuxia@tencent.com>:
      mm: memcontrol: sssign boolean values to a bool variable

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: remove incorrect comment

    Shakeel Butt <shakeelb@google.com>:
    Patch series "memcg: add pagetable comsumption to memory.stat", v2:
      mm: move lruvec stats update functions to vmstat.h
      mm: memcontrol: account pagetables per node

Subsystem: mm/pagemap

    Dan Williams <dan.j.williams@intel.com>:
      xen/unpopulated-alloc: consolidate pgmap manipulation

    Kalesh Singh <kaleshsingh@google.com>:
    Patch series "Speed up mremap on large regions", v4:
      kselftests: vm: add mremap tests
      mm: speedup mremap on 1GB or larger regions
      arm64: mremap speedup - enable HAVE_MOVE_PUD
      x86: mremap speedup - Enable HAVE_MOVE_PUD

    John Hubbard <jhubbard@nvidia.com>:
      mm: cleanup: remove unused tsk arg from __access_remote_vm

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/mapping_dirty_helpers: enhance the kernel-doc markups
      mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte

    Axel Rasmussen <axelrasmussen@google.com>:
      mm: mmap_lock: add tracepoints around lock acquisition

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      sparc: fix handling of page table constructor failure
      mm: move free_unref_page to mm/internal.h

Subsystem: mm/mremap

    Dmitry Safonov <dima@arista.com>:
    Patch series "mremap: move_vma() fixes":
      mm/mremap: account memory on do_munmap() failure
      mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
      mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
      vm_ops: rename .split() callback to .may_split()
      mremap: check if it's possible to split original vma
      mm: forbid splitting special mappings

Subsystem: mm/hmm

    Daniel Vetter <daniel.vetter@ffwll.ch>:
      mm: track mmu notifiers in fs_reclaim_acquire/release
      mm: extract might_alloc() debug check
      locking/selftests: add testcases for fs_reclaim

Subsystem: mm/vmalloc

    Andrew Morton <akpm@linux-foundation.org>:
      mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: use free_vm_area() if an allocation fails
      mm/vmalloc: rework the drain logic

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/vmalloc.c: remove unnecessary return statement

    Waiman Long <longman@redhat.com>:
      mm/vmalloc: Fix unlock order in s_stop()

Subsystem: mm/documentation

    Alex Shi <alex.shi@linux.alibaba.com>:
      docs/vm: remove unused 3 items explanation for /proc/vmstat

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      mm/vmalloc.c: fix kasan shadow poisoning size

    Walter Wu <walter-zh.wu@mediatek.com>:
    Patch series "kasan: add workqueue stack for generic KASAN", v5:
      workqueue: kasan: record workqueue stack
      kasan: print workqueue stack
      lib/test_kasan.c: add workqueue test case
      kasan: update documentation for generic kasan

    Marco Elver <elver@google.com>:
      lkdtm: disable KASAN for rodata.o

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "arch, mm: deprecate DISCONTIGMEM", v2:
      alpha: switch from DISCONTIGMEM to SPARSEMEM
      ia64: remove custom __early_pfn_to_nid()
      ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
      ia64: discontig: paging_init(): remove local max_pfn calculation
      ia64: split virtual map initialization out of paging_init()
      ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
      ia64: make SPARSEMEM default and disable DISCONTIGMEM
      arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
      arm, arm64: move free_unused_memmap() to generic mm
      arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
      m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
      m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
      m68k: deprecate DISCONTIGMEM
    Patch series "arch, mm: improve robustness of direct map manipulation", v7:
      mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
      PM: hibernate: make direct map manipulations more explicit
      arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
      arch, mm: make kernel_page_present() always available

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "disable pcplists during memory offline", v3:
      mm, page_alloc: clean up pageset high and batch update
      mm, page_alloc: calculate pageset high and batch once per zone
      mm, page_alloc: remove setup_pageset()
      mm, page_alloc: simplify pageset_update()
      mm, page_alloc: cache pageset high and batch in struct zone
      mm, page_alloc: move draining pcplists to page isolation users
      mm, page_alloc: disable pcplists during memory offline

    Miaohe Lin <linmiaohe@huawei.com>:
      include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/page-flags: fix comment
      mm/page_alloc: add __free_pages() documentation

    Zou Wei <zou_wei@huawei.com>:
      mm/page_alloc: mark some symbols with static keyword

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1

    Lin Feng <linf@wangsu.com>:
      init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set

