linux-mm.kvack.org archive mirror
 help / color / mirror / Atom feed
* incoming
@ 2021-03-25  4:36 Andrew Morton
  2021-03-25  4:37 ` [patch 01/14] hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings Andrew Morton
                   ` (13 more replies)
  0 siblings, 14 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:36 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/kasan
  mm/gup
  mm/selftests
  mm/z3fold
  squashfs
  ia64
  gcov
  mm/kfence
  mm/memblock
  mm/highmem
  mailmap

Subsystem: mm/hugetlb

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix per-page tags for non-page_alloc pages

Subsystem: mm/gup

    Sean Christopherson <seanjc@google.com>:
      mm/mmu_notifiers: ensure range_end() is paired with range_start()

Subsystem: mm/selftests

    Rong Chen <rong.a.chen@intel.com>:
      selftests/vm: fix out-of-tree build

Subsystem: mm/z3fold

    Thomas Hebb <tommyhebb@gmail.com>:
      z3fold: prevent reclaim/free race for headless pages

Subsystem: squashfs

    Sean Nyekjaer <sean@geanix.com>:
      squashfs: fix inode lookup sanity checks

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix xattr id and id lookup sanity checks

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: mca: allocate early mca with GFP_ATOMIC
      ia64: fix format strings for err_inject

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: fix clang-11+ support

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: make compatible with kmemleak

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      mm: memblock: fix section mismatch warning again

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP

Subsystem: mailmap

    Andrey Konovalov <andreyknvl@google.com>:
      mailmap: update Andrey Konovalov's email address

 .mailmap                            |    1 
 arch/ia64/kernel/err_inject.c       |   22 +++++------
 arch/ia64/kernel/mca.c              |    2 -
 fs/squashfs/export.c                |    8 +++-
 fs/squashfs/id.c                    |    6 ++-
 fs/squashfs/squashfs_fs.h           |    1 
 fs/squashfs/xattr_id.c              |    6 ++-
 include/linux/hugetlb_cgroup.h      |   15 ++++++-
 include/linux/memblock.h            |    4 +-
 include/linux/mm.h                  |   18 +++++++--
 include/linux/mmu_notifier.h        |   10 ++---
 kernel/gcov/clang.c                 |   69 ++++++++++++++++++++++++++++++++++++
 mm/highmem.c                        |    4 +-
 mm/hugetlb.c                        |   41 +++++++++++++++++++--
 mm/hugetlb_cgroup.c                 |   10 ++++-
 mm/kfence/core.c                    |    9 ++++
 mm/kmemleak.c                       |    3 +
 mm/mmu_notifier.c                   |   23 ++++++++++++
 mm/z3fold.c                         |   16 +++++++-
 tools/testing/selftests/vm/Makefile |    4 +-
 20 files changed, 230 insertions(+), 42 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 01/14] hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings
  2021-03-25  4:36 incoming Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 02/14] kasan: fix per-page tags for non-page_alloc pages Andrew Morton
                   ` (12 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, almasrymina, aneesh.kumar, linmiaohe, linux-mm, liwp.linux,
	lkp, mike.kravetz, mm-commits, stable, torvalds

From: Miaohe Lin <linmiaohe@huawei.com>
Subject: hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings

The current implementation of hugetlb_cgroup for shared mappings could
have different behavior.  Consider the following two scenarios:

1.Assume initial css reference count of hugetlb_cgroup is 1:
  1.1 Call hugetlb_reserve_pages with from = 1, to = 2. So css reference
count is 2 associated with 1 file_region.
  1.2 Call hugetlb_reserve_pages with from = 2, to = 3. So css reference
count is 3 associated with 2 file_region.
  1.3 coalesce_file_region will coalesce these two file_regions into one.
So css reference count is 3 associated with 1 file_region now.

2.Assume initial css reference count of hugetlb_cgroup is 1 again:
  2.1 Call hugetlb_reserve_pages with from = 1, to = 3. So css reference
count is 2 associated with 1 file_region.

Therefore, we might have one file_region while holding one or more css
reference counts.  This inconsistency could lead to imbalanced css_get()
and css_put() pair.  If we do css_put one by one (i.g.  hole punch case),
scenario 2 would put one more css reference.  If we do css_put all
together (i.g.  truncate case), scenario 1 will leak one css reference.

The imbalanced css_get() and css_put() pair would result in a non-zero
reference when we try to destroy the hugetlb cgroup.  The hugetlb cgroup
directory is removed __but__ associated resource is not freed.  This might
result in OOM or can not create a new hugetlb cgroup in a busy workload
ultimately.

In order to fix this, we have to make sure that one file_region must hold
exactly one css reference.  So in coalesce_file_region case, we should
release one css reference before coalescence.  Also only put css reference
when the entire file_region is removed.

The last thing to note is that the caller of region_add() will only hold
one reference to h_cg->css for the whole contiguous reservation region. 
But this area might be scattered when there are already some file_regions
reside in it.  As a result, many file_regions may share only one h_cg->css
reference.  In order to ensure that one file_region must hold exactly one
css reference, we should do css_get() for each file_region and release the
reference held by caller when they are done.

[linmiaohe@huawei.com: fix imbalanced css_get and css_put pair for shared mappings]
  Link: https://lkml.kernel.org/r/20210316023002.53921-1-linmiaohe@huawei.com
Link: https://lkml.kernel.org/r/20210301120540.37076-1-linmiaohe@huawei.com
Fixes: 075a61d07a8e ("hugetlb_cgroup: add accounting for shared mappings")
Reported-by: kernel test robot <lkp@intel.com> (auto build test ERROR)
Signed-off-by: Miaohe Lin <linmiaohe@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Cc: Aneesh Kumar K.V <aneesh.kumar@linux.vnet.ibm.com>
Cc: Wanpeng Li <liwp.linux@gmail.com>
Cc: Mina Almasry <almasrymina@google.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/hugetlb_cgroup.h |   15 +++++++++--
 mm/hugetlb.c                   |   41 +++++++++++++++++++++++++++----
 mm/hugetlb_cgroup.c            |   10 ++++++-
 3 files changed, 58 insertions(+), 8 deletions(-)

--- a/include/linux/hugetlb_cgroup.h~hugetlb_cgroup-fix-imbalanced-css_get-and-css_put-pair-for-shared-mappings
+++ a/include/linux/hugetlb_cgroup.h
@@ -113,6 +113,11 @@ static inline bool hugetlb_cgroup_disabl
 	return !cgroup_subsys_enabled(hugetlb_cgrp_subsys);
 }
 
+static inline void hugetlb_cgroup_put_rsvd_cgroup(struct hugetlb_cgroup *h_cg)
+{
+	css_put(&h_cg->css);
+}
+
 extern int hugetlb_cgroup_charge_cgroup(int idx, unsigned long nr_pages,
 					struct hugetlb_cgroup **ptr);
 extern int hugetlb_cgroup_charge_cgroup_rsvd(int idx, unsigned long nr_pages,
@@ -138,7 +143,8 @@ extern void hugetlb_cgroup_uncharge_coun
 
 extern void hugetlb_cgroup_uncharge_file_region(struct resv_map *resv,
 						struct file_region *rg,
-						unsigned long nr_pages);
+						unsigned long nr_pages,
+						bool region_del);
 
 extern void hugetlb_cgroup_file_init(void) __init;
 extern void hugetlb_cgroup_migrate(struct page *oldhpage,
@@ -147,7 +153,8 @@ extern void hugetlb_cgroup_migrate(struc
 #else
 static inline void hugetlb_cgroup_uncharge_file_region(struct resv_map *resv,
 						       struct file_region *rg,
-						       unsigned long nr_pages)
+						       unsigned long nr_pages,
+						       bool region_del)
 {
 }
 
@@ -185,6 +192,10 @@ static inline bool hugetlb_cgroup_disabl
 	return true;
 }
 
+static inline void hugetlb_cgroup_put_rsvd_cgroup(struct hugetlb_cgroup *h_cg)
+{
+}
+
 static inline int hugetlb_cgroup_charge_cgroup(int idx, unsigned long nr_pages,
 					       struct hugetlb_cgroup **ptr)
 {
--- a/mm/hugetlb.c~hugetlb_cgroup-fix-imbalanced-css_get-and-css_put-pair-for-shared-mappings
+++ a/mm/hugetlb.c
@@ -280,6 +280,17 @@ static void record_hugetlb_cgroup_unchar
 		nrg->reservation_counter =
 			&h_cg->rsvd_hugepage[hstate_index(h)];
 		nrg->css = &h_cg->css;
+		/*
+		 * The caller will hold exactly one h_cg->css reference for the
+		 * whole contiguous reservation region. But this area might be
+		 * scattered when there are already some file_regions reside in
+		 * it. As a result, many file_regions may share only one css
+		 * reference. In order to ensure that one file_region must hold
+		 * exactly one h_cg->css reference, we should do css_get for
+		 * each file_region and leave the reference held by caller
+		 * untouched.
+		 */
+		css_get(&h_cg->css);
 		if (!resv->pages_per_hpage)
 			resv->pages_per_hpage = pages_per_huge_page(h);
 		/* pages_per_hpage should be the same for all entries in
@@ -293,6 +304,14 @@ static void record_hugetlb_cgroup_unchar
 #endif
 }
 
+static void put_uncharge_info(struct file_region *rg)
+{
+#ifdef CONFIG_CGROUP_HUGETLB
+	if (rg->css)
+		css_put(rg->css);
+#endif
+}
+
 static bool has_same_uncharge_info(struct file_region *rg,
 				   struct file_region *org)
 {
@@ -316,6 +335,7 @@ static void coalesce_file_region(struct
 		prg->to = rg->to;
 
 		list_del(&rg->link);
+		put_uncharge_info(rg);
 		kfree(rg);
 
 		rg = prg;
@@ -327,6 +347,7 @@ static void coalesce_file_region(struct
 		nrg->from = rg->from;
 
 		list_del(&rg->link);
+		put_uncharge_info(rg);
 		kfree(rg);
 	}
 }
@@ -662,7 +683,7 @@ retry:
 
 			del += t - f;
 			hugetlb_cgroup_uncharge_file_region(
-				resv, rg, t - f);
+				resv, rg, t - f, false);
 
 			/* New entry for end of split region */
 			nrg->from = t;
@@ -683,7 +704,7 @@ retry:
 		if (f <= rg->from && t >= rg->to) { /* Remove entire region */
 			del += rg->to - rg->from;
 			hugetlb_cgroup_uncharge_file_region(resv, rg,
-							    rg->to - rg->from);
+							    rg->to - rg->from, true);
 			list_del(&rg->link);
 			kfree(rg);
 			continue;
@@ -691,13 +712,13 @@ retry:
 
 		if (f <= rg->from) {	/* Trim beginning of region */
 			hugetlb_cgroup_uncharge_file_region(resv, rg,
-							    t - rg->from);
+							    t - rg->from, false);
 
 			del += t - rg->from;
 			rg->from = t;
 		} else {		/* Trim end of region */
 			hugetlb_cgroup_uncharge_file_region(resv, rg,
-							    rg->to - f);
+							    rg->to - f, false);
 
 			del += rg->to - f;
 			rg->to = f;
@@ -5187,6 +5208,10 @@ bool hugetlb_reserve_pages(struct inode
 			 */
 			long rsv_adjust;
 
+			/*
+			 * hugetlb_cgroup_uncharge_cgroup_rsvd() will put the
+			 * reference to h_cg->css. See comment below for detail.
+			 */
 			hugetlb_cgroup_uncharge_cgroup_rsvd(
 				hstate_index(h),
 				(chg - add) * pages_per_huge_page(h), h_cg);
@@ -5194,6 +5219,14 @@ bool hugetlb_reserve_pages(struct inode
 			rsv_adjust = hugepage_subpool_put_pages(spool,
 								chg - add);
 			hugetlb_acct_memory(h, -rsv_adjust);
+		} else if (h_cg) {
+			/*
+			 * The file_regions will hold their own reference to
+			 * h_cg->css. So we should release the reference held
+			 * via hugetlb_cgroup_charge_cgroup_rsvd() when we are
+			 * done.
+			 */
+			hugetlb_cgroup_put_rsvd_cgroup(h_cg);
 		}
 	}
 	return true;
--- a/mm/hugetlb_cgroup.c~hugetlb_cgroup-fix-imbalanced-css_get-and-css_put-pair-for-shared-mappings
+++ a/mm/hugetlb_cgroup.c
@@ -391,7 +391,8 @@ void hugetlb_cgroup_uncharge_counter(str
 
 void hugetlb_cgroup_uncharge_file_region(struct resv_map *resv,
 					 struct file_region *rg,
-					 unsigned long nr_pages)
+					 unsigned long nr_pages,
+					 bool region_del)
 {
 	if (hugetlb_cgroup_disabled() || !resv || !rg || !nr_pages)
 		return;
@@ -400,7 +401,12 @@ void hugetlb_cgroup_uncharge_file_region
 	    !resv->reservation_counter) {
 		page_counter_uncharge(rg->reservation_counter,
 				      nr_pages * resv->pages_per_hpage);
-		css_put(rg->css);
+		/*
+		 * Only do css_put(rg->css) when we delete the entire region
+		 * because one file_region must hold exactly one css reference.
+		 */
+		if (region_del)
+			css_put(rg->css);
 	}
 }
 
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 02/14] kasan: fix per-page tags for non-page_alloc pages
  2021-03-25  4:36 incoming Andrew Morton
  2021-03-25  4:37 ` [patch 01/14] hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 03/14] mm/mmu_notifiers: ensure range_end() is paired with range_start() Andrew Morton
                   ` (11 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, andreyknvl, aryabinin, Branislav.Rankov, catalin.marinas,
	dvyukov, elver, eugenis, glider, kevin.brodsky, linux-mm,
	mm-commits, pcc, stable, torvalds, vincenzo.frascino,
	will.deacon

From: Andrey Konovalov <andreyknvl@google.com>
Subject: kasan: fix per-page tags for non-page_alloc pages

To allow performing tag checks on page_alloc addresses obtained via
page_address(), tag-based KASAN modes store tags for page_alloc
allocations in page->flags.

Currently, the default tag value stored in page->flags is 0x00. 
Therefore, page_address() returns a 0x00ffff...  address for pages that
were not allocated via page_alloc.

This might cause problems.  A particular case we encountered is a conflict
with KFENCE.  If a KFENCE-allocated slab object is being freed via
kfree(page_address(page) + offset), the address passed to kfree() will get
tagged with 0x00 (as slab pages keep the default per-page tags).  This
leads to is_kfence_address() check failing, and a KFENCE object ending up
in normal slab freelist, which causes memory corruptions.

This patch changes the way KASAN stores tag in page-flags: they are now
stored xor'ed with 0xff.  This way, KASAN doesn't need to initialize
per-page flags for every created page, which might be slow.

With this change, page_address() returns natively-tagged (with 0xff)
pointers for pages that didn't have tags set explicitly.

This patch fixes the encountered conflict with KFENCE and prevents more
similar issues that can occur in the future.

Link: https://lkml.kernel.org/r/1a41abb11c51b264511d9e71c303bb16d5cb367b.1615475452.git.andreyknvl@google.com
Fixes: 2813b9c02962 ("kasan, mm, arm64: tag non slab memory allocated via pagealloc")
Signed-off-by: Andrey Konovalov <andreyknvl@google.com>
Reviewed-by: Marco Elver <elver@google.com>
Cc: Catalin Marinas <catalin.marinas@arm.com>
Cc: Will Deacon <will.deacon@arm.com>
Cc: Vincenzo Frascino <vincenzo.frascino@arm.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Andrey Ryabinin <aryabinin@virtuozzo.com>
Cc: Alexander Potapenko <glider@google.com>
Cc: Peter Collingbourne <pcc@google.com>
Cc: Evgenii Stepanov <eugenis@google.com>
Cc: Branislav Rankov <Branislav.Rankov@arm.com>
Cc: Kevin Brodsky <kevin.brodsky@arm.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/mm.h |   18 +++++++++++++++---
 1 file changed, 15 insertions(+), 3 deletions(-)

--- a/include/linux/mm.h~kasan-fix-per-page-tags-for-non-page_alloc-pages
+++ a/include/linux/mm.h
@@ -1461,16 +1461,28 @@ static inline bool cpupid_match_pid(stru
 
 #if defined(CONFIG_KASAN_SW_TAGS) || defined(CONFIG_KASAN_HW_TAGS)
 
+/*
+ * KASAN per-page tags are stored xor'ed with 0xff. This allows to avoid
+ * setting tags for all pages to native kernel tag value 0xff, as the default
+ * value 0x00 maps to 0xff.
+ */
+
 static inline u8 page_kasan_tag(const struct page *page)
 {
-	if (kasan_enabled())
-		return (page->flags >> KASAN_TAG_PGSHIFT) & KASAN_TAG_MASK;
-	return 0xff;
+	u8 tag = 0xff;
+
+	if (kasan_enabled()) {
+		tag = (page->flags >> KASAN_TAG_PGSHIFT) & KASAN_TAG_MASK;
+		tag ^= 0xff;
+	}
+
+	return tag;
 }
 
 static inline void page_kasan_tag_set(struct page *page, u8 tag)
 {
 	if (kasan_enabled()) {
+		tag ^= 0xff;
 		page->flags &= ~(KASAN_TAG_MASK << KASAN_TAG_PGSHIFT);
 		page->flags |= (tag & KASAN_TAG_MASK) << KASAN_TAG_PGSHIFT;
 	}
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 03/14] mm/mmu_notifiers: ensure range_end() is paired with range_start()
  2021-03-25  4:36 incoming Andrew Morton
  2021-03-25  4:37 ` [patch 01/14] hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings Andrew Morton
  2021-03-25  4:37 ` [patch 02/14] kasan: fix per-page tags for non-page_alloc pages Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 04/14] selftests/vm: fix out-of-tree build Andrew Morton
                   ` (10 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: aarcange, akpm, bgardon, dimitri.sivanich, hannes, jgg, jgg,
	jglisse, linux-mm, mhocko, mm-commits, rientjes, seanjc,
	torvalds

From: Sean Christopherson <seanjc@google.com>
Subject: mm/mmu_notifiers: ensure range_end() is paired with range_start()

If one or more notifiers fails .invalidate_range_start(), invoke
.invalidate_range_end() for "all" notifiers.  If there are multiple
notifiers, those that did not fail are expecting _start() and _end() to be
paired, e.g.  KVM's mmu_notifier_count would become imbalanced.  Disallow
notifiers that can fail _start() from implementing _end() so that it's
unnecessary to either track which notifiers rejected _start(), or had
already succeeded prior to a failed _start().