    Lorenzo Stoakes <lstoakes@gmail.com>:
      mm: page_alloc: refactor setup_per_zone_lowmem_reserve()

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_alloc: speed up the iteration of max_order

Subsystem: mm/memory-failure

    Oscar Salvador <osalvador@suse.de>:
    Patch series "HWpoison: further fixes and cleanups", v5:
      mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
      mm,hwpoison: take free pages off the buddy freelists
      mm,hwpoison: drop unneeded pcplist draining
    Patch series "HWPoison: Refactor get page interface", v2:
      mm,hwpoison: refactor get_any_page
      mm,hwpoison: disable pcplists before grabbing a refcount
      mm,hwpoison: remove drain_all_pages from shake_page
      mm,memory_failure: always pin the page in madvise_inject_error
      mm,hwpoison: return -EBUSY when migration fails

Subsystem: mm/hugetlb

    Hui Su <sh_def@163.com>:
      mm/hugetlb.c: just use put_page_testzero() instead of page_count()

    Ralph Campbell <rcampbell@nvidia.com>:
      include/linux/huge_mm.h: remove extern keyword

    Alex Shi <alex.shi@linux.alibaba.com>:
      khugepaged: add parameter explanations for kernel-doc markup

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()

    Oscar Salvador <osalvador@suse.de>:
      mm,hugetlb: remove unneeded initialization

    Dan Carpenter <dan.carpenter@oracle.com>:
      hugetlb: fix an error code in hugetlb_reserve_pages()

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: don't wake kswapd prematurely when watermark boosting is disabled

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      mm/vmscan: drop unneeded assignment in kswapd()

    "logic.yu" <hymmsx.yu@gmail.com>:
      mm/vmscan.c: remove the filename in the top of file comment

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_isolation: do not isolate the max order page

Subsystem: mm/z3fold

    Vitaly Wool <vitaly.wool@konsulko.com>:
    Patch series "z3fold: stability / rt fixes":
      z3fold: simplify freeing slots
      z3fold: stricter locking and more careful reclaim
      z3fold: remove preempt disabled sections for RT

Subsystem: mm/compaction

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()

    Hui Su <sh_def@163.com>:
      mm/compaction: move compaction_suitable's comment to right place
      mm/compaction: make defer_compaction and compaction_deferred static

Subsystem: mm/oom-kill

    Hui Su <sh_def@163.com>:
      mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()

Subsystem: mm/migration

    Long Li <lonuxli.64@gmail.com>:
      mm/migrate.c: fix comment spelling

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate.c: optimize migrate_vma_pages() mmu notifier

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: support THPs in zero_user_segments

    Yang Shi <shy828301@gmail.com>:
    Patch series "mm: misc migrate cleanup and improvement", v3:
      mm: truncate_complete_page() does not exist any more
      mm: migrate: simplify the logic for handling permanent failure
      mm: migrate: skip shared exec THP for NUMA balancing
      mm: migrate: clean up migrate_prep{_local}
      mm: migrate: return -ENOSYS if THP migration is unsupported

    Stephen Zhang <starzhangzsd@gmail.com>:
      mm: migrate: remove unused parameter in migrate_vma_insert_page()

Subsystem: mm/cma

    Lecopzer Chen <lecopzer.chen@mediatek.com>:
      mm/cma.c: remove redundant cma_mutex lock

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: cma: improve pr_debug log in cma_release()

Subsystem: mm/page-poison

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "cleanup page poisoning", v3:
      mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
      mm, page_poison: use static key more efficiently
      kernel/power: allow hibernation with page_poison sanity checking
      mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
      mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO

Subsystem: mm/userfaultfd

    Lokesh Gidra <lokeshgidra@google.com>:
    Patch series "Control over userfaultfd kernel-fault handling", v6:
      userfaultfd: add UFFD_USER_MODE_ONLY
      userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: selftests: make __{s,u}64 format specifiers portable

    Peter Xu <peterx@redhat.com>:
    Patch series "userfaultfd: selftests: Small fixes":
      userfaultfd/selftests: always dump something in modes
      userfaultfd/selftests: fix retval check for userfaultfd_open()
      userfaultfd/selftests: hint the test runner on required privilege

Subsystem: mm/zswap

    Joe Perches <joe@perches.com>:
      mm/zswap: make struct kernel_param_ops definitions const

    YueHaibing <yuehaibing@huawei.com>:
      mm/zswap: fix passing zero to 'PTR_ERR' warning