Note, the existing behavior of calling _start() on all notifiers even
after a previous notifier failed _start() was an unintented "feature". 
Make it canon now that the behavior is depended on for correctness.

As of today, the bug is likely benign:

  1. The only caller of the non-blocking notifier is OOM kill.
  2. The only notifiers that can fail _start() are the i915 and Nouveau
     drivers.
  3. The only notifiers that utilize _end() are the SGI UV GRU driver
     and KVM.
  4. The GRU driver will never coincide with the i195/Nouveau drivers.
  5. An imbalanced kvm->mmu_notifier_count only causes soft lockup in the
     _guest_, and the guest is already doomed due to being an OOM victim.

Fix the bug now to play nice with future usage, e.g.  KVM has a potential
use case for blocking memslot updates in KVM while an invalidation is
in-progress, and failure to unblock would result in said updates being
blocked indefinitely and hanging.

Found by inspection.  Verified by adding a second notifier in KVM that
periodically returns -EAGAIN on non-blockable ranges, triggering OOM, and
observing that KVM exits with an elevated notifier count.

Link: https://lkml.kernel.org/r/20210311180057.1582638-1-seanjc@google.com
Fixes: 93065ac753e4 ("mm, oom: distinguish blockable mode for mmu notifiers")
Signed-off-by: Sean Christopherson <seanjc@google.com>
Suggested-by: Jason Gunthorpe <jgg@ziepe.ca>
Reviewed-by: Jason Gunthorpe <jgg@nvidia.com>
Cc: David Rientjes <rientjes@google.com>
Cc: Ben Gardon <bgardon@google.com>
Cc: Michal Hocko <mhocko@suse.com>
Cc: "Jérôme Glisse" <jglisse@redhat.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Cc: Johannes Weiner <hannes@cmpxchg.org>
Cc: Dimitri Sivanich <dimitri.sivanich@hpe.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/mmu_notifier.h |   10 +++++-----
 mm/mmu_notifier.c            |   23 +++++++++++++++++++++++
 2 files changed, 28 insertions(+), 5 deletions(-)

--- a/include/linux/mmu_notifier.h~mm-mmu_notifiers-esnure-range_end-is-paired-with-range_start
+++ a/include/linux/mmu_notifier.h
@@ -169,11 +169,11 @@ struct mmu_notifier_ops {
 	 * the last refcount is dropped.
 	 *
 	 * If blockable argument is set to false then the callback cannot
-	 * sleep and has to return with -EAGAIN. 0 should be returned
-	 * otherwise. Please note that if invalidate_range_start approves
-	 * a non-blocking behavior then the same applies to
-	 * invalidate_range_end.
-	 *
+	 * sleep and has to return with -EAGAIN if sleeping would be required.
+	 * 0 should be returned otherwise. Please note that notifiers that can
+	 * fail invalidate_range_start are not allowed to implement
+	 * invalidate_range_end, as there is no mechanism for informing the
+	 * notifier that its start failed.
 	 */
 	int (*invalidate_range_start)(struct mmu_notifier *subscription,
 				      const struct mmu_notifier_range *range);
--- a/mm/mmu_notifier.c~mm-mmu_notifiers-esnure-range_end-is-paired-with-range_start
+++ a/mm/mmu_notifier.c
@@ -501,10 +501,33 @@ static int mn_hlist_invalidate_range_sta
 						"");
 				WARN_ON(mmu_notifier_range_blockable(range) ||
 					_ret != -EAGAIN);
+				/*
+				 * We call all the notifiers on any EAGAIN,
+				 * there is no way for a notifier to know if
+				 * its start method failed, thus a start that
+				 * does EAGAIN can't also do end.
+				 */
+				WARN_ON(ops->invalidate_range_end);
 				ret = _ret;
 			}
 		}
 	}
+
+	if (ret) {
+		/*
+		 * Must be non-blocking to get here.  If there are multiple
+		 * notifiers and one or more failed start, any that succeeded
+		 * start are expecting their end to be called.  Do so now.
+		 */
+		hlist_for_each_entry_rcu(subscription, &subscriptions->list,
+					 hlist, srcu_read_lock_held(&srcu)) {
+			if (!subscription->ops->invalidate_range_end)
+				continue;
+
+			subscription->ops->invalidate_range_end(subscription,
+								range);
+		}
+	}
 	srcu_read_unlock(&srcu, id);
 
 	return ret;
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 04/14] selftests/vm: fix out-of-tree build
  2021-03-25  4:36 incoming Andrew Morton
                   ` (2 preceding siblings ...)
  2021-03-25  4:37 ` [patch 03/14] mm/mmu_notifiers: ensure range_end() is paired with range_start() Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 05/14] z3fold: prevent reclaim/free race for headless pages Andrew Morton
                   ` (9 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, linux-mm, lkp, mm-commits, rong.a.chen, shuah, torvalds

From: Rong Chen <rong.a.chen@intel.com>
Subject: selftests/vm: fix out-of-tree build

When building out-of-tree, attempting to make target from $(OUTPUT) directory:

  make[1]: *** No rule to make target '$(OUTPUT)/protection_keys.c', needed by '$(OUTPUT)/protection_keys_32'.

Link: https://lkml.kernel.org/r/20210315094700.522753-1-rong.a.chen@intel.com
Signed-off-by: Rong Chen <rong.a.chen@intel.com>
Reported-by: kernel test robot <lkp@intel.com>
Cc: Shuah Khan <shuah@kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 tools/testing/selftests/vm/Makefile |    4 ++--
 1 file changed, 2 insertions(+), 2 deletions(-)

--- a/tools/testing/selftests/vm/Makefile~selftests-vm-fix-out-of-tree-build
+++ a/tools/testing/selftests/vm/Makefile
@@ -101,7 +101,7 @@ endef
 ifeq ($(CAN_BUILD_I386),1)
 $(BINARIES_32): CFLAGS += -m32
 $(BINARIES_32): LDLIBS += -lrt -ldl -lm
-$(BINARIES_32): %_32: %.c
+$(BINARIES_32): $(OUTPUT)/%_32: %.c
 	$(CC) $(CFLAGS) $(EXTRA_CFLAGS) $(notdir $^) $(LDLIBS) -o $@
 $(foreach t,$(TARGETS),$(eval $(call gen-target-rule-32,$(t))))
 endif
@@ -109,7 +109,7 @@ endif
 ifeq ($(CAN_BUILD_X86_64),1)
 $(BINARIES_64): CFLAGS += -m64
 $(BINARIES_64): LDLIBS += -lrt -ldl
-$(BINARIES_64): %_64: %.c
+$(BINARIES_64): $(OUTPUT)/%_64: %.c
 	$(CC) $(CFLAGS) $(EXTRA_CFLAGS) $(notdir $^) $(LDLIBS) -o $@
 $(foreach t,$(TARGETS),$(eval $(call gen-target-rule-64,$(t))))
 endif
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 05/14] z3fold: prevent reclaim/free race for headless pages
  2021-03-25  4:36 incoming Andrew Morton
                   ` (3 preceding siblings ...)
  2021-03-25  4:37 ` [patch 04/14] selftests/vm: fix out-of-tree build Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 06/14] squashfs: fix inode lookup sanity checks Andrew Morton
                   ` (8 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, ks77sj, linux-mm, mm-commits, snild, stable, tommyhebb,
	torvalds, vitaly.wool

From: Thomas Hebb <tommyhebb@gmail.com>
Subject: z3fold: prevent reclaim/free race for headless pages

commit ca0246bb97c2 ("z3fold: fix possible reclaim races") introduced the
PAGE_CLAIMED flag "to avoid racing on a z3fold 'headless' page release."
By atomically testing and setting the bit in each of z3fold_free() and
z3fold_reclaim_page(), a double-free was avoided.

However, commit dcf5aedb24f8 ("z3fold: stricter locking and more careful
reclaim") appears to have unintentionally broken this behavior by moving
the PAGE_CLAIMED check in z3fold_reclaim_page() to after the page lock
gets taken, which only happens for non-headless pages.  For headless
pages, the check is now skipped entirely and races can occur again.

I have observed such a race on my system:

    page:00000000ffbd76b7 refcount:0 mapcount:0 mapping:0000000000000000 index:0x0 pfn:0x165316
    flags: 0x2ffff0000000000()
    raw: 02ffff0000000000 ffffea0004535f48 ffff8881d553a170 0000000000000000
    raw: 0000000000000000 0000000000000011 00000000ffffffff 0000000000000000
    page dumped because: VM_BUG_ON_PAGE(page_ref_count(page) == 0)
    ------------[ cut here ]------------
    kernel BUG at include/linux/mm.h:707!
    invalid opcode: 0000 [#1] PREEMPT SMP KASAN PTI
    CPU: 2 PID: 291928 Comm: kworker/2:0 Tainted: G    B             5.10.7-arch1-1-kasan #1
    Hardware name: Gigabyte Technology Co., Ltd. H97N-WIFI/H97N-WIFI, BIOS F9b 03/03/2016
    Workqueue: zswap-shrink shrink_worker
    RIP: 0010:__free_pages+0x10a/0x130
    Code: c1 e7 06 48 01 ef 45 85 e4 74 d1 44 89 e6 31 d2 41 83 ec 01 e8 e7 b0 ff ff eb da 48 c7 c6 e0 32 91 88 48 89 ef e8 a6 89 f8 ff <0f> 0b 4c 89 e7 e8 fc 79 07 00 e9 33 ff ff ff 48 89 ef e8 ff 79 07
    RSP: 0000:ffff88819a2ffb98 EFLAGS: 00010296
    RAX: 0000000000000000 RBX: ffffea000594c5a8 RCX: 0000000000000000
    RDX: 1ffffd4000b298b7 RSI: 0000000000000000 RDI: ffffea000594c5b8
    RBP: ffffea000594c580 R08: 000000000000003e R09: ffff8881d5520bbb
    R10: ffffed103aaa4177 R11: 0000000000000001 R12: ffffea000594c5b4
    R13: 0000000000000000 R14: ffff888165316000 R15: ffffea000594c588
    FS:  0000000000000000(0000) GS:ffff8881d5500000(0000) knlGS:0000000000000000
    CS:  0010 DS: 0000 ES: 0000 CR0: 0000000080050033
    CR2: 00007f7c8c3654d8 CR3: 0000000103f42004 CR4: 00000000001706e0
    Call Trace:
     z3fold_zpool_shrink+0x9b6/0x1240
     ? sugov_update_single+0x357/0x990
     ? sched_clock+0x5/0x10
     ? sched_clock_cpu+0x18/0x180
     ? z3fold_zpool_map+0x490/0x490
     ? _raw_spin_lock_irq+0x88/0xe0
     shrink_worker+0x35/0x90
     process_one_work+0x70c/0x1210
     ? pwq_dec_nr_in_flight+0x15b/0x2a0
     worker_thread+0x539/0x1200
     ? __kthread_parkme+0x73/0x120
     ? rescuer_thread+0x1000/0x1000
     kthread+0x330/0x400
     ? __kthread_bind_mask+0x90/0x90
     ret_from_fork+0x22/0x30
    Modules linked in: rfcomm ebtable_filter ebtables ip6table_filter ip6_tables iptable_filter ccm algif_aead des_generic libdes ecb algif_skcipher cmac bnep md4 algif_hash af_alg vfat fat intel_rapl_msr intel_rapl_common x86_pkg_temp_thermal intel_powerclamp coretemp kvm_intel iwlmvm hid_logitech_hidpp kvm at24 mac80211 snd_hda_codec_realtek iTCO_wdt snd_hda_codec_generic intel_pmc_bxt snd_hda_codec_hdmi ledtrig_audio iTCO_vendor_support mei_wdt mei_hdcp snd_hda_intel snd_intel_dspcfg libarc4 soundwire_intel irqbypass iwlwifi soundwire_generic_allocation rapl soundwire_cadence intel_cstate snd_hda_codec intel_uncore btusb joydev mousedev snd_usb_audio pcspkr btrtl uvcvideo nouveau btbcm i2c_i801 btintel snd_hda_core videobuf2_vmalloc i2c_smbus snd_usbmidi_lib videobuf2_memops bluetooth snd_hwdep soundwire_bus snd_soc_rt5640 videobuf2_v4l2 cfg80211 snd_soc_rl6231 videobuf2_common snd_rawmidi lpc_ich alx videodev mdio snd_seq_device snd_soc_core mc ecdh_generic mxm_wmi mei_me
     hid_logitech_dj wmi snd_compress e1000e ac97_bus mei ttm rfkill snd_pcm_dmaengine ecc snd_pcm snd_timer snd soundcore mac_hid acpi_pad pkcs8_key_parser it87 hwmon_vid crypto_user fuse ip_tables x_tables ext4 crc32c_generic crc16 mbcache jbd2 dm_crypt cbc encrypted_keys trusted tpm rng_core usbhid dm_mod crct10dif_pclmul crc32_pclmul crc32c_intel ghash_clmulni_intel aesni_intel crypto_simd cryptd glue_helper xhci_pci xhci_pci_renesas i915 video intel_gtt i2c_algo_bit drm_kms_helper syscopyarea sysfillrect sysimgblt fb_sys_fops cec drm agpgart
    ---[ end trace 126d646fc3dc0ad8 ]---

To fix the issue, re-add the earlier test and set in the case where we
have a headless page.

Link: https://lkml.kernel.org/r/c8106dbe6d8390b290cd1d7f873a2942e805349e.1615452048.git.tommyhebb@gmail.com
Fixes: dcf5aedb24f8 ("z3fold: stricter locking and more careful reclaim")
Signed-off-by: Thomas Hebb <tommyhebb@gmail.com>
Reviewed-by: Vitaly Wool <vitaly.wool@konsulko.com>
Cc: Jongseok Kim <ks77sj@gmail.com>
Cc: Snild Dolkow <snild@sony.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/z3fold.c |   16 +++++++++++++++-
 1 file changed, 15 insertions(+), 1 deletion(-)

--- a/mm/z3fold.c~z3fold-prevent-reclaim-free-race-for-headless-pages
+++ a/mm/z3fold.c
@@ -1346,8 +1346,22 @@ static int z3fold_reclaim_page(struct z3
 			page = list_entry(pos, struct page, lru);
 
 			zhdr = page_address(page);
-			if (test_bit(PAGE_HEADLESS, &page->private))
+			if (test_bit(PAGE_HEADLESS, &page->private)) {
+				/*
+				 * For non-headless pages, we wait to do this
+				 * until we have the page lock to avoid racing
+				 * with __z3fold_alloc(). Headless pages don't
+				 * have a lock (and __z3fold_alloc() will never
+				 * see them), but we still need to test and set
+				 * PAGE_CLAIMED to avoid racing with
+				 * z3fold_free(), so just do it now before
+				 * leaving the loop.
+				 */
+				if (test_and_set_bit(PAGE_CLAIMED, &page->private))
+					continue;
+
 				break;
+			}
 
 			if (kref_get_unless_zero(&zhdr->refcount) == 0) {
 				zhdr = NULL;
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 06/14] squashfs: fix inode lookup sanity checks
  2021-03-25  4:36 incoming Andrew Morton
                   ` (4 preceding siblings ...)
  2021-03-25  4:37 ` [patch 05/14] z3fold: prevent reclaim/free race for headless pages Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 07/14] squashfs: fix xattr id and id " Andrew Morton
                   ` (7 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, linux-mm, mm-commits, phillip, sean, stable, torvalds

From: Sean Nyekjaer <sean@geanix.com>
Subject: squashfs: fix inode lookup sanity checks

When mouting a squashfs image created without inode compression it fails
with: "unable to read inode lookup table"

It turns out that the BLOCK_OFFSET is missing when checking the
SQUASHFS_METADATA_SIZE agaist the actual size.