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/zswap: move to use crypto_acomp API for hardware acceleration

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: rework the list_add code in insert_zspage()

Subsystem: mm/uaccess

    Colin Ian King <colin.king@canonical.com>:
      mm/process_vm_access: remove redundant initialization of iov_r

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      zram: support page writeback
      zram: add stat to gather incompressible pages since zram set up

    Rui Salvaterra <rsalvaterra@gmail.com>:
      zram: break the strict dependency from lzo

Subsystem: mm/cleanups

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      mm: fix kernel-doc markups

    Joe Perches <joe@perches.com>:
    Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2:
      mm: use sysfs_emit for struct kobject * uses
      mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
      mm:backing-dev: use sysfs_emit in macro defining functions
      mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
      mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      mm: fix fall-through warnings for Clang

    Alexey Dobriyan <adobriyan@gmail.com>:
      mm: cleanup kstrto*() usage

 /mmap_lock.h                                         |  107 ++
 a/Documentation/admin-guide/blockdev/zram.rst        |    6 
 a/Documentation/admin-guide/cgroup-v1/memcg_test.rst |    8 
 a/Documentation/admin-guide/cgroup-v1/memory.rst     |   42 
 a/Documentation/admin-guide/cgroup-v2.rst            |   11 
 a/Documentation/admin-guide/mm/transhuge.rst         |   15 
 a/Documentation/admin-guide/sysctl/vm.rst            |   15 
 a/Documentation/core-api/memory-allocation.rst       |    4 
 a/Documentation/core-api/pin_user_pages.rst          |    8 
 a/Documentation/dev-tools/kasan.rst                  |    5 
 a/Documentation/filesystems/tmpfs.rst                |    8 
 a/Documentation/vm/memory-model.rst                  |    3 
 a/Documentation/vm/page_owner.rst                    |   12 
 a/arch/Kconfig                                       |   21 
 a/arch/alpha/Kconfig                                 |    8 
 a/arch/alpha/include/asm/mmzone.h                    |   14 
 a/arch/alpha/include/asm/page.h                      |    7 
 a/arch/alpha/include/asm/pgtable.h                   |   12 
 a/arch/alpha/include/asm/sparsemem.h                 |   18 
 a/arch/alpha/kernel/setup.c                          |    1 
 a/arch/arc/Kconfig                                   |    3 
 a/arch/arc/include/asm/page.h                        |   20 
 a/arch/arc/mm/init.c                                 |   29 
 a/arch/arm/Kconfig                                   |   12 
 a/arch/arm/kernel/vdso.c                             |    9 
 a/arch/arm/mach-bcm/Kconfig                          |    1 
 a/arch/arm/mach-davinci/Kconfig                      |    1 
 a/arch/arm/mach-exynos/Kconfig                       |    1 
 a/arch/arm/mach-highbank/Kconfig                     |    1 
 a/arch/arm/mach-omap2/Kconfig                        |    1 
 a/arch/arm/mach-s5pv210/Kconfig                      |    1 
 a/arch/arm/mach-tango/Kconfig                        |    1 
 a/arch/arm/mm/init.c                                 |   78 -
 a/arch/arm64/Kconfig                                 |    9 
 a/arch/arm64/include/asm/cacheflush.h                |    1 
 a/arch/arm64/include/asm/pgtable.h                   |    1 
 a/arch/arm64/kernel/vdso.c                           |   41 
 a/arch/arm64/mm/init.c                               |   68 -
 a/arch/arm64/mm/pageattr.c                           |   12 
 a/arch/ia64/Kconfig                                  |   11 
 a/arch/ia64/include/asm/meminit.h                    |    2 
 a/arch/ia64/mm/contig.c                              |   88 --
 a/arch/ia64/mm/discontig.c                           |   44 -
 a/arch/ia64/mm/init.c                                |   14 
 a/arch/ia64/mm/numa.c                                |   30 
 a/arch/m68k/Kconfig.cpu                              |   31 
 a/arch/m68k/include/asm/page.h                       |    2 
 a/arch/m68k/include/asm/page_mm.h                    |    7 
 a/arch/m68k/include/asm/virtconvert.h                |    7 
 a/arch/m68k/mm/init.c                                |   10 
 a/arch/mips/vdso/genvdso.c                           |    4 
 a/arch/nds32/mm/mm-nds32.c                           |    6 
 a/arch/powerpc/Kconfig                               |    5 
 a/arch/riscv/Kconfig                                 |    4 
 a/arch/riscv/include/asm/pgtable.h                   |    2 
 a/arch/riscv/include/asm/set_memory.h                |    1 
 a/arch/riscv/mm/pageattr.c                           |   31 
 a/arch/s390/Kconfig                                  |    4 
 a/arch/s390/configs/debug_defconfig                  |    2 
 a/arch/s390/configs/defconfig                        |    2 
 a/arch/s390/kernel/vdso.c                            |   11 
 a/arch/sparc/Kconfig                                 |    4 
 a/arch/sparc/mm/init_64.c                            |    2 
 a/arch/x86/Kconfig                                   |    5 
 a/arch/x86/entry/vdso/vma.c                          |   17 
 a/arch/x86/include/asm/set_memory.h                  |    1 
 a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c          |    2 
 a/arch/x86/kernel/tboot.c                            |    1 
 a/arch/x86/mm/pat/set_memory.c                       |    6 
 a/drivers/base/node.c                                |    2 
 a/drivers/block/zram/Kconfig                         |   42 
 a/drivers/block/zram/zcomp.c                         |    2 
 a/drivers/block/zram/zram_drv.c                      |   29 
 a/drivers/block/zram/zram_drv.h                      |    1 
 a/drivers/dax/device.c                               |    4 
 a/drivers/dax/kmem.c                                 |    2 
 a/drivers/dma-buf/sync_file.c                        |    3 
 a/drivers/edac/ghes_edac.c                           |    4 
 a/drivers/firmware/efi/efi.c                         |    1 
 a/drivers/gpu/drm/drm_atomic.c                       |    3 
 a/drivers/hwtracing/intel_th/msu.c                   |    2 
 a/drivers/ide/falconide.c                            |    2 
 a/drivers/ide/ide-probe.c                            |    3 
 a/drivers/misc/lkdtm/Makefile                        |    1 
 a/drivers/pinctrl/pinctrl-utils.c                    |    2 
 a/drivers/vhost/vringh.c                             |    3 
 a/drivers/virtio/virtio_balloon.c                    |    6 
 a/drivers/xen/unpopulated-alloc.c                    |   14 
 a/fs/aio.c                                           |    5 
 a/fs/ntfs/file.c                                     |    5 
 a/fs/ntfs/inode.c                                    |    2 
 a/fs/ntfs/logfile.c                                  |    3 
 a/fs/ocfs2/cluster/tcp.c                             |    1 
 a/fs/ocfs2/namei.c                                   |    4 
 a/fs/proc/kcore.c                                    |    2 
 a/fs/proc/meminfo.c                                  |    2 
 a/fs/userfaultfd.c                                   |   20 
 a/include/linux/cgroup-defs.h                        |   15 
 a/include/linux/compaction.h                         |   12 
 a/include/linux/fs.h                                 |    2 
 a/include/linux/gfp.h                                |    2 
 a/include/linux/highmem.h                            |   19 
 a/include/linux/huge_mm.h                            |   93 --
 a/include/linux/memcontrol.h                         |  148 ---
 a/include/linux/migrate.h                            |    4 
 a/include/linux/mm.h                                 |  118 +-
 a/include/linux/mm_types.h                           |    8 
 a/include/linux/mmap_lock.h                          |   94 ++
 a/include/linux/mmzone.h                             |   50 -
 a/include/linux/page-flags.h                         |    6 
 a/include/linux/page_ext.h                           |    8 
 a/include/linux/pagevec.h                            |    3 
 a/include/linux/poison.h                             |    4 
 a/include/linux/rmap.h                               |    1 
 a/include/linux/sched/mm.h                           |   16 
 a/include/linux/set_memory.h                         |    5 
 a/include/linux/shmem_fs.h                           |    6 
 a/include/linux/slab.h                               |   18 
 a/include/linux/vmalloc.h                            |    8 
 a/include/linux/vmstat.h                             |  104 ++
 a/include/trace/events/sched.h                       |   84 +
 a/include/uapi/linux/const.h                         |    5 
 a/include/uapi/linux/ethtool.h                       |    2 
 a/include/uapi/linux/kernel.h                        |    9 
 a/include/uapi/linux/lightnvm.h                      |    2 
 a/include/uapi/linux/mroute6.h                       |    2 
 a/include/uapi/linux/netfilter/x_tables.h            |    2 
 a/include/uapi/linux/netlink.h                       |    2 
 a/include/uapi/linux/sysctl.h                        |    2 
 a/include/uapi/linux/userfaultfd.h                   |    9 
 a/init/main.c                                        |    6 
 a/ipc/shm.c                                          |    8 
 a/kernel/cgroup/cgroup.c                             |   12 
 a/kernel/fork.c                                      |    3 
 a/kernel/kthread.c                                   |   29 
 a/kernel/power/hibernate.c                           |    2 
 a/kernel/power/power.h                               |    2 
 a/kernel/power/snapshot.c                            |   52 +
 a/kernel/ptrace.c                                    |    2 
 a/kernel/workqueue.c                                 |    3 
 a/lib/locking-selftest.c                             |   47 +