Link: https://lkml.kernel.org/r/20210226092903.1473545-1-sean@geanix.com
Fixes: eabac19e40c0 ("squashfs: add more sanity checks in inode lookup")
Signed-off-by: Sean Nyekjaer <sean@geanix.com>
Acked-by: Phillip Lougher <phillip@squashfs.org.uk>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/squashfs/export.c      |    8 ++++++--
 fs/squashfs/squashfs_fs.h |    1 +
 2 files changed, 7 insertions(+), 2 deletions(-)

--- a/fs/squashfs/export.c~squashfs-fix-inode-lookup-sanity-checks
+++ a/fs/squashfs/export.c
@@ -152,14 +152,18 @@ __le64 *squashfs_read_inode_lookup_table
 		start = le64_to_cpu(table[n]);
 		end = le64_to_cpu(table[n + 1]);
 
-		if (start >= end || (end - start) > SQUASHFS_METADATA_SIZE) {
+		if (start >= end
+		    || (end - start) >
+		    (SQUASHFS_METADATA_SIZE + SQUASHFS_BLOCK_OFFSET)) {
 			kfree(table);
 			return ERR_PTR(-EINVAL);
 		}
 	}
 
 	start = le64_to_cpu(table[indexes - 1]);
-	if (start >= lookup_table_start || (lookup_table_start - start) > SQUASHFS_METADATA_SIZE) {
+	if (start >= lookup_table_start ||
+	    (lookup_table_start - start) >
+	    (SQUASHFS_METADATA_SIZE + SQUASHFS_BLOCK_OFFSET)) {
 		kfree(table);
 		return ERR_PTR(-EINVAL);
 	}
--- a/fs/squashfs/squashfs_fs.h~squashfs-fix-inode-lookup-sanity-checks
+++ a/fs/squashfs/squashfs_fs.h
@@ -17,6 +17,7 @@
 
 /* size of metadata (inode and directory) blocks */
 #define SQUASHFS_METADATA_SIZE		8192
+#define SQUASHFS_BLOCK_OFFSET		2
 
 /* default size of block device I/O */
 #ifdef CONFIG_SQUASHFS_4K_DEVBLK_SIZE
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 07/14] squashfs: fix xattr id and id lookup sanity checks
  2021-03-25  4:36 incoming Andrew Morton
                   ` (5 preceding siblings ...)
  2021-03-25  4:37 ` [patch 06/14] squashfs: fix inode lookup sanity checks Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 08/14] ia64: mca: allocate early mca with GFP_ATOMIC Andrew Morton
                   ` (6 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, linux-mm, mm-commits, phillip, sean, stable, torvalds

From: Phillip Lougher <phillip@squashfs.org.uk>
Subject: squashfs: fix xattr id and id lookup sanity checks

The checks for maximum metadata block size is missing
SQUASHFS_BLOCK_OFFSET (the two byte length count).

Link: https://lkml.kernel.org/r/2069685113.2081245.1614583677427@webmail.123-reg.co.uk
Fixes: f37aa4c7366e23f ("squashfs: add more sanity checks in id lookup")
Signed-off-by: Phillip Lougher <phillip@squashfs.org.uk>
Cc: Sean Nyekjaer <sean@geanix.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/squashfs/id.c       |    6 ++++--
 fs/squashfs/xattr_id.c |    6 ++++--
 2 files changed, 8 insertions(+), 4 deletions(-)

--- a/fs/squashfs/id.c~squashfs-fix-xattr-id-and-id-lookup-sanity-checks
+++ a/fs/squashfs/id.c
@@ -97,14 +97,16 @@ __le64 *squashfs_read_id_index_table(str
 		start = le64_to_cpu(table[n]);
 		end = le64_to_cpu(table[n + 1]);
 
-		if (start >= end || (end - start) > SQUASHFS_METADATA_SIZE) {
+		if (start >= end || (end - start) >
+				(SQUASHFS_METADATA_SIZE + SQUASHFS_BLOCK_OFFSET)) {
 			kfree(table);
 			return ERR_PTR(-EINVAL);
 		}
 	}
 
 	start = le64_to_cpu(table[indexes - 1]);
-	if (start >= id_table_start || (id_table_start - start) > SQUASHFS_METADATA_SIZE) {
+	if (start >= id_table_start || (id_table_start - start) >
+				(SQUASHFS_METADATA_SIZE + SQUASHFS_BLOCK_OFFSET)) {
 		kfree(table);
 		return ERR_PTR(-EINVAL);
 	}
--- a/fs/squashfs/xattr_id.c~squashfs-fix-xattr-id-and-id-lookup-sanity-checks
+++ a/fs/squashfs/xattr_id.c
@@ -109,14 +109,16 @@ __le64 *squashfs_read_xattr_id_table(str
 		start = le64_to_cpu(table[n]);
 		end = le64_to_cpu(table[n + 1]);
 
-		if (start >= end || (end - start) > SQUASHFS_METADATA_SIZE) {
+		if (start >= end || (end - start) >
+				(SQUASHFS_METADATA_SIZE + SQUASHFS_BLOCK_OFFSET)) {
 			kfree(table);
 			return ERR_PTR(-EINVAL);
 		}
 	}
 
 	start = le64_to_cpu(table[indexes - 1]);
-	if (start >= table_start || (table_start - start) > SQUASHFS_METADATA_SIZE) {
+	if (start >= table_start || (table_start - start) >
+				(SQUASHFS_METADATA_SIZE + SQUASHFS_BLOCK_OFFSET)) {
 		kfree(table);
 		return ERR_PTR(-EINVAL);
 	}
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 08/14] ia64: mca: allocate early mca with GFP_ATOMIC
  2021-03-25  4:36 incoming Andrew Morton
                   ` (6 preceding siblings ...)
  2021-03-25  4:37 ` [patch 07/14] squashfs: fix xattr id and id " Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 09/14] ia64: fix format strings for err_inject Andrew Morton
                   ` (5 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, linux-mm, mm-commits, slyfox, torvalds

From: Sergei Trofimovich <slyfox@gentoo.org>
Subject: ia64: mca: allocate early mca with GFP_ATOMIC

The sleep warning happens at early boot right at secondary CPU activation
bootup:

    smp: Bringing up secondary CPUs ...
    BUG: sleeping function called from invalid context at mm/page_alloc.c:4942
    in_atomic(): 0, irqs_disabled(): 1, non_block: 0, pid: 0, name: swapper/1
    CPU: 1 PID: 0 Comm: swapper/1 Not tainted 5.12.0-rc2-00007-g79e228d0b611-dirty #99

    Call Trace:
     [<a000000100014d10>] show_stack+0x90/0xc0
     [<a000000101111d90>] dump_stack+0x150/0x1c0
     [<a0000001000cbec0>] ___might_sleep+0x1c0/0x2a0
     [<a0000001000cc040>] __might_sleep+0xa0/0x160
     [<a000000100399960>] __alloc_pages_nodemask+0x1a0/0x600
     [<a0000001003b71b0>] alloc_page_interleave+0x30/0x1c0
     [<a0000001003b9b60>] alloc_pages_current+0x2c0/0x340
     [<a00000010038c270>] __get_free_pages+0x30/0xa0
     [<a000000100044730>] ia64_mca_cpu_init+0x2d0/0x3a0
     [<a000000100023430>] cpu_init+0x8b0/0x1440
     [<a000000100054680>] start_secondary+0x60/0x700
     [<a00000010111e1d0>] start_ap+0x750/0x780
    Fixed BSP b0 value from CPU 1

As I understand interrupts are not enabled yet and system has a lot of
memory.  There is little chance to sleep and switch to GFP_ATOMIC should
be a no-op.

Link: https://lkml.kernel.org/r/20210315085045.204414-1-slyfox@gentoo.org
Signed-off-by: Sergei Trofimovich <slyfox@gentoo.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/ia64/kernel/mca.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/arch/ia64/kernel/mca.c~ia64-mca-allocate-early-mca-with-gfp_atomic
+++ a/arch/ia64/kernel/mca.c
@@ -1824,7 +1824,7 @@ ia64_mca_cpu_init(void *cpu_data)
 			data = mca_bootmem();
 			first_time = 0;
 		} else
-			data = (void *)__get_free_pages(GFP_KERNEL,
+			data = (void *)__get_free_pages(GFP_ATOMIC,
 							get_order(sz));
 		if (!data)
 			panic("Could not allocate MCA memory for cpu %d\n",
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 09/14] ia64: fix format strings for err_inject
  2021-03-25  4:36 incoming Andrew Morton
                   ` (7 preceding siblings ...)
  2021-03-25  4:37 ` [patch 08/14] ia64: mca: allocate early mca with GFP_ATOMIC Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 10/14] gcov: fix clang-11+ support Andrew Morton
                   ` (4 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, linux-mm, mm-commits, slyfox, torvalds

From: Sergei Trofimovich <slyfox@gentoo.org>
Subject: ia64: fix format strings for err_inject

Fix warning with %lx / u64 mismatch:

  arch/ia64/kernel/err_inject.c: In function 'show_resources':
  arch/ia64/kernel/err_inject.c:62:22: warning:
    format '%lx' expects argument of type 'long unsigned int',
    but argument 3 has type 'u64' {aka 'long long unsigned int'}
     62 |  return sprintf(buf, "%lx
", name[cpu]);   \
        |                      ^~~~~~~

Link: https://lkml.kernel.org/r/20210313104312.1548232-1-slyfox@gentoo.org
Signed-off-by: Sergei Trofimovich <slyfox@gentoo.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/ia64/kernel/err_inject.c |   22 +++++++++++-----------
 1 file changed, 11 insertions(+), 11 deletions(-)

--- a/arch/ia64/kernel/err_inject.c~ia64-fix-format-strings-for-err_inject
+++ a/arch/ia64/kernel/err_inject.c
@@ -59,7 +59,7 @@ show_##name(struct device *dev, struct d
 		char *buf)						\
 {									\
 	u32 cpu=dev->id;						\
-	return sprintf(buf, "%lx\n", name[cpu]);			\
+	return sprintf(buf, "%llx\n", name[cpu]);			\
 }
 
 #define store(name)							\
@@ -86,9 +86,9 @@ store_call_start(struct device *dev, str
 
 #ifdef ERR_INJ_DEBUG
 	printk(KERN_DEBUG "pal_mc_err_inject for cpu%d:\n", cpu);
-	printk(KERN_DEBUG "err_type_info=%lx,\n", err_type_info[cpu]);
-	printk(KERN_DEBUG "err_struct_info=%lx,\n", err_struct_info[cpu]);
-	printk(KERN_DEBUG "err_data_buffer=%lx, %lx, %lx.\n",
+	printk(KERN_DEBUG "err_type_info=%llx,\n", err_type_info[cpu]);
+	printk(KERN_DEBUG "err_struct_info=%llx,\n", err_struct_info[cpu]);
+	printk(KERN_DEBUG "err_data_buffer=%llx, %llx, %llx.\n",
 			  err_data_buffer[cpu].data1,
 			  err_data_buffer[cpu].data2,
 			  err_data_buffer[cpu].data3);
@@ -117,8 +117,8 @@ store_call_start(struct device *dev, str
 
 #ifdef ERR_INJ_DEBUG
 	printk(KERN_DEBUG "Returns: status=%d,\n", (int)status[cpu]);
-	printk(KERN_DEBUG "capabilities=%lx,\n", capabilities[cpu]);
-	printk(KERN_DEBUG "resources=%lx\n", resources[cpu]);
+	printk(KERN_DEBUG "capabilities=%llx,\n", capabilities[cpu]);
+	printk(KERN_DEBUG "resources=%llx\n", resources[cpu]);
 #endif
 	return size;
 }
@@ -131,7 +131,7 @@ show_virtual_to_phys(struct device *dev,
 			char *buf)
 {
 	unsigned int cpu=dev->id;
-	return sprintf(buf, "%lx\n", phys_addr[cpu]);
+	return sprintf(buf, "%llx\n", phys_addr[cpu]);
 }
 
 static ssize_t
@@ -145,7 +145,7 @@ store_virtual_to_phys(struct device *dev
 	ret = get_user_pages_fast(virt_addr, 1, FOLL_WRITE, NULL);
 	if (ret<=0) {
 #ifdef ERR_INJ_DEBUG
-		printk("Virtual address %lx is not existing.\n",virt_addr);
+		printk("Virtual address %llx is not existing.\n", virt_addr);
 #endif
 		return -EINVAL;
 	}
@@ -163,7 +163,7 @@ show_err_data_buffer(struct device *dev,
 {
 	unsigned int cpu=dev->id;
 
-	return sprintf(buf, "%lx, %lx, %lx\n",
+	return sprintf(buf, "%llx, %llx, %llx\n",
 			err_data_buffer[cpu].data1,
 			err_data_buffer[cpu].data2,
 			err_data_buffer[cpu].data3);
@@ -178,13 +178,13 @@ store_err_data_buffer(struct device *dev
 	int ret;
 
 #ifdef ERR_INJ_DEBUG
-	printk("write err_data_buffer=[%lx,%lx,%lx] on cpu%d\n",
+	printk("write err_data_buffer=[%llx,%llx,%llx] on cpu%d\n",
 		 err_data_buffer[cpu].data1,
 		 err_data_buffer[cpu].data2,
 		 err_data_buffer[cpu].data3,
 		 cpu);
 #endif
-	ret=sscanf(buf, "%lx, %lx, %lx",
+	ret = sscanf(buf, "%llx, %llx, %llx",
 			&err_data_buffer[cpu].data1,
 			&err_data_buffer[cpu].data2,
 			&err_data_buffer[cpu].data3);
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 10/14] gcov: fix clang-11+ support
  2021-03-25  4:36 incoming Andrew Morton
                   ` (8 preceding siblings ...)
  2021-03-25  4:37 ` [patch 09/14] ia64: fix format strings for err_inject Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 11/14] kfence: make compatible with kmemleak Andrew Morton
                   ` (3 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, linux-mm, maskray, mm-commits, nathan, ndesaulniers,
	oberpar, psodagud, stable, torvalds

From: Nick Desaulniers <ndesaulniers@google.com>
Subject: gcov: fix clang-11+ support

LLVM changed the expected function signatures for llvm_gcda_start_file()
and llvm_gcda_emit_function() in the clang-11 release.  Users of clang-11
or newer may have noticed their kernels failing to boot due to a panic
when enabling CONFIG_GCOV_KERNEL=y +CONFIG_GCOV_PROFILE_ALL=y.  Fix up the
function signatures so calling these functions doesn't panic the kernel.

Link: https://reviews.llvm.org/rGcdd683b516d147925212724b09ec6fb792a40041
Link: https://reviews.llvm.org/rG13a633b438b6500ecad9e4f936ebadf3411d0f44
Link: https://lkml.kernel.org/r/20210312224132.3413602-2-ndesaulniers@google.com
Signed-off-by: Nick Desaulniers <ndesaulniers@google.com>
Reported-by: Prasad Sodagudi <psodagud@quicinc.com>
Suggested-by: Nathan Chancellor <nathan@kernel.org>
Reviewed-by: Fangrui Song <maskray@google.com>
Tested-by: Nathan Chancellor <nathan@kernel.org>
Acked-by: Peter Oberparleiter <oberpar@linux.ibm.com>
Reviewed-by: Nathan Chancellor <nathan@kernel.org>
Cc: <stable@vger.kernel.org>	[5.4+]
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 kernel/gcov/clang.c |   69 ++++++++++++++++++++++++++++++++++++++++++
 1 file changed, 69 insertions(+)

--- a/kernel/gcov/clang.c~gcov-fix-clang-11-support
+++ a/kernel/gcov/clang.c
@@ -75,7 +75,9 @@ struct gcov_fn_info {
 
 	u32 num_counters;
 	u64 *counters;
+#if CONFIG_CLANG_VERSION < 110000
 	const char *function_name;
+#endif
 };
 
 static struct gcov_info *current_info;
@@ -105,6 +107,7 @@ void llvm_gcov_init(llvm_gcov_callback w
 }
 EXPORT_SYMBOL(llvm_gcov_init);
 
+#if CONFIG_CLANG_VERSION < 110000
 void llvm_gcda_start_file(const char *orig_filename, const char version[4],
 		u32 checksum)
 {
@@ -113,7 +116,17 @@ void llvm_gcda_start_file(const char *or
 	current_info->checksum = checksum;
 }
 EXPORT_SYMBOL(llvm_gcda_start_file);
+#else
+void llvm_gcda_start_file(const char *orig_filename, u32 version, u32 checksum)
+{
+	current_info->filename = orig_filename;
+	current_info->version = version;
+	current_info->checksum = checksum;
+}
+EXPORT_SYMBOL(llvm_gcda_start_file);
+#endif
 
+#if CONFIG_CLANG_VERSION < 110000
 void llvm_gcda_emit_function(u32 ident, const char *function_name,
 		u32 func_checksum, u8 use_extra_checksum, u32 cfg_checksum)
 {
@@ -133,6 +146,24 @@ void llvm_gcda_emit_function(u32 ident,
 	list_add_tail(&info->head, &current_info->functions);
 }
 EXPORT_SYMBOL(llvm_gcda_emit_function);
+#else
+void llvm_gcda_emit_function(u32 ident, u32 func_checksum,
+		u8 use_extra_checksum, u32 cfg_checksum)
+{
+	struct gcov_fn_info *info = kzalloc(sizeof(*info), GFP_KERNEL);
+
+	if (!info)
+		return;
+
+	INIT_LIST_HEAD(&info->head);
+	info->ident = ident;
+	info->checksum = func_checksum;
+	info->use_extra_checksum = use_extra_checksum;
+	info->cfg_checksum = cfg_checksum;
+	list_add_tail(&info->head, &current_info->functions);
+}
+EXPORT_SYMBOL(llvm_gcda_emit_function);
+#endif
 
 void llvm_gcda_emit_arcs(u32 num_counters, u64 *counters)
 {
@@ -295,6 +326,7 @@ void gcov_info_add(struct gcov_info *dst
 	}
 }
 
+#if CONFIG_CLANG_VERSION < 110000
 static struct gcov_fn_info *gcov_fn_info_dup(struct gcov_fn_info *fn)
 {
 	size_t cv_size; /* counter values size */
@@ -322,6 +354,28 @@ err_name:
 	kfree(fn_dup);
 	return NULL;
 }
+#else
+static struct gcov_fn_info *gcov_fn_info_dup(struct gcov_fn_info *fn)
+{
+	size_t cv_size; /* counter values size */
+	struct gcov_fn_info *fn_dup = kmemdup(fn, sizeof(*fn),
+			GFP_KERNEL);
+	if (!fn_dup)
+		return NULL;
+	INIT_LIST_HEAD(&fn_dup->head);
+
+	cv_size = fn->num_counters * sizeof(fn->counters[0]);
+	fn_dup->counters = vmalloc(cv_size);
+	if (!fn_dup->counters) {
+		kfree(fn_dup);
+		return NULL;
+	}
+
+	memcpy(fn_dup->counters, fn->counters, cv_size);
+
+	return fn_dup;
+}
+#endif
 
 /**
  * gcov_info_dup - duplicate profiling data set
@@ -362,6 +416,7 @@ err:
  * gcov_info_free - release memory for profiling data set duplicate
  * @info: profiling data set duplicate to free
  */
+#if CONFIG_CLANG_VERSION < 110000
 void gcov_info_free(struct gcov_info *info)
 {
 	struct gcov_fn_info *fn, *tmp;
@@ -375,6 +430,20 @@ void gcov_info_free(struct gcov_info *in
 	kfree(info->filename);
 	kfree(info);
 }
+#else
+void gcov_info_free(struct gcov_info *info)
+{
+	struct gcov_fn_info *fn, *tmp;
+
+	list_for_each_entry_safe(fn, tmp, &info->functions, head) {
+		vfree(fn->counters);
+		list_del(&fn->head);
+		kfree(fn);
+	}
+	kfree(info->filename);
+	kfree(info);
+}
+#endif
 
 #define ITER_STRIDE	PAGE_SIZE
 
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 11/14] kfence: make compatible with kmemleak
  2021-03-25  4:36 incoming Andrew Morton
                   ` (9 preceding siblings ...)
  2021-03-25  4:37 ` [patch 10/14] gcov: fix clang-11+ support Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 12/14] mm: memblock: fix section mismatch warning again Andrew Morton
                   ` (2 subsequent siblings)
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, andreyknvl, catalin.marinas, dvyukov, elver, glider, jannh,
	lhenriques, linux-mm, mm-commits, torvalds

From: Marco Elver <elver@google.com>
Subject: kfence: make compatible with kmemleak

Because memblock allocations are registered with kmemleak, the KFENCE pool
was seen by kmemleak as one large object.  Later allocations through
kfence_alloc() that were registered with kmemleak via
slab_post_alloc_hook() would then overlap and trigger a warning. 
Therefore, once the pool is initialized, we can remove (free) it from
kmemleak again, since it should be treated as allocator-internal and be
seen as "free memory".