 a/lib/test_kasan_module.c                            |   29 
 a/mm/Kconfig                                         |   25 
 a/mm/Kconfig.debug                                   |   28 
 a/mm/Makefile                                        |    4 
 a/mm/backing-dev.c                                   |    8 
 a/mm/cma.c                                           |    6 
 a/mm/compaction.c                                    |   29 
 a/mm/filemap.c                                       |  823 ++++++++++---------
 a/mm/gup.c                                           |  329 ++-----
 a/mm/gup_benchmark.c                                 |  210 ----
 a/mm/gup_test.c                                      |  299 ++++++
 a/mm/gup_test.h                                      |   40 
 a/mm/highmem.c                                       |   52 +
 a/mm/huge_memory.c                                   |   86 +
 a/mm/hugetlb.c                                       |   28 
 a/mm/init-mm.c                                       |    1 
 a/mm/internal.h                                      |    5 
 a/mm/kasan/generic.c                                 |    3 
 a/mm/kasan/report.c                                  |    4 
 a/mm/khugepaged.c                                    |   58 -
 a/mm/ksm.c                                           |   50 -
 a/mm/madvise.c                                       |   14 
 a/mm/mapping_dirty_helpers.c                         |    6 
 a/mm/memblock.c                                      |   80 +
 a/mm/memcontrol.c                                    |  170 +--
 a/mm/memory-failure.c                                |  322 +++----
 a/mm/memory.c                                        |   24 
 a/mm/memory_hotplug.c                                |   44 -
 a/mm/mempolicy.c                                     |    8 
 a/mm/migrate.c                                       |  183 ++--
 a/mm/mm_init.c                                       |    1 
 a/mm/mmap.c                                          |   22 
 a/mm/mmap_lock.c                                     |  230 +++++
 a/mm/mmu_notifier.c                                  |    7 
 a/mm/mmzone.c                                        |   14 
 a/mm/mremap.c                                        |  282 ++++--
 a/mm/nommu.c                                         |    8 
 a/mm/oom_kill.c                                      |   14 
 a/mm/page_alloc.c                                    |  517 ++++++-----
 a/mm/page_counter.c                                  |    4 
 a/mm/page_ext.c                                      |   10 
 a/mm/page_isolation.c                                |   18 
 a/mm/page_owner.c                                    |   17 
 a/mm/page_poison.c                                   |   56 -
 a/mm/page_vma_mapped.c                               |    9 
 a/mm/process_vm_access.c                             |    2 
 a/mm/rmap.c                                          |    9 
 a/mm/shmem.c                                         |   39 
 a/mm/slab.c                                          |   10 
 a/mm/slab.h                                          |    9 
 a/mm/slab_common.c                                   |   10 
 a/mm/slob.c                                          |    6 
 a/mm/slub.c                                          |  156 +--
 a/mm/swap.c                                          |   12 
 a/mm/swap_state.c                                    |    7 
 a/mm/swapfile.c                                      |   14 
 a/mm/truncate.c                                      |   18 
 a/mm/vmalloc.c                                       |  105 +-
 a/mm/vmscan.c                                        |   21 
 a/mm/vmstat.c                                        |    6 
 a/mm/workingset.c                                    |    8 
 a/mm/z3fold.c                                        |  215 ++--
 a/mm/zsmalloc.c                                      |   11 
 a/mm/zswap.c                                         |  193 +++-
 a/sound/core/pcm_lib.c                               |    4 
 a/tools/include/linux/poison.h                       |    6 
 a/tools/testing/selftests/vm/.gitignore              |    4 
 a/tools/testing/selftests/vm/Makefile                |   41 
 a/tools/testing/selftests/vm/check_config.sh         |   31 
 a/tools/testing/selftests/vm/config                  |    2 
 a/tools/testing/selftests/vm/gup_benchmark.c         |  143 ---
 a/tools/testing/selftests/vm/gup_test.c              |  258 +++++
 a/tools/testing/selftests/vm/hmm-tests.c             |   10 
 a/tools/testing/selftests/vm/mremap_test.c           |  344 +++++++
 a/tools/testing/selftests/vm/run_vmtests             |   51 -
 a/tools/testing/selftests/vm/userfaultfd.c           |   94 --
 217 files changed, 4817 insertions(+), 3369 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-12-11 21:35 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c.

Subsystems affected by this patch series:

  mm/pagecache
  proc
  selftests
  kbuild
  mm/kasan
  mm/hugetlb

Subsystem: mm/pagecache

    Andrew Morton <akpm@linux-foundation.org>:
      revert "mm/filemap: add static for function __add_to_page_cache_locked"

Subsystem: proc

    Miles Chen <miles.chen@mediatek.com>:
      proc: use untagged_addr() for pagemap_read addresses

Subsystem: selftests

    Arnd Bergmann <arnd@arndb.de>:
      selftest/fpu: avoid clang warning

Subsystem: kbuild

    Arnd Bergmann <arnd@arndb.de>:
      kbuild: avoid static_assert for genksyms
      initramfs: fix clang build failure
      elfcore: fix building with clang

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      kasan: fix object remaining in offline per-cpu quarantine

Subsystem: mm/hugetlb

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/hugetlb: clear compound_nr before freeing gigantic pages

 fs/proc/task_mmu.c        |    8 ++++++--
 include/linux/build_bug.h |    5 +++++
 include/linux/elfcore.h   |   22 ++++++++++++++++++++++
 init/initramfs.c          |    2 +-
 kernel/Makefile           |    1 -
 kernel/elfcore.c          |   26 --------------------------
 lib/Makefile              |    3 ++-
 mm/filemap.c              |    2 +-
 mm/hugetlb.c              |    1 +
 mm/kasan/quarantine.c     |   39 +++++++++++++++++++++++++++++++++++++++
 10 files changed, 77 insertions(+), 32 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-12-06  6:14 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-12-06  6:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59.

Subsystems affected by this patch series:

  lib
  coredump
  mm/memcg
  mm/zsmalloc
  mm/swap
  mailmap
  mm/selftests
  mm/pagecache
  mm/hugetlb
  mm/pagemap

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      zlib: export S390 symbols for zlib modules

Subsystem: coredump

    Menglong Dong <dong.menglong@zte.com.cn>:
      coredump: fix core_pattern parse error

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: fix obj_cgroup_charge() return value handling

    Yang Shi <shy828301@gmail.com>:
      mm: list_lru: set shrinker map bit when child nr_items is not zero

Subsystem: mm/zsmalloc

    Minchan Kim <minchan@kernel.org>:
      mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING

Subsystem: mm/swap

    Qian Cai <qcai@redhat.com>:
      mm/swapfile: do not sleep with a spin lock held

Subsystem: mailmap

    Uwe Kleine-König <u.kleine-koenig@pengutronix.de>:
      mailmap: add two more addresses of Uwe Kleine-König

Subsystem: mm/selftests

    Xingxing Su <suxingxing@loongson.cn>:
      tools/testing/selftests/vm: fix build error

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: selftests: fix SIGSEGV if huge mmap fails

Subsystem: mm/pagecache

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/filemap: add static for function __add_to_page_cache_locked

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb_cgroup: fix offline of hugetlb cgroup with reservations

Subsystem: mm/pagemap

    Liu Zixian <liuzixian4@huawei.com>:
      mm/mmap.c: fix mmap return value when vma is merged after call_mmap()

 .mailmap                                 |    2 +
 arch/arm/configs/omap2plus_defconfig     |    1 
 fs/coredump.c                            |    3 +
 include/linux/zsmalloc.h                 |    1 
 lib/zlib_dfltcc/dfltcc_inflate.c         |    3 +
 mm/Kconfig                               |   13 -------
 mm/filemap.c                             |    2 -
 mm/hugetlb_cgroup.c                      |    8 +---
 mm/list_lru.c                            |   10 ++---
 mm/mmap.c                                |   26 ++++++--------
 mm/slab.h                                |   40 +++++++++++++---------
 mm/swapfile.c                            |    4 +-
 mm/zsmalloc.c                            |   54 -------------------------------
 tools/testing/selftests/vm/Makefile      |    4 ++
 tools/testing/selftests/vm/userfaultfd.c |   25 +++++++++-----
 15 files changed, 75 insertions(+), 121 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-11-22  6:16 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-11-22  6:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95.