The second problem is that kmemleak is passed the rounded size, and not
the originally requested size, which is also the size of KFENCE objects. 
To avoid kmemleak scanning past the end of an object and trigger a KFENCE
out-of-bounds error, fix the size if it is a KFENCE object.

For simplicity, to avoid a call to kfence_ksize() in
slab_post_alloc_hook() (and avoid new IS_ENABLED(CONFIG_DEBUG_KMEMLEAK)
guard), just call kfence_ksize() in mm/kmemleak.c:create_object().

Link: https://lkml.kernel.org/r/20210317084740.3099921-1-elver@google.com
Signed-off-by: Marco Elver <elver@google.com>
Reported-by: Luis Henriques <lhenriques@suse.de>
Reviewed-by: Catalin Marinas <catalin.marinas@arm.com>
Tested-by: Luis Henriques <lhenriques@suse.de>
Cc: Alexander Potapenko <glider@google.com>
Cc: Dmitry Vyukov <dvyukov@google.com>
Cc: Andrey Konovalov <andreyknvl@google.com>
Cc: Jann Horn <jannh@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/kfence/core.c |    9 +++++++++
 mm/kmemleak.c    |    3 ++-
 2 files changed, 11 insertions(+), 1 deletion(-)

--- a/mm/kfence/core.c~kfence-make-compatible-with-kmemleak
+++ a/mm/kfence/core.c
@@ -12,6 +12,7 @@
 #include <linux/debugfs.h>
 #include <linux/kcsan-checks.h>
 #include <linux/kfence.h>
+#include <linux/kmemleak.h>
 #include <linux/list.h>
 #include <linux/lockdep.h>
 #include <linux/memblock.h>
@@ -480,6 +481,14 @@ static bool __init kfence_init_pool(void
 		addr += 2 * PAGE_SIZE;
 	}
 
+	/*
+	 * The pool is live and will never be deallocated from this point on.
+	 * Remove the pool object from the kmemleak object tree, as it would
+	 * otherwise overlap with allocations returned by kfence_alloc(), which
+	 * are registered with kmemleak through the slab post-alloc hook.
+	 */
+	kmemleak_free(__kfence_pool);
+
 	return true;
 
 err:
--- a/mm/kmemleak.c~kfence-make-compatible-with-kmemleak
+++ a/mm/kmemleak.c
@@ -97,6 +97,7 @@
 #include <linux/atomic.h>
 
 #include <linux/kasan.h>
+#include <linux/kfence.h>
 #include <linux/kmemleak.h>
 #include <linux/memory_hotplug.h>
 
@@ -589,7 +590,7 @@ static struct kmemleak_object *create_ob
 	atomic_set(&object->use_count, 1);
 	object->flags = OBJECT_ALLOCATED;
 	object->pointer = ptr;
-	object->size = size;
+	object->size = kfence_ksize((void *)ptr) ?: size;
 	object->excess_ref = 0;
 	object->min_count = min_count;
 	object->count = 0;			/* white color initially */
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 12/14] mm: memblock: fix section mismatch warning again
  2021-03-25  4:36 incoming Andrew Morton
                   ` (10 preceding siblings ...)
  2021-03-25  4:37 ` [patch 11/14] kfence: make compatible with kmemleak Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 13/14] mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP Andrew Morton
  2021-03-25  4:37 ` [patch 14/14] mailmap: update Andrey Konovalov's email address Andrew Morton
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, arnd, david, linux-mm, lkp, mm-commits, ndesaulniers, rppt,
	torvalds

From: Mike Rapoport <rppt@linux.ibm.com>
Subject: mm: memblock: fix section mismatch warning again

Commit 34dc2efb39a2 ("memblock: fix section mismatch warning") marked
memblock_bottom_up() and memblock_set_bottom_up() as __init, but they
could be referenced from non-init functions like
memblock_find_in_range_node() on architectures that enable
CONFIG_ARCH_KEEP_MEMBLOCK.

For such builds kernel test robot reports: All warnings (new ones prefixed
by >>, old ones prefixed by <<):

>> WARNING: modpost: vmlinux.o(.text+0x74fea4): Section mismatch in reference from the function memblock_find_in_range_node() to the function .init.text:memblock_bottom_up()
The function memblock_find_in_range_node() references
the function __init memblock_bottom_up().
This is often because memblock_find_in_range_node lacks a __init
annotation or the annotation of memblock_bottom_up is wrong.

Replace __init annotations with __init_memblock annotations so that the
appropriate section will be selected depending on
CONFIG_ARCH_KEEP_MEMBLOCK.

Link: https://lore.kernel.org/lkml/202103160133.UzhgY0wt-lkp@intel.com
Link: https://lkml.kernel.org/r/20210316171347.14084-1-rppt@kernel.org
Fixes: 34dc2efb39a2 ("memblock: fix section mismatch warning")
Signed-off-by: Mike Rapoport <rppt@linux.ibm.com>
Reviewed-by: Arnd Bergmann <arnd@arndb.de>
Reported-by: kernel test robot <lkp@intel.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Acked-by: Nick Desaulniers <ndesaulniers@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 include/linux/memblock.h |    4 ++--
 1 file changed, 2 insertions(+), 2 deletions(-)

--- a/include/linux/memblock.h~memblock-fix-section-mismatch-warning-again
+++ a/include/linux/memblock.h
@@ -460,7 +460,7 @@ static inline void memblock_free_late(ph
 /*
  * Set the allocation direction to bottom-up or top-down.
  */
-static inline __init void memblock_set_bottom_up(bool enable)
+static inline __init_memblock void memblock_set_bottom_up(bool enable)
 {
 	memblock.bottom_up = enable;
 }
@@ -470,7 +470,7 @@ static inline __init void memblock_set_b
  * if this is true, that said, memblock will allocate memory
  * in bottom-up direction.
  */
-static inline __init bool memblock_bottom_up(void)
+static inline __init_memblock bool memblock_bottom_up(void)
 {
 	return memblock.bottom_up;
 }
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 13/14] mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP
  2021-03-25  4:36 incoming Andrew Morton
                   ` (11 preceding siblings ...)
  2021-03-25  4:37 ` [patch 12/14] mm: memblock: fix section mismatch warning again Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  2021-03-25  4:37 ` [patch 14/14] mailmap: update Andrey Konovalov's email address Andrew Morton
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, Chaitanya.Kulkarni, dsterba, ira.weiny, linux-mm,
	mm-commits, oliver.sang, stable, tglx, torvalds

From: Ira Weiny <ira.weiny@intel.com>
Subject: mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP

The kernel test robot found that __kmap_local_sched_out() was not
correctly skipping the guard pages when CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP
was set.[1] This was due to CONFIG_DEBUG_HIGHMEM check being used.

Change the configuration check to be correct.

[1] https://lore.kernel.org/lkml/20210304083825.GB17830@xsang-OptiPlex-9020/

Link: https://lkml.kernel.org/r/20210318230657.1497881-1-ira.weiny@intel.com
Fixes: 0e91a0c6984c ("mm/highmem: Provide CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP")
Signed-off-by: Ira Weiny <ira.weiny@intel.com>
Reported-by: kernel test robot <oliver.sang@intel.com>
Reviewed-by: Thomas Gleixner <tglx@linutronix.de>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Oliver Sang <oliver.sang@intel.com>
Cc: Chaitanya Kulkarni <Chaitanya.Kulkarni@wdc.com>
Cc: David Sterba <dsterba@suse.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/highmem.c |    4 ++--
 1 file changed, 2 insertions(+), 2 deletions(-)

--- a/mm/highmem.c~mm-highmem-fix-config_debug_kmap_local_force_map
+++ a/mm/highmem.c
@@ -618,7 +618,7 @@ void __kmap_local_sched_out(void)
 		int idx;
 
 		/* With debug all even slots are unmapped and act as guard */
-		if (IS_ENABLED(CONFIG_DEBUG_HIGHMEM) && !(i & 0x01)) {
+		if (IS_ENABLED(CONFIG_DEBUG_KMAP_LOCAL) && !(i & 0x01)) {
 			WARN_ON_ONCE(!pte_none(pteval));
 			continue;
 		}
@@ -654,7 +654,7 @@ void __kmap_local_sched_in(void)
 		int idx;
 
 		/* With debug all even slots are unmapped and act as guard */
-		if (IS_ENABLED(CONFIG_DEBUG_HIGHMEM) && !(i & 0x01)) {
+		if (IS_ENABLED(CONFIG_DEBUG_KMAP_LOCAL) && !(i & 0x01)) {
 			WARN_ON_ONCE(!pte_none(pteval));
 			continue;
 		}
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* [patch 14/14] mailmap: update Andrey Konovalov's email address
  2021-03-25  4:36 incoming Andrew Morton
                   ` (12 preceding siblings ...)
  2021-03-25  4:37 ` [patch 13/14] mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP Andrew Morton
@ 2021-03-25  4:37 ` Andrew Morton
  13 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-25  4:37 UTC (permalink / raw)
  To: akpm, andreyknvl, linux-mm, mm-commits, torvalds

From: Andrey Konovalov <andreyknvl@google.com>
Subject: mailmap: update Andrey Konovalov's email address

Use my personal email, the @google.com one will stop functioning soon.

Link: https://lkml.kernel.org/r/ead0e9c32a2f70e0bde6f63b3b9470e0ef13d2ee.1616107969.git.andreyknvl@google.com
Signed-off-by: Andrey Konovalov <andreyknvl@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 .mailmap |    1 +
 1 file changed, 1 insertion(+)

--- a/.mailmap~mailmap-update-andrey-konovalovs-email-address
+++ a/.mailmap
@@ -36,6 +36,7 @@ Andrew Morton <akpm@linux-foundation.org
 Andrew Murray <amurray@thegoodpenguin.co.uk> <amurray@embedded-bits.co.uk>
 Andrew Murray <amurray@thegoodpenguin.co.uk> <andrew.murray@arm.com>
 Andrew Vasquez <andrew.vasquez@qlogic.com>
+Andrey Konovalov <andreyknvl@gmail.com> <andreyknvl@google.com>
 Andrey Ryabinin <ryabinin.a.a@gmail.com> <a.ryabinin@samsung.com>
 Andrey Ryabinin <ryabinin.a.a@gmail.com> <aryabinin@virtuozzo.com>
 Andy Adamson <andros@citi.umich.edu>
_


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-09-10 17:11 ` incoming Kees Cook
@ 2021-09-10 20:13   ` Kees Cook
  0 siblings, 0 replies; 188+ messages in thread
From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw)
  To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits

On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote:
> On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> > 
> > More post linux-next material.
> > 
> > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> > 
> > Subsystems affected by this patch series:
> > 
> >   mm/slab-generic
> >   rapidio
> >   mm/debug
> > 
> > Subsystem: mm/slab-generic
> > 
> >     "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> >       mm: move kvmalloc-related functions to slab.h
> > 
> > Subsystem: rapidio
> > 
> >     Kees Cook <keescook@chromium.org>:
> >       rapidio: avoid bogus __alloc_size warning
> > 
> > Subsystem: mm/debug
> > 
> >     Kees Cook <keescook@chromium.org>:
> >     Patch series "Add __alloc_size() for better bounds checking", v2:
> >       Compiler Attributes: add __alloc_size() for better bounds checking
> >       checkpatch: add __alloc_size() to known $Attribute
> >       slab: clean up function declarations
> >       slab: add __alloc_size attributes for better bounds checking
> >       mm/page_alloc: add __alloc_size attributes for better bounds checking
> >       percpu: add __alloc_size attributes for better bounds checking
> >       mm/vmalloc: add __alloc_size attributes for better bounds checking
> 
> Hi,
> 
> FYI, in overnight build testing I found yet another corner case in
> GCC's handling of the __alloc_size attribute. It's the gift that keeps
> on giving. The fix is here:
> 
> https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/

I'm so glad it's Friday. Here's the v2 fix... *sigh*

https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/

-Kees

> 
> > 
> >  Makefile                                 |   15 +++
> >  drivers/of/kexec.c                       |    1 
> >  drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
> >  include/linux/compiler_attributes.h      |    6 +
> >  include/linux/gfp.h                      |    2 
> >  include/linux/mm.h                       |   34 --------
> >  include/linux/percpu.h                   |    3 
> >  include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
> >  include/linux/vmalloc.h                  |   11 ++
> >  scripts/checkpatch.pl                    |    3 
> >  10 files changed, 132 insertions(+), 74 deletions(-)
> > 
> 
> -- 
> Kees Cook

-- 
Kees Cook


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-09-10  3:09 incoming Andrew Morton
@ 2021-09-10 17:11 ` Kees Cook
  2021-09-10 20:13   ` incoming Kees Cook
  0 siblings, 1 reply; 188+ messages in thread
From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw)
  To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits

On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> 
> More post linux-next material.
> 
> 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> 
> Subsystems affected by this patch series:
> 
>   mm/slab-generic
>   rapidio
>   mm/debug
> 
> Subsystem: mm/slab-generic
> 
>     "Matthew Wilcox (Oracle)" <willy@infradead.org>:
>       mm: move kvmalloc-related functions to slab.h
> 
> Subsystem: rapidio
> 
>     Kees Cook <keescook@chromium.org>:
>       rapidio: avoid bogus __alloc_size warning
> 
> Subsystem: mm/debug
> 
>     Kees Cook <keescook@chromium.org>:
>     Patch series "Add __alloc_size() for better bounds checking", v2:
>       Compiler Attributes: add __alloc_size() for better bounds checking
>       checkpatch: add __alloc_size() to known $Attribute
>       slab: clean up function declarations
>       slab: add __alloc_size attributes for better bounds checking
>       mm/page_alloc: add __alloc_size attributes for better bounds checking
>       percpu: add __alloc_size attributes for better bounds checking
>       mm/vmalloc: add __alloc_size attributes for better bounds checking

Hi,

FYI, in overnight build testing I found yet another corner case in
GCC's handling of the __alloc_size attribute. It's the gift that keeps
on giving. The fix is here:

https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/

> 
>  Makefile                                 |   15 +++
>  drivers/of/kexec.c                       |    1 
>  drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
>  include/linux/compiler_attributes.h      |    6 +
>  include/linux/gfp.h                      |    2 
>  include/linux/mm.h                       |   34 --------
>  include/linux/percpu.h                   |    3 
>  include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
>  include/linux/vmalloc.h                  |   11 ++
>  scripts/checkpatch.pl                    |    3 
>  10 files changed, 132 insertions(+), 74 deletions(-)
> 

-- 
Kees Cook


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-09-10  3:09 Andrew Morton
  2021-09-10 17:11 ` incoming Kees Cook
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-09-10  3:09 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


More post linux-next material.

9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.

Subsystems affected by this patch series:

  mm/slab-generic
  rapidio
  mm/debug

Subsystem: mm/slab-generic

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move kvmalloc-related functions to slab.h

Subsystem: rapidio

    Kees Cook <keescook@chromium.org>:
      rapidio: avoid bogus __alloc_size warning

Subsystem: mm/debug

    Kees Cook <keescook@chromium.org>:
    Patch series "Add __alloc_size() for better bounds checking", v2:
      Compiler Attributes: add __alloc_size() for better bounds checking
      checkpatch: add __alloc_size() to known $Attribute
      slab: clean up function declarations
      slab: add __alloc_size attributes for better bounds checking
      mm/page_alloc: add __alloc_size attributes for better bounds checking
      percpu: add __alloc_size attributes for better bounds checking
      mm/vmalloc: add __alloc_size attributes for better bounds checking

 Makefile                                 |   15 +++
 drivers/of/kexec.c                       |    1 
 drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
 include/linux/compiler_attributes.h      |    6 +
 include/linux/gfp.h                      |    2 
 include/linux/mm.h                       |   34 --------
 include/linux/percpu.h                   |    3 
 include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
 include/linux/vmalloc.h                  |   11 ++
 scripts/checkpatch.pl                    |    3 
 10 files changed, 132 insertions(+), 74 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-09-09  1:08 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-09-09  1:08 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


A bunch of hotfixes, mostly cc:stable.


8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.

Subsystems affected by this patch series:

  mm/hmm
  mm/hugetlb
  mm/vmscan
  mm/pagealloc
  mm/pagemap
  mm/kmemleak
  mm/mempolicy
  mm/memblock

Subsystem: mm/hmm

    Li Zhijian <lizhijian@cn.fujitsu.com>:
      mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled

Subsystem: mm/hugetlb

    Liu Zixian <liuzixian4@huawei.com>:
      mm/hugetlb: initialize hugetlb_usage in mm_init

Subsystem: mm/vmscan

    Rik van Riel <riel@surriel.com>:
      mm,vmscan: fix divide by zero in get_scan_count

Subsystem: mm/pagealloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype

Subsystem: mm/pagemap

    Liam Howlett <liam.howlett@oracle.com>:
      mmap_lock: change trace and locking order

Subsystem: mm/kmemleak

    Naohiro Aota <naohiro.aota@wdc.com>:
      mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp

Subsystem: mm/mempolicy

    yanghui <yanghui.def@bytedance.com>:
      mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      nds32/setup: remove unused memblock_region variable in setup_memory()

 arch/nds32/kernel/setup.c |    1 -
 include/linux/hugetlb.h   |    9 +++++++++
 include/linux/mmap_lock.h |    8 ++++----
 kernel/fork.c             |    1 +
 mm/hmm.c                  |    5 ++++-
 mm/kmemleak.c             |    3 ++-
 mm/mempolicy.c            |   17 +++++++++++++----
 mm/page_alloc.c           |    4 +++-
 mm/vmscan.c               |    2 +-
 9 files changed, 37 insertions(+), 13 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-09-08 22:17 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


This is the post-linux-next material, so it is based upon latest
upstream to catch the now-merged dependencies.

10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.

Subsystems affected by this patch series:

  mm/vmstat
  mm/migration
  compat

Subsystem: mm/vmstat

    Ingo Molnar <mingo@elte.hu>:
      mm/vmstat: protect per cpu variables with preempt disable on RT

Subsystem: mm/migration

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: migrate: introduce a local variable to get the number of pages
      mm: migrate: fix the incorrect function name in comments
      mm: migrate: change to use bool type for 'page_was_mapped'

Subsystem: compat

    Arnd Bergmann <arnd@arndb.de>:
    Patch series "compat: remove compat_alloc_user_space", v5:
      kexec: move locking into do_kexec_load
      kexec: avoid compat_alloc_user_space
      mm: simplify compat_sys_move_pages
      mm: simplify compat numa syscalls
      compat: remove some compat entry points
      arch: remove compat_alloc_user_space

 arch/arm64/include/asm/compat.h           |    5 
 arch/arm64/include/asm/uaccess.h          |   11 -
 arch/arm64/include/asm/unistd32.h         |   10 -
 arch/arm64/lib/Makefile                   |    2 
 arch/arm64/lib/copy_in_user.S             |   77 ----------
 arch/mips/cavium-octeon/octeon-memcpy.S   |    2 
 arch/mips/include/asm/compat.h            |    8 -
 arch/mips/include/asm/uaccess.h           |   26 ---
 arch/mips/kernel/syscalls/syscall_n32.tbl |   10 -
 arch/mips/kernel/syscalls/syscall_o32.tbl |   10 -
 arch/mips/lib/memcpy.S                    |   11 -
 arch/parisc/include/asm/compat.h          |    6 
 arch/parisc/include/asm/uaccess.h         |    2 
 arch/parisc/kernel/syscalls/syscall.tbl   |    8 -
 arch/parisc/lib/memcpy.c                  |    9 -
 arch/powerpc/include/asm/compat.h         |   16 --
 arch/powerpc/kernel/syscalls/syscall.tbl  |   10 -
 arch/s390/include/asm/compat.h            |   10 -
 arch/s390/include/asm/uaccess.h           |    3 
 arch/s390/kernel/syscalls/syscall.tbl     |   10 -
 arch/s390/lib/uaccess.c                   |   63 --------
 arch/sparc/include/asm/compat.h           |   19 --
 arch/sparc/kernel/process_64.c            |    2 
 arch/sparc/kernel/signal32.c              |   12 -
 arch/sparc/kernel/signal_64.c             |    8 -
 arch/sparc/kernel/syscalls/syscall.tbl    |   10 -
 arch/x86/entry/syscalls/syscall_32.tbl    |    4 
 arch/x86/entry/syscalls/syscall_64.tbl    |    2 
 arch/x86/include/asm/compat.h             |   13 -
 arch/x86/include/asm/uaccess_64.h         |    7 
 include/linux/compat.h                    |   39 +----
 include/linux/uaccess.h                   |   10 -
 include/uapi/asm-generic/unistd.h         |   10 -
 kernel/compat.c                           |   21 --
 kernel/kexec.c                            |  105 +++++---------
 kernel/sys_ni.c                           |    5 
 mm/mempolicy.c                            |  213 +++++++-----------------------
 mm/migrate.c                              |   69 +++++----
 mm/vmstat.c                               |   48 ++++++
 39 files changed, 243 insertions(+), 663 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-09-08  2:52 incoming Andrew Morton
@ 2021-09-08  8:57 ` Vlastimil Babka
  0 siblings, 0 replies; 188+ messages in thread
From: Vlastimil Babka @ 2021-09-08  8:57 UTC (permalink / raw)
  To: Andrew Morton, Linus Torvalds
  Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman

On 9/8/21 04:52, Andrew Morton wrote:
> Subsystem: mm/slub
> 
>     Vlastimil Babka <vbabka@suse.cz>:
>     Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
>       mm, slub: don't call flush_all() from slab_debug_trace_open()
>       mm, slub: allocate private object map for debugfs listings
>       mm, slub: allocate private object map for validate_slab_cache()
>       mm, slub: don't disable irq for debug_check_no_locks_freed()
>       mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
>       mm, slub: extract get_partial() from new_slab_objects()
>       mm, slub: dissolve new_slab_objects() into ___slab_alloc()
>       mm, slub: return slab page from get_partial() and set c->page afterwards
>       mm, slub: restructure new page checks in ___slab_alloc()
>       mm, slub: simplify kmem_cache_cpu and tid setup
>       mm, slub: move disabling/enabling irqs to ___slab_alloc()
>       mm, slub: do initial checks in ___slab_alloc() with irqs enabled
>       mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
>       mm, slub: restore irqs around calling new_slab()
>       mm, slub: validate slab from partial list or page allocator before making it cpu slab
>       mm, slub: check new pages with restored irqs
>       mm, slub: stop disabling irqs around get_partial()
>       mm, slub: move reset of c->page and freelist out of deactivate_slab()
>       mm, slub: make locking in deactivate_slab() irq-safe
>       mm, slub: call deactivate_slab() without disabling irqs
>       mm, slub: move irq control into unfreeze_partials()
>       mm, slub: discard slabs in unfreeze_partials() without irqs disabled
>       mm, slub: detach whole partial list at once in unfreeze_partials()
>       mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
>       mm, slub: only disable irq with spin_lock in __unfreeze_partials()
>       mm, slub: don't disable irqs in slub_cpu_dead()
>       mm, slab: split out the cpu offline variant of flush_slab()
> 
>     Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
>       mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
>       mm: slub: make object_map_lock a raw_spinlock_t
> 
>     Vlastimil Babka <vbabka@suse.cz>:
>       mm, slub: make slab_lock() disable irqs with PREEMPT_RT
>       mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
>       mm, slub: use migrate_disable() on PREEMPT_RT
>       mm, slub: convert kmem_cpu_slab protection to local_lock

For my own piece of mind, I've checked that this part (patches 1 to 33)
are identical to the v6 posting [1] and git version [2] that Mel and
Mike tested (replies to [1]).

[1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/
[2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git
tags/mm-slub-5.15-rc1


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-09-08  2:52 Andrew Morton
  2021-09-08  8:57 ` incoming Vlastimil Babka
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-09-08  2:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f.

Subsystems affected by this patch series:

  mm/slub
  mm/memory-hotplug
  mm/rmap
  mm/ioremap
  mm/highmem
  mm/cleanups
  mm/secretmem
  mm/kfence
  mm/damon
  alpha
  percpu
  procfs
  misc
  core-kernel
  MAINTAINERS
  lib
  bitops
  checkpatch
  epoll
  init
  nilfs2
  coredump
  fork
  pids
  criu
  kconfig
  selftests
  ipc
  mm/vmscan
  scripts

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
      mm, slub: don't call flush_all() from slab_debug_trace_open()
      mm, slub: allocate private object map for debugfs listings
      mm, slub: allocate private object map for validate_slab_cache()
      mm, slub: don't disable irq for debug_check_no_locks_freed()
      mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
      mm, slub: extract get_partial() from new_slab_objects()
      mm, slub: dissolve new_slab_objects() into ___slab_alloc()
      mm, slub: return slab page from get_partial() and set c->page afterwards
      mm, slub: restructure new page checks in ___slab_alloc()
      mm, slub: simplify kmem_cache_cpu and tid setup
      mm, slub: move disabling/enabling irqs to ___slab_alloc()
      mm, slub: do initial checks in ___slab_alloc() with irqs enabled
      mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
      mm, slub: restore irqs around calling new_slab()
      mm, slub: validate slab from partial list or page allocator before making it cpu slab
      mm, slub: check new pages with restored irqs
      mm, slub: stop disabling irqs around get_partial()
      mm, slub: move reset of c->page and freelist out of deactivate_slab()
      mm, slub: make locking in deactivate_slab() irq-safe
      mm, slub: call deactivate_slab() without disabling irqs
      mm, slub: move irq control into unfreeze_partials()
      mm, slub: discard slabs in unfreeze_partials() without irqs disabled
      mm, slub: detach whole partial list at once in unfreeze_partials()
      mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
      mm, slub: only disable irq with spin_lock in __unfreeze_partials()
      mm, slub: don't disable irqs in slub_cpu_dead()
      mm, slab: split out the cpu offline variant of flush_slab()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
      mm: slub: make object_map_lock a raw_spinlock_t

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: make slab_lock() disable irqs with PREEMPT_RT
      mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
      mm, slub: use migrate_disable() on PREEMPT_RT
      mm, slub: convert kmem_cpu_slab protection to local_lock

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3:
      memory-hotplug.rst: remove locking details from admin-guide
      memory-hotplug.rst: complete admin-guide overhaul

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE":
      mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE
      mm: memory_hotplug: cleanup after removal of pfn_valid_within()

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory":
      mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range()
      mm/memory_hotplug: remove nid parameter from arch_remove_memory()
      mm/memory_hotplug: remove nid parameter from remove_memory() and friends
      ACPI: memhotplug: memory resources cannot be enabled yet
    Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3:
      mm: track present early pages per zone
      mm/memory_hotplug: introduce "auto-movable" online policy
      drivers/base/memory: introduce "memory groups" to logically group memory blocks
      mm/memory_hotplug: track present pages in memory groups
      ACPI: memhotplug: use a single static memory group for a single memory device
      dax/kmem: use a single static memory group for a single probed unit
      virtio-mem: use a single dynamic memory group for a single virtio-mem device
      mm/memory_hotplug: memory group aware "auto-movable" online policy
      mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixups for memory hotplug":
      mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code

Subsystem: mm/rmap

    Muchun Song <songmuchun@bytedance.com>:
      mm: remove redundant compound_head() calling

Subsystem: mm/ioremap

    Christoph Hellwig <hch@lst.de>:
      riscv: only select GENERIC_IOREMAP if MMU support is enabled
    Patch series "small ioremap cleanups":
      mm: move ioremap_page_range to vmalloc.c
      mm: don't allow executable ioremap mappings

    Weizhao Ouyang <o451686892@gmail.com>:
      mm/early_ioremap.c: remove redundant early_ioremap_shutdown()

Subsystem: mm/highmem

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      highmem: don't disable preemption on RT in kmap_atomic()

Subsystem: mm/cleanups

    Changbin Du <changbin.du@gmail.com>:
      mm: in_irq() cleanup

    Muchun Song <songmuchun@bytedance.com>:
      mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1)

Subsystem: mm/secretmem

    Jordy Zomer <jordy@jordyzomer.github.io>:
      mm/secretmem: use refcount_t instead of atomic_t

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: show cpu and timestamp in alloc/free info
      kfence: test: fail fast if disabled at boot

Subsystem: mm/damon

    SeongJae Park <sjpark@amazon.de>:
    Patch series "Introduce Data Access MONitor (DAMON)", v34:
      mm: introduce Data Access MONitor (DAMON)
      mm/damon/core: implement region-based sampling
      mm/damon: adaptively adjust regions
      mm/idle_page_tracking: make PG_idle reusable
      mm/damon: implement primitives for the virtual memory address spaces
      mm/damon: add a tracepoint
      mm/damon: implement a debugfs-based user space interface
      mm/damon/dbgfs: export kdamond pid to the user space
      mm/damon/dbgfs: support multiple contexts
      Documentation: add documents for DAMON
      mm/damon: add kunit tests
      mm/damon: add user space selftests
      MAINTAINERS: update for DAMON

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: agp: make empty macros use do-while-0 style
      alpha: pci-sysfs: fix all kernel-doc warnings

Subsystem: percpu

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      percpu: remove export of pcpu_base_addr

Subsystem: procfs

    Feng Zhou <zhoufeng.zf@bytedance.com>:
      fs/proc/kcore.c: add mmap interface

    Christoph Hellwig <hch@lst.de>:
      proc: stop using seq_get_buf in proc_task_name

    Ohhoon Kwon <ohoono.kwon@samsung.com>:
      connector: send event on write to /proc/[pid]/comm

Subsystem: misc

    Colin Ian King <colin.king@canonical.com>:
      arch: Kconfig: fix spelling mistake "seperate" -> "separate"

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/once.h: fix trivia typo Not -> Note

    Daniel Lezcano <daniel.lezcano@linaro.org>:
    Patch series "Add Hz macros", v3:
      units: change from 'L' to 'UL'
      units: add the HZ macros
      thermal/drivers/devfreq_cooling: use HZ macros
      devfreq: use HZ macros
      iio/drivers/as73211: use HZ macros
      hwmon/drivers/mr75203: use HZ macros
      iio/drivers/hid-sensor: use HZ macros
      i2c/drivers/ov02q10: use HZ macros
      mtd/drivers/nand: use HZ macros
      phy/drivers/stm32: use HZ macros

Subsystem: core-kernel

    Yang Yang <yang.yang29@zte.com.cn>:
      kernel/acct.c: use dedicated helper to access rlimit values

    Pavel Skripkin <paskripkin@gmail.com>:
      profiling: fix shift-out-of-bounds bugs

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS: update ClangBuiltLinux mailing list
      Documentation/llvm: update mailing list
      Documentation/llvm: update IRC location

Subsystem: lib

    Geert Uytterhoeven <geert@linux-m68k.org>:
    Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements":
      math: make RATIONAL tristate
      math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it

    Matteo Croce <mcroce@microsoft.com>:
    Patch series "lib/string: optimized mem* functions", v2:
      lib/string: optimized memcpy
      lib/string: optimized memmove
      lib/string: optimized memset

    Daniel Latypov <dlatypov@google.com>:
      lib/test: convert test_sort.c to use KUnit

    Randy Dunlap <rdunlap@infradead.org>:
      lib/dump_stack: correct kernel-doc notation
      lib/iov_iter.c: fix kernel-doc warnings

Subsystem: bitops

    Yury Norov <yury.norov@gmail.com>:
    Patch series "Resend bitmap patches":
      bitops: protect find_first_{,zero}_bit properly
      bitops: move find_bit_*_le functions from le.h to find.h
      include: move find.h from asm_generic to linux
      arch: remove GENERIC_FIND_FIRST_BIT entirely
      lib: add find_first_and_bit()
      cpumask: use find_first_and_bit()
      all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate
      tools: sync tools/bitmap with mother linux
      cpumask: replace cpumask_next_* with cpumask_first_* where appropriate
      include/linux: move for_each_bit() macros from bitops.h to find.h
      find: micro-optimize for_each_{set,clear}_bit()
      bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      tools: rename bitmap_alloc() to bitmap_zalloc()

    Yury Norov <yury.norov@gmail.com>:
      mm/percpu: micro-optimize pcpu_is_populated()
      bitmap: unify find_bit operations
      lib: bitmap: add performance test for bitmap_print_to_pagebuf
      vsprintf: rework bitmap_list_string

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: support wide strings

    Mimi Zohar <zohar@linux.ibm.com>:
      checkpatch: make email address check case insensitive

    Joe Perches <joe@perches.com>:
      checkpatch: improve GIT_COMMIT_ID test

Subsystem: epoll

    Nicholas Piggin <npiggin@gmail.com>:
      fs/epoll: use a per-cpu counter for user's watches count

Subsystem: init

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      init: move usermodehelper_enable() to populate_rootfs()

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      trap: cleanup trap_init()

Subsystem: nilfs2

    Nanyong Sun <sunnanyong@huawei.com>:
    Patch series "nilfs2: fix incorrect usage of kobject":
      nilfs2: fix memory leak in nilfs_sysfs_create_device_group
      nilfs2: fix NULL pointer in nilfs_##name##_attr_release
      nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group
      nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group
      nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group
      nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group

    Zhen Lei <thunder.leizhen@huawei.com>:
      nilfs2: use refcount_dec_and_lock() to fix potential UAF

Subsystem: coredump

    David Oberhollenzer <david.oberhollenzer@sigma-star.at>:
      fs/coredump.c: log if a core dump is aborted due to changed file permissions

    QiuXi <qiuxi1@huawei.com>:
      coredump: fix memleak in dump_vma_snapshot()

Subsystem: fork

    Christoph Hellwig <hch@lst.de>:
      kernel/fork.c: unexport get_{mm,task}_exe_file

Subsystem: pids

    Takahiro Itazuri <itazur@amazon.com>:
      pid: cleanup the stale comment mentioning pidmap_init().