Subsystems affected by this patch series:

  mm/madvise
  kbuild
  mm/pagemap
  mm/readahead
  mm/memcg
  mm/userfaultfd
  vfs-akpm
  mm/madvise

Subsystem: mm/madvise

    Eric Dumazet <edumazet@google.com>:
      mm/madvise: fix memory leak from process_madvise

Subsystem: kbuild

    Nick Desaulniers <ndesaulniers@google.com>:
      compiler-clang: remove version check for BPF Tracing

Subsystem: mm/pagemap

    Dan Williams <dan.j.williams@intel.com>:
      mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports

Subsystem: mm/readahead

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix readahead_page_batch for retry entries

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix root memcg vmstats

Subsystem: mm/userfaultfd

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault()

Subsystem: vfs-akpm

    Yicong Yang <yangyicong@hisilicon.com>:
      libfs: fix error cast of negative value in simple_attr_write()

Subsystem: mm/madvise

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix madvise WILLNEED performance problem

 arch/ia64/include/asm/sparsemem.h    |    6 ++++++
 arch/powerpc/include/asm/mmzone.h    |    5 +++++
 arch/powerpc/include/asm/sparsemem.h |    5 ++---
 arch/powerpc/mm/mem.c                |    1 +
 arch/x86/include/asm/sparsemem.h     |   10 ++++++++++
 arch/x86/mm/numa.c                   |    2 ++
 drivers/dax/Kconfig                  |    1 -
 fs/libfs.c                           |    6 ++++--
 include/linux/compiler-clang.h       |    2 ++
 include/linux/memory_hotplug.h       |   14 --------------
 include/linux/numa.h                 |   30 +++++++++++++++++++++++++++++-
 include/linux/pagemap.h              |    2 ++
 mm/huge_memory.c                     |    9 ++++-----
 mm/madvise.c                         |    4 +---
 mm/memcontrol.c                      |    9 +++++++--
 mm/memory_hotplug.c                  |   18 ------------------
 16 files changed, 75 insertions(+), 49 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-11-14  6:51 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-11-14  6:51 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81.

Subsystems affected by this patch series:

  mm/migration
  mm/vmscan
  mailmap
  mm/slub
  mm/gup
  kbuild
  reboot
  kernel/watchdog
  mm/memcg
  mm/hugetlbfs
  panic
  ocfs2

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm/compaction: count pages and stop correctly during page isolation
      mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate

Subsystem: mm/vmscan

    Nicholas Piggin <npiggin@gmail.com>:
      mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit

Subsystem: mailmap

    Dmitry Baryshkov <dbaryshkov@gmail.com>:
      mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov

Subsystem: mm/slub

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm/slub: fix panic in slab_alloc_node()

Subsystem: mm/gup

    Jason Gunthorpe <jgg@nvidia.com>:
      mm/gup: use unpin_user_pages() in __gup_longterm_locked()

Subsystem: kbuild

    Arvind Sankar <nivedita@alum.mit.edu>:
      compiler.h: fix barrier_data() on clang

Subsystem: reboot

    Matteo Croce <mcroce@microsoft.com>:
    Patch series "fix parsing of reboot= cmdline", v3:
      Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint"
      reboot: fix overflow parsing reboot cpu number

Subsystem: kernel/watchdog

    Santosh Sivaraj <santosh@fossix.org>:
      kernel/watchdog: fix watchdog_allowed_mask not used warning

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix missing wakeup polling thread

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: fix anon huge page migration race

Subsystem: panic

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      panic: don't dump stack twice on warn

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: initialize ip_next_orphan

 .mailmap                       |    5 +-
 fs/ocfs2/super.c               |    1 
 include/asm-generic/barrier.h  |    1 
 include/linux/compiler-clang.h |    6 --
 include/linux/compiler-gcc.h   |   19 --------
 include/linux/compiler.h       |   18 +++++++-
 include/linux/memcontrol.h     |   11 ++++-
 kernel/panic.c                 |    3 -
 kernel/reboot.c                |   28 ++++++------
 kernel/watchdog.c              |    4 -
 mm/compaction.c                |   12 +++--
 mm/gup.c                       |   14 ++++--
 mm/hugetlb.c                   |   90 ++---------------------------------------
 mm/memory-failure.c            |   36 +++++++---------
 mm/migrate.c                   |   46 +++++++++++---------
 mm/rmap.c                      |    5 --
 mm/slub.c                      |    2 
 mm/vmscan.c                    |    5 +-
 18 files changed, 119 insertions(+), 187 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-11-02  1:06 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-11-02  1:06 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891.