Subsystem: criu

    Cyrill Gorcunov <gorcunov@gmail.com>:
      prctl: allow to setup brk for et_dyn executables

Subsystem: kconfig

    Zenghui Yu <yuzenghui@huawei.com>:
      configs: remove the obsolete CONFIG_INPUT_POLLDEV

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH

Subsystem: selftests

    Greg Thelen <gthelen@google.com>:
      selftests/memfd: remove unused variable

Subsystem: ipc

    Rafael Aquini <aquini@redhat.com>:
      ipc: replace costly bailout check in sysvipc_find_ipc()

Subsystem: mm/vmscan

    Randy Dunlap <rdunlap@infradead.org>:
      mm/workingset: correct kernel-doc notations

Subsystem: scripts

    Randy Dunlap <rdunlap@infradead.org>:
      scripts: check_extable: fix typo in user error message

 a/Documentation/admin-guide/mm/damon/index.rst            |   15 
 a/Documentation/admin-guide/mm/damon/start.rst            |  114 +
 a/Documentation/admin-guide/mm/damon/usage.rst            |  112 +
 a/Documentation/admin-guide/mm/index.rst                  |    1 
 a/Documentation/admin-guide/mm/memory-hotplug.rst         |  842 ++++++-----
 a/Documentation/dev-tools/kfence.rst                      |   98 -
 a/Documentation/kbuild/llvm.rst                           |    5 
 a/Documentation/vm/damon/api.rst                          |   20 
 a/Documentation/vm/damon/design.rst                       |  166 ++
 a/Documentation/vm/damon/faq.rst                          |   51 
 a/Documentation/vm/damon/index.rst                        |   30 
 a/Documentation/vm/index.rst                              |    1 
 a/MAINTAINERS                                             |   17 
 a/arch/Kconfig                                            |    2 
 a/arch/alpha/include/asm/agp.h                            |    4 
 a/arch/alpha/include/asm/bitops.h                         |    2 
 a/arch/alpha/kernel/pci-sysfs.c                           |   12 
 a/arch/arc/Kconfig                                        |    1 
 a/arch/arc/include/asm/bitops.h                           |    1 
 a/arch/arc/kernel/traps.c                                 |    5 
 a/arch/arm/configs/dove_defconfig                         |    1 
 a/arch/arm/configs/pxa_defconfig                          |    1 
 a/arch/arm/include/asm/bitops.h                           |    1 
 a/arch/arm/kernel/traps.c                                 |    5 
 a/arch/arm64/Kconfig                                      |    1 
 a/arch/arm64/include/asm/bitops.h                         |    1 
 a/arch/arm64/mm/mmu.c                                     |    3 
 a/arch/csky/include/asm/bitops.h                          |    1 
 a/arch/h8300/include/asm/bitops.h                         |    1 
 a/arch/h8300/kernel/traps.c                               |    4 
 a/arch/hexagon/include/asm/bitops.h                       |    1 
 a/arch/hexagon/kernel/traps.c                             |    4 
 a/arch/ia64/include/asm/bitops.h                          |    2 
 a/arch/ia64/mm/init.c                                     |    3 
 a/arch/m68k/include/asm/bitops.h                          |    2 
 a/arch/mips/Kconfig                                       |    1 
 a/arch/mips/configs/lemote2f_defconfig                    |    1 
 a/arch/mips/configs/pic32mzda_defconfig                   |    1 
 a/arch/mips/configs/rt305x_defconfig                      |    1 
 a/arch/mips/configs/xway_defconfig                        |    1 
 a/arch/mips/include/asm/bitops.h                          |    1 
 a/arch/nds32/kernel/traps.c                               |    5 
 a/arch/nios2/kernel/traps.c                               |    5 
 a/arch/openrisc/include/asm/bitops.h                      |    1 
 a/arch/openrisc/kernel/traps.c                            |    5 
 a/arch/parisc/configs/generic-32bit_defconfig             |    1 
 a/arch/parisc/include/asm/bitops.h                        |    2 
 a/arch/parisc/kernel/traps.c                              |    4 
 a/arch/powerpc/include/asm/bitops.h                       |    2 
 a/arch/powerpc/include/asm/cputhreads.h                   |    2 
 a/arch/powerpc/kernel/traps.c                             |    5 
 a/arch/powerpc/mm/mem.c                                   |    3 
 a/arch/powerpc/platforms/pasemi/dma_lib.c                 |    4 
 a/arch/powerpc/platforms/pseries/hotplug-memory.c         |    9 
 a/arch/riscv/Kconfig                                      |    2 
 a/arch/riscv/include/asm/bitops.h                         |    1 
 a/arch/riscv/kernel/traps.c                               |    5 
 a/arch/s390/Kconfig                                       |    1 
 a/arch/s390/include/asm/bitops.h                          |    1 
 a/arch/s390/kvm/kvm-s390.c                                |    2 
 a/arch/s390/mm/init.c                                     |    3 
 a/arch/sh/include/asm/bitops.h                            |    1 
 a/arch/sh/mm/init.c                                       |    3 
 a/arch/sparc/include/asm/bitops_32.h                      |    1 
 a/arch/sparc/include/asm/bitops_64.h                      |    2 
 a/arch/um/kernel/trap.c                                   |    4 
 a/arch/x86/Kconfig                                        |    1 
 a/arch/x86/configs/i386_defconfig                         |    1 
 a/arch/x86/configs/x86_64_defconfig                       |    1 
 a/arch/x86/include/asm/bitops.h                           |    2 
 a/arch/x86/kernel/apic/vector.c                           |    4 
 a/arch/x86/mm/init_32.c                                   |    3 
 a/arch/x86/mm/init_64.c                                   |    3 
 a/arch/x86/um/Kconfig                                     |    1 
 a/arch/xtensa/include/asm/bitops.h                        |    1 
 a/block/blk-mq.c                                          |    2 
 a/drivers/acpi/acpi_memhotplug.c                          |   46 
 a/drivers/base/memory.c                                   |  231 ++-
 a/drivers/base/node.c                                     |    2 
 a/drivers/block/rnbd/rnbd-clt.c                           |    2 
 a/drivers/dax/kmem.c                                      |   43 
 a/drivers/devfreq/devfreq.c                               |    2 
 a/drivers/dma/ti/edma.c                                   |    2 
 a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c                   |    4 
 a/drivers/hwmon/ltc2992.c                                 |    3 
 a/drivers/hwmon/mr75203.c                                 |    2 
 a/drivers/iio/adc/ad7124.c                                |    2 
 a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c  |    3 
 a/drivers/iio/light/as73211.c                             |    3 
 a/drivers/infiniband/hw/irdma/hw.c                        |   16 
 a/drivers/media/cec/core/cec-core.c                       |    2 
 a/drivers/media/i2c/ov02a10.c                             |    2 
 a/drivers/media/mc/mc-devnode.c                           |    2 
 a/drivers/mmc/host/renesas_sdhi_core.c                    |    2 
 a/drivers/mtd/nand/raw/intel-nand-controller.c            |    2 
 a/drivers/net/virtio_net.c                                |    2 
 a/drivers/pci/controller/dwc/pci-dra7xx.c                 |    2 
 a/drivers/phy/st/phy-stm32-usbphyc.c                      |    2 
 a/drivers/scsi/lpfc/lpfc_sli.c                            |   10 
 a/drivers/soc/fsl/qbman/bman_portal.c                     |    2 
 a/drivers/soc/fsl/qbman/qman_portal.c                     |    2 
 a/drivers/soc/ti/k3-ringacc.c                             |    4 
 a/drivers/thermal/devfreq_cooling.c                       |    2 
 a/drivers/tty/n_tty.c                                     |    2 
 a/drivers/virt/acrn/ioreq.c                               |    3 
 a/drivers/virtio/virtio_mem.c                             |   26 
 a/fs/coredump.c                                           |   15 
 a/fs/eventpoll.c                                          |   18 
 a/fs/f2fs/segment.c                                       |    8 
 a/fs/nilfs2/sysfs.c                                       |   26 
 a/fs/nilfs2/the_nilfs.c                                   |    9 
 a/fs/ocfs2/cluster/heartbeat.c                            |    2 
 a/fs/ocfs2/dlm/dlmdomain.c                                |    4 
 a/fs/ocfs2/dlm/dlmmaster.c                                |   18 
 a/fs/ocfs2/dlm/dlmrecovery.c                              |    2 
 a/fs/ocfs2/dlm/dlmthread.c                                |    2 
 a/fs/proc/array.c                                         |   18 
 a/fs/proc/base.c                                          |    5 
 a/fs/proc/kcore.c                                         |   73 
 a/include/asm-generic/bitops.h                            |    1 
 a/include/asm-generic/bitops/find.h                       |  198 --
 a/include/asm-generic/bitops/le.h                         |   64 
 a/include/asm-generic/early_ioremap.h                     |    6 
 a/include/linux/bitmap.h                                  |   34 
 a/include/linux/bitops.h                                  |   34 
 a/include/linux/cpumask.h                                 |   46 
 a/include/linux/damon.h                                   |  290 +++
 a/include/linux/find.h                                    |  134 +
 a/include/linux/highmem-internal.h                        |   27 
 a/include/linux/memory.h                                  |   55 
 a/include/linux/memory_hotplug.h                          |   40 
 a/include/linux/mmzone.h                                  |   19 
 a/include/linux/once.h                                    |    2 
 a/include/linux/page-flags.h                              |   17 
 a/include/linux/page_ext.h                                |    2 
 a/include/linux/page_idle.h                               |    6 
 a/include/linux/pagemap.h                                 |    7 
 a/include/linux/sched/user.h                              |    3 
 a/include/linux/slub_def.h                                |    6 
 a/include/linux/threads.h                                 |    2 
 a/include/linux/units.h                                   |   10 
 a/include/linux/vmalloc.h                                 |    3 
 a/include/trace/events/damon.h                            |   43 
 a/include/trace/events/mmflags.h                          |    2 
 a/include/trace/events/page_ref.h                         |    4 
 a/init/initramfs.c                                        |    2 
 a/init/main.c                                             |    3 
 a/init/noinitramfs.c                                      |    2 
 a/ipc/util.c                                              |   16 
 a/kernel/acct.c                                           |    2 
 a/kernel/fork.c                                           |    2 
 a/kernel/profile.c                                        |   21 
 a/kernel/sys.c                                            |    7 
 a/kernel/time/clocksource.c                               |    4 
 a/kernel/user.c                                           |   25 
 a/lib/Kconfig                                             |    3 
 a/lib/Kconfig.debug                                       |    9 
 a/lib/dump_stack.c                                        |    3 
 a/lib/find_bit.c                                          |   21 
 a/lib/find_bit_benchmark.c                                |   21 
 a/lib/genalloc.c                                          |    2 
 a/lib/iov_iter.c                                          |    8 
 a/lib/math/Kconfig                                        |    2 
 a/lib/math/rational.c                                     |    3 
 a/lib/string.c                                            |  130 +
 a/lib/test_bitmap.c                                       |   37 
 a/lib/test_printf.c                                       |    2 
 a/lib/test_sort.c                                         |   40 
 a/lib/vsprintf.c                                          |   26 
 a/mm/Kconfig                                              |   15 
 a/mm/Makefile                                             |    4 
 a/mm/compaction.c                                         |   20 
 a/mm/damon/Kconfig                                        |   68 
 a/mm/damon/Makefile                                       |    5 
 a/mm/damon/core-test.h                                    |  253 +++
 a/mm/damon/core.c                                         |  748 ++++++++++
 a/mm/damon/dbgfs-test.h                                   |  126 +
 a/mm/damon/dbgfs.c                                        |  631 ++++++++
 a/mm/damon/vaddr-test.h                                   |  329 ++++
 a/mm/damon/vaddr.c                                        |  672 +++++++++
 a/mm/early_ioremap.c                                      |    5 
 a/mm/highmem.c                                            |    2 
 a/mm/ioremap.c                                            |   25 
 a/mm/kfence/core.c                                        |    3 
 a/mm/kfence/kfence.h                                      |    2 
 a/mm/kfence/kfence_test.c                                 |    3 
 a/mm/kfence/report.c                                      |   19 
 a/mm/kmemleak.c                                           |    2 
 a/mm/memory_hotplug.c                                     |  396 ++++-
 a/mm/memremap.c                                           |    5 
 a/mm/page_alloc.c                                         |   27 
 a/mm/page_ext.c                                           |   12 
 a/mm/page_idle.c                                          |   10 
 a/mm/page_isolation.c                                     |    7 
 a/mm/page_owner.c                                         |   14 
 a/mm/percpu.c                                             |   36 
 a/mm/rmap.c                                               |    6 
 a/mm/secretmem.c                                          |    9 
 a/mm/slab_common.c                                        |    2 
 a/mm/slub.c                                               | 1023 +++++++++-----
 a/mm/vmalloc.c                                            |   24 
 a/mm/workingset.c                                         |    2 
 a/net/ncsi/ncsi-manage.c                                  |    4 
 a/scripts/check_extable.sh                                |    2 
 a/scripts/checkpatch.pl                                   |   93 -
 a/tools/include/linux/bitmap.h                            |    4 
 a/tools/perf/bench/find-bit-bench.c                       |    2 
 a/tools/perf/builtin-c2c.c                                |    6 
 a/tools/perf/builtin-record.c                             |    2 
 a/tools/perf/tests/bitmap.c                               |    2 
 a/tools/perf/tests/mem2node.c                             |    2 
 a/tools/perf/util/affinity.c                              |    4 
 a/tools/perf/util/header.c                                |    4 
 a/tools/perf/util/metricgroup.c                           |    2 
 a/tools/perf/util/mmap.c                                  |    4 
 a/tools/testing/selftests/damon/Makefile                  |    7 
 a/tools/testing/selftests/damon/_chk_dependency.sh        |   28 
 a/tools/testing/selftests/damon/debugfs_attrs.sh          |   75 +
 a/tools/testing/selftests/kvm/dirty_log_perf_test.c       |    2 
 a/tools/testing/selftests/kvm/dirty_log_test.c            |    4 
 a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c |    2 
 a/tools/testing/selftests/memfd/memfd_test.c              |    2 
 b/MAINTAINERS                                             |    2 
 b/tools/include/asm-generic/bitops.h                      |    1 
 b/tools/include/linux/bitmap.h                            |    7 
 b/tools/include/linux/find.h                              |   81 +
 b/tools/lib/find_bit.c                                    |   20 
 227 files changed, 6695 insertions(+), 1875 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-09-02 21:48 incoming Andrew Morton
@ 2021-09-02 21:49 ` Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw)
  To: Linus Torvalds, linux-mm, mm-commits

On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote:

> 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.

Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f".


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-09-02 21:48 Andrew Morton
  2021-09-02 21:49 ` incoming Andrew Morton
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.

Subsystems affected by this patch series:

  ia64
  ocfs2
  block
  mm/slub
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mremap
  mm/bootmem
  mm/sparsemem
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/mempolicy
  mm/memblock
  mm/oom-kill
  mm/migration
  mm/ksm
  mm/percpu
  mm/vmstat
  mm/madvise

Subsystem: ia64

    Jason Wang <wangborong@cdjrlc.com>:
      ia64: fix typo in a comment

    Geert Uytterhoeven <geert+renesas@glider.be>:
    Patch series "ia64: Miscellaneous fixes and cleanups":
      ia64: fix #endif comment for reserve_elfcorehdr()
      ia64: make reserve_elfcorehdr() static
      ia64: make num_rsvd_regions static

Subsystem: ocfs2

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: remove an unnecessary condition

    Tuo Li <islituo@gmail.com>:
      ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info()

    Gang He <ghe@suse.com>:
      ocfs2: ocfs2_downconvert_lock failure results in deadlock

Subsystem: block

    kernel test robot <lkp@intel.com>:
      arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4:
      mm, slub: don't call flush_all() from slab_debug_trace_open()
      mm, slub: allocate private object map for debugfs listings
      mm, slub: allocate private object map for validate_slab_cache()
      mm, slub: don't disable irq for debug_check_no_locks_freed()
      mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
      mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab()
      mm, slub: extract get_partial() from new_slab_objects()
      mm, slub: dissolve new_slab_objects() into ___slab_alloc()
      mm, slub: return slab page from get_partial() and set c->page afterwards
      mm, slub: restructure new page checks in ___slab_alloc()
      mm, slub: simplify kmem_cache_cpu and tid setup
      mm, slub: move disabling/enabling irqs to ___slab_alloc()
      mm, slub: do initial checks in ___slab_alloc() with irqs enabled
      mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
      mm, slub: restore irqs around calling new_slab()
      mm, slub: validate slab from partial list or page allocator before making it cpu slab
      mm, slub: check new pages with restored irqs
      mm, slub: stop disabling irqs around get_partial()
      mm, slub: move reset of c->page and freelist out of deactivate_slab()
      mm, slub: make locking in deactivate_slab() irq-safe
      mm, slub: call deactivate_slab() without disabling irqs
      mm, slub: move irq control into unfreeze_partials()
      mm, slub: discard slabs in unfreeze_partials() without irqs disabled
      mm, slub: detach whole partial list at once in unfreeze_partials()
      mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
      mm, slub: only disable irq with spin_lock in __unfreeze_partials()
      mm, slub: don't disable irqs in slub_cpu_dead()
      mm, slab: make flush_slab() possible to call with irqs enabled

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
      mm: slub: make object_map_lock a raw_spinlock_t

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: optionally save/restore irqs in slab_[un]lock()/
      mm, slub: make slab_lock() disable irqs with PREEMPT_RT
      mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
      mm, slub: use migrate_disable() on PREEMPT_RT
      mm, slub: convert kmem_cpu_slab protection to local_lock

Subsystem: mm/debug

    Gavin Shan <gshan@redhat.com>:
    Patch series "mm/debug_vm_pgtable: Enhancements", v6:
      mm/debug_vm_pgtable: introduce struct pgtable_debug_args
      mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests
      mm/debug_vm_pgtable: remove unused code
      mm/debug_vm_pgtable: fix corrupted page flag

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: report a more useful address for reclaim acquisition

    liuhailong <liuhailong@oppo.com>:
      mm: add kernel_misc_reclaimable in show_free_areas

Subsystem: mm/pagecache

    Jan Kara <jack@suse.cz>:
    Patch series "writeback: Fix bandwidth estimates", v4:
      writeback: track number of inodes under writeback
      writeback: reliably update bandwidth estimation
      writeback: fix bandwidth estimate for spiky workload
      writeback: rename domain_update_bandwidth()
      writeback: use READ_ONCE for unlocked reads of writeback stats

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: remove irqsave/restore locking from contexts with irqs enabled
      fs: drop_caches: fix skipping over shadow cache inodes
      fs: inode: count invalidated shadow pages in pginodesteal

    Shakeel Butt <shakeelb@google.com>:
      writeback: memcg: simplify cgroup_writeback_by_id

    Jing Yangyang <jing.yangyang@zte.com.cn>:
      include/linux/buffer_head.h: fix boolreturn.cocci warnings

Subsystem: mm/gup

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for gup":
      mm: gup: remove set but unused local variable major
      mm: gup: remove unneed local variable orig_refs
      mm: gup: remove useless BUG_ON in __get_user_pages()
      mm: gup: fix potential pgmap refcnt leak in __gup_device_huge()
      mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range()

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "A few gup refactorings and documentation updates", v3:
      mm/gup: documentation corrections for gup/pup
      mm/gup: small refactoring: simplify try_grab_page()
      mm/gup: remove try_get_page(), call try_get_compound_head() directly

Subsystem: mm/swap

    Hugh Dickins <hughd@google.com>:
      fs, mm: fix race in unlinking swapfile

    John Hubbard <jhubbard@nvidia.com>:
      mm: delete unused get_kernel_page()

Subsystem: mm/shmem

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      shmem: use raw_spinlock_t for ->stat_lock

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for shmem":
      shmem: remove unneeded variable ret
      shmem: remove unneeded header file
      shmem: remove unneeded function forward declaration
      shmem: include header file to declare swap_info

    Hugh Dickins <hughd@google.com>:
    Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups":
      huge tmpfs: fix fallocate(vanilla) advance over huge pages
      huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE
      huge tmpfs: remove shrinklist addition from shmem_setattr()
      huge tmpfs: revert shmem's use of transhuge_vma_enabled()
      huge tmpfs: move shmem_huge_enabled() upwards
      huge tmpfs: SGP_NOALLOC to stop collapse_file() on race
      huge tmpfs: shmem_is_huge(vma, inode, index)
      huge tmpfs: decide stat.st_blksize by shmem_is_huge()
      shmem: shmem_writepage() split unlikely i915 THP

Subsystem: mm/memcg

    Suren Baghdasaryan <surenb@google.com>:
      mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions
      mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config
      mm, memcg: inline swap-related functions to improve disabled memcg config

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: enable accounting for pids in nested pid namespaces

    Shakeel Butt <shakeelb@google.com>:
      memcg: switch lruvec stats to rstat
      memcg: infrastructure to flush memcg stats

    Yutian Yang <nglaive@gmail.com>:
      memcg: charge fs_context and legacy_fs_context

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "memcg accounting from OpenVZ", v7:
      memcg: enable accounting for mnt_cache entries
      memcg: enable accounting for pollfd and select bits arrays
      memcg: enable accounting for file lock caches
      memcg: enable accounting for fasync_cache
      memcg: enable accounting for new namesapces and struct nsproxy
      memcg: enable accounting of ipc resources
      memcg: enable accounting for signals
      memcg: enable accounting for posix_timers_cache slab
      memcg: enable accounting for ldt_struct objects

    Shakeel Butt <shakeelb@google.com>:
      memcg: cleanup racy sum avoidance code

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: replace in_interrupt() by !in_task() in active_memcg()

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: memcontrol: set the correct memcg swappiness restriction

    Miaohe Lin <linmiaohe@huawei.com>:
      mm, memcg: remove unused functions
      mm, memcg: save some atomic ops when flush is already true

    Michal Hocko <mhocko@suse.com>:
      memcg: fix up drain_local_stock comment

    Shakeel Butt <shakeelb@google.com>:
      memcg: make memcg->event_list_lock irqsafe

Subsystem: mm/selftests

    Po-Hsu Lin <po-hsu.lin@canonical.com>:
      selftests/vm: use kselftest skip code for skipped tests

    Colin Ian King <colin.king@canonical.com>:
      selftests: Fix spelling mistake "cann't" -> "cannot"

Subsystem: mm/pagemap

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "shoot lazy tlbs", v4:
      lazy tlb: introduce lazy mm refcount helper functions
      lazy tlb: allow lazy tlb mm refcounting to be configurable
      lazy tlb: shoot lazies, a non-refcounting lazy tlb option
      powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN

    Christoph Hellwig <hch@lst.de>:
    Patch series "_kernel_dcache_page fixes and removal":
      mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data
      mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page
      scatterlist: replace flush_kernel_dcache_page with flush_dcache_page
      mm: remove flush_kernel_dcache_page

    Huang Ying <ying.huang@intel.com>:
      mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      mm: change fault_in_pages_* to have an unsigned size parameter

    Luigi Rizzo <lrizzo@google.com>:
      mm/pagemap: add mmap_assert_locked() annotations to find_vma*()

    "Liam R. Howlett" <Liam.Howlett@Oracle.com>:
      remap_file_pages: Use vma_lookup() instead of find_vma()

Subsystem: mm/mremap

    Chen Wandun <chenwandun@huawei.com>:
      mm/mremap: fix memory account on do_munmap() failure

Subsystem: mm/bootmem

    Muchun Song <songmuchun@bytedance.com>:
      mm/bootmem_info.c: mark __init on register_page_bootmem_info_section

Subsystem: mm/sparsemem

    Ohhoon Kwon <ohoono.kwon@samsung.com>:
    Patch series "mm: sparse: remove __section_nr() function", v4:
      mm: sparse: pass section_nr to section_mark_present
      mm: sparse: pass section_nr to find_memory_block
      mm: sparse: remove __section_nr() function

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/sparse: set SECTION_NID_SHIFT to 6

    Matthew Wilcox <willy@infradead.org>:
      include/linux/mmzone.h: avoid a warning in sparse memory support

    Miles Chen <miles.chen@mediatek.com>:
      mm/sparse: clarify pgdat_to_phys

Subsystem: mm/vmalloc

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: use batched page requests in bulk-allocator
      mm/vmalloc: remove gfpflags_allow_blocking() check
      lib/test_vmalloc.c: add a new 'nr_pages' parameter

    Chen Wandun <chenwandun@huawei.com>:
      mm/vmalloc: fix wrong behavior in vread

Subsystem: mm/kasan

    Woody Lin <woodylin@google.com>:
      mm/kasan: move kasan.fault to mm/kasan/report.c

    Andrey Konovalov <andreyknvl@gmail.com>:
    Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2:
      kasan: test: rework kmalloc_oob_right
      kasan: test: avoid writing invalid memory
      kasan: test: avoid corrupting memory via memset
      kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS
      kasan: test: only do kmalloc_uaf_memset for generic mode
      kasan: test: clean up ksize_uaf
      kasan: test: avoid corrupting memory in copy_user_test
      kasan: test: avoid corrupting memory in kasan_rcu_uaf

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: ensure consistency of memory map poisoning":
      mm/page_alloc: always initialize memory map for the holes
      microblaze: simplify pte_alloc_one_kernel()
      mm: introduce memmap_alloc() to unify memory map allocation
      memblock: stop poisoning raw allocations

    Nico Pache <npache@redhat.com>:
      mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc: make alloc_node_mem_map() __init rather than __ref

    Vasily Averin <vvs@virtuozzo.com>:
      mm/page_alloc.c: use in_task()

    "George G. Davis" <davis.george@siemens.com>:
      mm/page_isolation: tracing: trace all test_pages_isolated failures

Subsystem: mm/memory-failure

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for hwpoison":
      mm/hwpoison: remove unneeded variable unmap_success
      mm/hwpoison: fix potential pte_unmap_unlock pte error
      mm/hwpoison: change argument struct page **hpagep to *hpage
      mm/hwpoison: fix some obsolete comments

    Yang Shi <shy828301@gmail.com>:
      mm: hwpoison: don't drop slab caches for offlining non-LRU page
      doc: hwpoison: correct the support for hugepage
      mm: hwpoison: dump page for unhandlable page

    Michael Wang <yun.wang@linux.alibaba.com>:
      mm: fix panic caused by __page_handle_poison()

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: simplify prep_compound_gigantic_page ref count racing code
      hugetlb: drop ref count earlier after page allocation
      hugetlb: before freeing hugetlb page set dtor to appropriate value
      hugetlb: fix hugetlb cgroup refcounting during vma split

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
    Patch series "userfaultfd: minor bug fixes":
      userfaultfd: change mmap_changing to atomic
      userfaultfd: prevent concurrent API initialization
      selftests/vm/userfaultfd: wake after copy failure

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "Migrate Pages in lieu of discard", v11:
      mm/numa: automatically generate node migration order
      mm/migrate: update node demotion order on hotplug events

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/migrate: enable returning precise migrate_pages() success count

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/migrate: demote pages during reclaim

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/vmscan: add page demotion counter

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: add helper for querying ability to age anonymous pages

    Keith Busch <kbusch@kernel.org>:
      mm/vmscan: Consider anonymous pages without swap

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: never demote for memcg reclaim

    Huang Ying <ying.huang@intel.com>:
      mm/migrate: add sysfs interface to enable reclaim migration

    Hui Su <suhui@zeku.com>:
      mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg()

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for vmscan", v2:
      mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed
      mm/vmscan: remove misleading setting to sc->priority
      mm/vmscan: remove unneeded return value of kswapd_run()
      mm/vmscan: add 'else' to remove check_pending label

    Vlastimil Babka <vbabka@suse.cz>:
      mm, vmscan: guarantee drop_slab_node() termination

Subsystem: mm/compaction

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: optimize proactive compaction deferrals
      mm: compaction: support triggering of proactive compaction by user

Subsystem: mm/mempolicy

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "Introduce multi-preference mempolicy", v7:
      mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes

    Feng Tang <feng.tang@intel.com>:
      mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY
      mm/mempolicy: advertise new MPOL_PREFERRED_MANY

    Feng Tang <feng.tang@intel.com>:
      mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies

    Vasily Averin <vvs@virtuozzo.com>:
      mm/mempolicy.c: use in_task() in mempolicy_slab_node()

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      memblock: make memblock_find_in_range method private

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm: introduce process_mrelease system call
      mm: wire up syscall process_mrelease

Subsystem: mm/migration

    Randy Dunlap <rdunlap@infradead.org>:
      mm/migrate: correct kernel-doc notation

Subsystem: mm/ksm

    Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>:
    Patch series "add KSM selftests":
      selftests: vm: add KSM merge test
      selftests: vm: add KSM unmerge test
      selftests: vm: add KSM zero page merging test
      selftests: vm: add KSM merging across nodes test
      mm: KSM: fix data type
    Patch series "add KSM performance tests", v3:
      selftests: vm: add KSM merging time test
      selftests: vm: add COW time test for KSM pages

Subsystem: mm/percpu

    Jing Xiangfeng <jingxiangfeng@huawei.com>:
      mm/percpu,c: remove obsolete comments of pcpu_chunk_populated()

Subsystem: mm/vmstat

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for vmstat":
      mm/vmstat: correct some wrong comments
      mm/vmstat: simplify the array size calculation
      mm/vmstat: remove unneeded return value

Subsystem: mm/madvise

    zhangkui <zhangkui@oppo.com>:
      mm/madvise: add MADV_WILLNEED to process_madvise()