Subsystems affected by this patch series:

  mm/memremap
  mm/memcg
  mm/slab-generic
  mm/kasan
  mm/mempolicy
  signals
  lib
  mm/pagecache
  kthread
  mm/oom-kill
  mm/pagemap
  epoll
  core-kernel

Subsystem: mm/memremap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/mremap_pages: fix static key devmap_managed_key updates

Subsystem: mm/memcg

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb_cgroup: fix reservation accounting

    zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
      mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg: link page counters to root if use_hierarchy is false

Subsystem: mm/slab-generic

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: adopt KUNIT tests to SW_TAGS mode

Subsystem: mm/mempolicy

    Shijie Luo <luoshijie1@huawei.com>:
      mm: mempolicy: fix potential pte_unmap_unlock pte error

Subsystem: signals

    Oleg Nesterov <oleg@redhat.com>:
      ptrace: fix task_join_group_stop() for the case when current is traced

Subsystem: lib

    Vasily Gorbik <gor@linux.ibm.com>:
      lib/crc32test: remove extra local_irq_disable/enable

Subsystem: mm/pagecache

    Jason Yan <yanaijie@huawei.com>:
      mm/truncate.c: make __invalidate_mapping_pages() static

Subsystem: kthread

    Zqiang <qiang.zhang@windriver.com>:
      kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled

Subsystem: mm/oom-kill

    Charles Haithcock <chaithco@redhat.com>:
      mm, oom: keep oom_adj under or at upper limit when printing

Subsystem: mm/pagemap

    Jason Gunthorpe <jgg@nvidia.com>:
      mm: always have io_remap_pfn_range() set pgprot_decrypted()

Subsystem: epoll

    Soheil Hassas Yeganeh <soheil@google.com>:
      epoll: check ep_events_available() upon timeout
      epoll: add a selftest for epoll timeout race

Subsystem: core-kernel

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      kernel/hung_task.c: make type annotations consistent

 fs/eventpoll.c                                                |   16 +
 fs/proc/base.c                                                |    2 
 include/linux/mm.h                                            |    9 
 include/linux/pgtable.h                                       |    4 
 kernel/hung_task.c                                            |    3 
 kernel/kthread.c                                              |    3 
 kernel/signal.c                                               |   19 -
 lib/crc32test.c                                               |    4 
 lib/test_kasan.c                                              |  149 +++++++---
 mm/hugetlb.c                                                  |   20 -
 mm/memcontrol.c                                               |   25 +
 mm/mempolicy.c                                                |    6 
 mm/memremap.c                                                 |   39 +-
 mm/truncate.c                                                 |    2 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   95 ++++++
 15 files changed, 290 insertions(+), 106 deletions(-)



^ permalink raw reply	[flat|nested] 203+ messages in thread

* incoming
@ 2020-10-17 23:13 Andrew Morton
  0 siblings, 0 replies; 203+ messages in thread
From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53.

Subsystems affected by this patch series:

  ia64
  mm/memcg
  mm/migration
  mm/pagemap
  mm/gup
  mm/madvise
  mm/vmalloc
  misc

Subsystem: ia64

    Krzysztof Kozlowski <krzk@kernel.org>:
      ia64: fix build error with !COREDUMP

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm, memcg: rework remote charging API to support nesting
    Patch series "mm: kmem: kernel memory accounting in an interrupt context":
      mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current()
      mm: kmem: remove redundant checks from get_obj_cgroup_from_current()
      mm: kmem: prepare remote memcg charging infra for interrupt contexts
      mm: kmem: enable kernel memcg accounting from interrupt contexts

Subsystem: mm/migration

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/memory-failure: remove a wrapper for alloc_migration_target()
      mm/memory_hotplug: remove a wrapper for alloc_migration_target()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/migrate: avoid possible unnecessary process right check in kernel_move_pages()

Subsystem: mm/pagemap

    "Liam R. Howlett" <Liam.Howlett@Oracle.com>:
      mm/mmap: add inline vma_next() for readability of mmap code
      mm/mmap: add inline munmap_vma_range() for code readability

Subsys