 Documentation/ABI/testing/sysfs-kernel-mm-numa         |   24 
 Documentation/admin-guide/mm/numa_memory_policy.rst    |   15 
 Documentation/admin-guide/sysctl/vm.rst                |    3 
 Documentation/core-api/cachetlb.rst                    |   86 -
 Documentation/dev-tools/kasan.rst                      |   13 
 Documentation/translations/zh_CN/core-api/cachetlb.rst |    9 
 Documentation/vm/hwpoison.rst                          |    1 
 arch/Kconfig                                           |   28 
 arch/alpha/kernel/syscalls/syscall.tbl                 |    2 
 arch/arm/include/asm/cacheflush.h                      |    4 
 arch/arm/kernel/setup.c                                |   20 
 arch/arm/mach-rpc/ecard.c                              |    2 
 arch/arm/mm/flush.c                                    |   33 
 arch/arm/mm/nommu.c                                    |    6 
 arch/arm/tools/syscall.tbl                             |    2 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    2 
 arch/arm64/kvm/hyp/reserved_mem.c                      |    9 
 arch/arm64/mm/init.c                                   |   38 
 arch/csky/abiv1/cacheflush.c                           |   11 
 arch/csky/abiv1/inc/abi/cacheflush.h                   |    4 
 arch/csky/kernel/probes/kprobes.c                      |    3 
 arch/ia64/include/asm/meminit.h                        |    2 
 arch/ia64/kernel/acpi.c                                |    2 
 arch/ia64/kernel/setup.c                               |   55 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    2 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    2 
 arch/microblaze/include/asm/page.h                     |    3 
 arch/microblaze/include/asm/pgtable.h                  |    2 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    2 
 arch/microblaze/mm/init.c                              |   12 
 arch/microblaze/mm/pgtable.c                           |   17 
 arch/mips/include/asm/cacheflush.h                     |    8 
 arch/mips/kernel/setup.c                               |   14 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    2 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    2 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    2 
 arch/nds32/include/asm/cacheflush.h                    |    3 
 arch/nds32/mm/cacheflush.c                             |    9 
 arch/parisc/include/asm/cacheflush.h                   |    8 
 arch/parisc/kernel/cache.c                             |    3 
 arch/parisc/kernel/syscalls/syscall.tbl                |    2 
 arch/powerpc/Kconfig                                   |    1 
 arch/powerpc/kernel/smp.c                              |    2 
 arch/powerpc/kernel/syscalls/syscall.tbl               |    2 
 arch/powerpc/mm/book3s64/radix_tlb.c                   |    4 
 arch/powerpc/platforms/pseries/hotplug-memory.c        |    4 
 arch/riscv/mm/init.c                                   |   44 
 arch/s390/kernel/setup.c                               |    9 
 arch/s390/kernel/syscalls/syscall.tbl                  |    2 
 arch/s390/mm/fault.c                                   |    2 
 arch/sh/include/asm/cacheflush.h                       |    8 
 arch/sh/kernel/syscalls/syscall.tbl                    |    2 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    2 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    1 
 arch/x86/kernel/aperture_64.c                          |    5 
 arch/x86/kernel/ldt.c                                  |    6 
 arch/x86/mm/init.c                                     |   23 
 arch/x86/mm/numa.c                                     |    5 
 arch/x86/mm/numa_emulation.c                           |    5 
 arch/x86/realmode/init.c                               |    2 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    2 
 block/blk-map.c                                        |    2 
 drivers/acpi/tables.c                                  |    5 
 drivers/base/arch_numa.c                               |    5 
 drivers/base/memory.c                                  |    4 
 drivers/mmc/host/jz4740_mmc.c                          |    4 
 drivers/mmc/host/mmc_spi.c                             |    2 
 drivers/of/of_reserved_mem.c                           |   12 
 fs/drop_caches.c                                       |    3 
 fs/exec.c                                              |   12 
 fs/fcntl.c                                             |    3 
 fs/fs-writeback.c                                      |   28 
 fs/fs_context.c                                        |    4 
 fs/inode.c                                             |    2 
 fs/locks.c                                             |    6 
 fs/namei.c                                             |    8 
 fs/namespace.c                                         |    7 
 fs/ocfs2/dlmglue.c                                     |   14 
 fs/ocfs2/quota_global.c                                |    1 
 fs/ocfs2/quota_local.c                                 |    2 
 fs/pipe.c                                              |    2 
 fs/select.c                                            |    4 
 fs/userfaultfd.c                                       |  116 -
 include/linux/backing-dev-defs.h                       |    2 
 include/linux/backing-dev.h                            |   19 
 include/linux/buffer_head.h                            |    2 
 include/linux/compaction.h                             |    2 
 include/linux/highmem.h                                |    5 
 include/linux/hugetlb_cgroup.h                         |   12 
 include/linux/memblock.h                               |    2 
 include/linux/memcontrol.h                             |  118 +
 include/linux/memory.h                                 |    2 
 include/linux/mempolicy.h                              |   16 
 include/linux/migrate.h                                |   14 
 include/linux/mm.h                                     |   17 
 include/linux/mmzone.h                                 |    4 
 include/linux/page-flags.h                             |    9 
 include/linux/pagemap.h                                |    4 
 include/linux/sched/mm.h                               |   35 
 include/linux/shmem_fs.h                               |   25 
 include/linux/slub_def.h                               |    6 
 include/linux/swap.h                                   |   28 
 include/linux/syscalls.h                               |    1 
 include/linux/userfaultfd_k.h                          |    8 
 include/linux/vm_event_item.h                          |    2 
 include/linux/vmpressure.h                             |    2 
 include/linux/writeback.h                              |    4 
 include/trace/events/migrate.h                         |    3 
 include/uapi/asm-generic/unistd.h                      |    4 
 include/uapi/linux/mempolicy.h                         |    1 
 ipc/msg.c                                              |    2 
 ipc/namespace.c                                        |    2 
 ipc/sem.c                                              |    9 
 ipc/shm.c                                              |    2 
 kernel/cgroup/namespace.c                              |    2 
 kernel/cpu.c                                           |    2 
 kernel/exit.c                                          |    2 
 kernel/fork.c                                          |   51 
 kernel/kthread.c                                       |   21 
 kernel/nsproxy.c                                       |    2 
 kernel/pid_namespace.c                                 |    5 
 kernel/sched/core.c                                    |   37 
 kernel/sched/sched.h                                   |    4 
 kernel/signal.c                                        |    2 
 kernel/sys_ni.c                                        |    1 
 kernel/sysctl.c                                        |    2 
 kernel/time/namespace.c                                |    4 
 kernel/time/posix-timers.c                             |    4 
 kernel/user_namespace.c                                |    2 
 lib/scatterlist.c                                      |    5 
 lib/test_kasan.c                                       |   80 -
 lib/test_kasan_module.c                                |   20 
 lib/test_vmalloc.c                                     |    5 
 mm/backing-dev.c                                       |   11 
 mm/bootmem_info.c                                      |    4 
 mm/compaction.c                                        |   69 -
 mm/debug_vm_pgtable.c                                  |  982 +++++++++------
 mm/filemap.c                                           |   15 
 mm/gup.c                                               |  109 -
 mm/huge_memory.c                                       |   32 
 mm/hugetlb.c                                           |  173 ++
 mm/hwpoison-inject.c                                   |    2 
 mm/internal.h                                          |    9 
 mm/kasan/hw_tags.c                                     |   43 
 mm/kasan/kasan.h                                       |    1 
 mm/kasan/report.c                                      |   29 
 mm/khugepaged.c                                        |    2 
 mm/ksm.c                                               |    8 
 mm/madvise.c                                           |    1 
 mm/memblock.c                                          |   22 
 mm/memcontrol.c                                        |  234 +--
 mm/memory-failure.c                                    |   53 
 mm/memory_hotplug.c                                    |    2 
 mm/mempolicy.c                                         |  207 ++-
 mm/migrate.c                                           |  319 ++++
 mm/mmap.c                                              |    7 
 mm/mremap.c                                            |    2 
 mm/oom_kill.c                                          |   70 +
 mm/page-writeback.c                                    |  133 +-
 mm/page_alloc.c                                        |   62 
 mm/page_isolation.c                                    |   13 
 mm/percpu.c                                            |    3 
 mm/shmem.c                                             |  309 ++--
 mm/slab_common.c                                       |    2 
 mm/slub.c                                              | 1085 ++++++++++-------
 mm/sparse.c                                            |   46 
 mm/swap.c                                              |   22 
 mm/swapfile.c                                          |   14 
 mm/truncate.c                                          |   28 
 mm/userfaultfd.c                                       |   15 
 mm/vmalloc.c                                           |   79 -
 mm/vmpressure.c                                        |   10 
 mm/vmscan.c                                            |  220 ++-
 mm/vmstat.c                                            |   25 
 security/tomoyo/domain.c                               |   13 
 tools/testing/scatterlist/linux/mm.h                   |    1 
 tools/testing/selftests/vm/.gitignore                  |    1 
 tools/testing/selftests/vm/Makefile                    |    3 
 tools/testing/selftests/vm/charge_reserved_hugetlb.sh  |    5 
 tools/testing/selftests/vm/hugetlb_reparenting_test.sh |    5 
 tools/testing/selftests/vm/ksm_tests.c                 |  696 ++++++++++
 tools/testing/selftests/vm/mlock-random-test.c         |    2 
 tools/testing/selftests/vm/run_vmtests.sh              |   98 +
 tools/testing/selftests/vm/userfaultfd.c               |   13 
 186 files changed, 4488 insertions(+), 2281 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-08-25 19:17 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9.

Subsystems affected by this patch series:

  mm/memory-hotplug
  MAINTAINERS

Subsystem: mm/memory-hotplug

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory_hotplug: fix potential permanent lru cache disable

Subsystem: MAINTAINERS

    Namjae Jeon <namjae.jeon@samsung.com>:
      MAINTAINERS: exfat: update my email address

 MAINTAINERS         |    2 +-
 mm/memory_hotplug.c |    1 +
 2 files changed, 2 insertions(+), 1 deletion(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-08-20  2:03 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-08-20  2:03 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

10 patches, based on 614cb2751d3150850d459bee596c397f344a7936.

Subsystems affected by this patch series:

  mm/shmem
  mm/pagealloc
  mm/tracing
  MAINTAINERS
  mm/memcg
  mm/memory-failure
  mm/vmscan
  mm/kfence
  mm/hugetlb

Subsystem: mm/shmem

    Yang Shi <shy828301@gmail.com>:
      Revert "mm/shmem: fix shmem_swapin() race with swapoff"
      Revert "mm: swap: check if swap backing device is congested or not"

Subsystem: mm/pagealloc

    Doug Berger <opendmb@gmail.com>:
      mm/page_alloc: don't corrupt pcppage_migratetype

Subsystem: mm/tracing

    Mike Rapoport <rppt@linux.ibm.com>:
      mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS: update ClangBuiltLinux IRC chat

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: retry with shake_page() for unhandlable pages

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: vmscan: fix missing psi annotation for node_reclaim()

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: don't pass page cache pages to restore_reserve_on_error

 MAINTAINERS                    |    2 +-
 include/linux/kfence.h         |    7 ++++---
 include/linux/memcontrol.h     |   29 +++++++++++++++--------------
 include/trace/events/mmflags.h |    4 +++-
 mm/hugetlb.c                   |   19 ++++++++++++++-----
 mm/memory-failure.c            |   12 +++++++++---
 mm/page_alloc.c                |   25 ++++++++++++-------------
 mm/shmem.c                     |   14 +-------------
 mm/swap_state.c                |    7 -------
 mm/vmscan.c                    |   30 ++++++++++++++++++++++--------
 10 files changed, 81 insertions(+), 68 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-08-13 23:53 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008.

Subsystems affected by this patch series:

  mm/kasan
  mm/slub
  mm/madvise
  mm/memcg
  lib

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
    Patch series "kasan, slub: reset tag when printing address", v3:
      kasan, kmemleak: reset tags when scanning block
      kasan, slub: reset tag when printing address

Subsystem: mm/slub

    Shakeel Butt <shakeelb@google.com>:
      slub: fix kmalloc_pagealloc_invalid_free unit test

    Vlastimil Babka <vbabka@suse.cz>:
      mm: slub: fix slub_debug disabling for list of slabs

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
      mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE)

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
      mm/memcg: fix incorrect flushing of lruvec data in obj_stock

Subsystem: lib

    Liang Wang <wangliang101@huawei.com>:
      lib: use PFN_PHYS() in devmem_is_allowed()

 lib/devmem_is_allowed.c |    2 +-
 mm/gup.c                |    7 +++++--
 mm/kmemleak.c           |    6 +++---
 mm/madvise.c            |    4 +++-
 mm/memcontrol.c         |    6 ++++--
 mm/slub.c               |   25 ++++++++++++++-----------
 6 files changed, 30 insertions(+), 20 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-07-29 21:52 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2.

Subsystems affected by this patch series:

  lib
  ocfs2
  mm/memcg
  mm/migration
  mm/slub
  mm/memcg

Subsystem: lib

    Matteo Croce <mcroce@microsoft.com>:
      lib/test_string.c: move string selftest in the Runtime Testing menu

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: fix zero out valid data
      ocfs2: issue zeroout to EOF blocks

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code

Subsystem: mm/migration

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/migrate: fix NR_ISOLATED corruption on 64-bit

Subsystem: mm/slub

    Shakeel Butt <shakeelb@google.com>:
      slub: fix unreclaimable slab stat for bulk free

Subsystem: mm/memcg

    Wang Hai <wanghai38@huawei.com>:
      mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook()

 fs/ocfs2/file.c   |  103 ++++++++++++++++++++++++++++++++----------------------
 lib/Kconfig       |    3 -
 lib/Kconfig.debug |    3 +
 mm/memcontrol.c   |    3 +
 mm/migrate.c      |    2 -
 mm/slab.h         |    2 -
 mm/slub.c         |   22 ++++++-----
 7 files changed, 81 insertions(+), 57 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-07-23 22:49 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55.

Subsystems affected by this patch series:

  mm/userfaultfd
  mm/kfence
  mm/highmem
  mm/pagealloc
  mm/memblock
  mm/pagecache
  mm/secretmem
  mm/pagemap
  mm/hugetlbfs

Subsystem: mm/userfaultfd

    Peter Collingbourne <pcc@google.com>:
    Patch series "userfaultfd: do not untag user pointers", v5:
      userfaultfd: do not untag user pointers
      selftest: use mmap instead of posix_memalign to allocate memory

Subsystem: mm/kfence

    Weizhao Ouyang <o451686892@gmail.com>:
      kfence: defer kfence_test_init to ensure that kunit debugfs is created

    Alexander Potapenko <glider@google.com>:
      kfence: move the size check to the beginning of __kfence_alloc()
      kfence: skip all GFP_ZONEMASK allocations

Subsystem: mm/highmem

    Christoph Hellwig <hch@lst.de>:
      mm: call flush_dcache_page() in memcpy_to_page() and memzero_page()
      mm: use kmap_local_page in memzero_page

Subsystem: mm/pagealloc

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions

Subsystem: mm/pagecache

    Roman Gushchin <guro@fb.com>:
      writeback, cgroup: remove wb from offline list before releasing refcnt
      writeback, cgroup: do not reparent dax inodes

Subsystem: mm/secretmem

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/secretmem: wire up ->set_page_dirty

Subsystem: mm/pagemap

    Muchun Song <songmuchun@bytedance.com>:
      mm: mmap_lock: fix disabling preemption directly

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm: fix the deadlock in finish_fault()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: fix mount mode command line processing

 Documentation/arm64/tagged-address-abi.rst |   26 ++++++++++++++++++--------
 fs/fs-writeback.c                          |    3 +++
 fs/hugetlbfs/inode.c                       |    2 +-
 fs/userfaultfd.c                           |   26 ++++++++++++--------------
 include/linux/highmem.h                    |    6 ++++--
 include/linux/memblock.h                   |    4 ++--
 mm/backing-dev.c                           |    2 +-
 mm/kfence/core.c                           |   19 ++++++++++++++++---
 mm/kfence/kfence_test.c                    |    2 +-
 mm/memblock.c                              |    3 ++-
 mm/memory.c                                |   11 ++++++++++-
 mm/mmap_lock.c                             |    4 ++--
 mm/page_alloc.c                            |   29 ++++++++++++++++-------------
 mm/secretmem.c                             |    1 +
 tools/testing/selftests/vm/userfaultfd.c   |    6 ++++--
 15 files changed, 93 insertions(+), 51 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-07-15  4:26 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-07-15  4:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e.

Subsystems affected by this patch series:

  mm/kasan
  mm/pagealloc
  mm/rmap
  mm/hmm
  hfs
  mm/hugetlb

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      mm: move helper to check slub_debug_enabled

    Yee Lee <yee.lee@mediatek.com>:
      kasan: add memzero init for unaligned size at DEBUG

    Marco Elver <elver@google.com>:
      kasan: fix build by including kernel.h

Subsystem: mm/pagealloc

    Matteo Croce <mcroce@microsoft.com>:
      Revert "mm/page_alloc: make should_fail_alloc_page() static"

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: avoid page allocator recursion with pagesets.lock held

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/page_alloc: correct return value when failing at preparing

    Chuck Lever <chuck.lever@oracle.com>:
      mm/page_alloc: further fix __alloc_pages_bulk() return value

Subsystem: mm/rmap

    Christoph Hellwig <hch@lst.de>:
      mm: fix the try_to_unmap prototype for !CONFIG_MMU

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
      lib/test_hmm: remove set but unused page variable

Subsystem: hfs

    Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
    Patch series "hfs: fix various errors", v2:
      hfs: add missing clean-up in hfs_fill_super
      hfs: fix high memory mapping in hfs_bnode_read
      hfs: add lock nesting notation to hfs_find_init

Subsystem: mm/hugetlb

    Joao Martins <joao.m.martins@oracle.com>:
      mm/hugetlb: fix refs calculation from unaligned @vaddr

 fs/hfs/bfind.c        |   14 +++++++++++++-
 fs/hfs/bnode.c        |   25 ++++++++++++++++++++-----
 fs/hfs/btree.h        |    7 +++++++
 fs/hfs/super.c        |   10 +++++-----
 include/linux/kasan.h |    1 +
 include/linux/rmap.h  |    4 +++-
 lib/test_hmm.c        |    2 --
 mm/hugetlb.c          |    5 +++--
 mm/kasan/kasan.h      |   12 ++++++++++++
 mm/page_alloc.c       |   30 ++++++++++++++++++++++--------
 mm/slab.h             |   15 +++++++++++----
 mm/slub.c             |   14 --------------
 12 files changed, 97 insertions(+), 42 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-07-08  0:59 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-07-08  0:59 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d.

Subsystems affected by this patch series:

  lib
  mm/slub
  mm/secretmem
  mm/cleanups
  mm/init
  debug
  mm/pagemap
  mm/mremap

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/test: fix spelling mistakes
      lib: fix spelling mistakes
      lib: fix spelling mistakes in header files

Subsystem: mm/slub

    Nathan Chancellor <nathan@kernel.org>:
    Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN":
      hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script
      hexagon: use common DISCARDS macro
      hexagon: select ARCH_WANT_LD_ORPHAN_WARN

    Oliver Glitta <glittao@gmail.com>:
      mm/slub: use stackdepot to save stack trace in objects

Subsystem: mm/secretmem

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20:
      mmap: make mlock_future_check() global
      riscv/Kconfig: make direct map manipulation options depend on MMU
      set_memory: allow querying whether set_direct_map_*() is actually enabled
      mm: introduce memfd_secret system call to create "secret" memory areas
      PM: hibernate: disable when there are active secretmem users
      arch, mm: wire up memfd_secret system call where relevant
      secretmem: test: add basic selftest for memfd_secret(2)

Subsystem: mm/cleanups

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm: fix spelling mistakes in header files

Subsystem: mm/init

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3:
      mm: add setup_initial_init_mm() helper
      arc: convert to setup_initial_init_mm()
      arm: convert to setup_initial_init_mm()
      arm64: convert to setup_initial_init_mm()
      csky: convert to setup_initial_init_mm()
      h8300: convert to setup_initial_init_mm()
      m68k: convert to setup_initial_init_mm()
      nds32: convert to setup_initial_init_mm()
      nios2: convert to setup_initial_init_mm()
      openrisc: convert to setup_initial_init_mm()
      powerpc: convert to setup_initial_init_mm()
      riscv: convert to setup_initial_init_mm()
      s390: convert to setup_initial_init_mm()
      sh: convert to setup_initial_init_mm()
      x86: convert to setup_initial_init_mm()

Subsystem: debug

    Stephen Boyd <swboyd@chromium.org>:
    Patch series "Add build ID to stacktraces", v6:
      buildid: only consider GNU notes for build ID parsing
      buildid: add API to parse build ID out of buffer
      buildid: stash away kernels build ID on init
      dump_stack: add vmlinux build ID to stack traces
      module: add printk formats to add module build ID to stacktraces
      arm64: stacktrace: use %pSb for backtrace printing
      x86/dumpstack: use %pSb/%pBb for backtrace printing
      scripts/decode_stacktrace.sh: support debuginfod
      scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm
      scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path
      buildid: mark some arguments const
      buildid: fix kernel-doc notation
      kdump: use vmlinux_build_id to simplify

Subsystem: mm/pagemap

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t *
      mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t *

Subsystem: mm/mremap

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mrermap fixes", v2:
      selftest/mremap_test: update the test to handle pagesize other than 4K
      selftest/mremap_test: avoid crash with static build
      mm/mremap: convert huge PUD move to separate helper
      mm/mremap: don't enable optimized PUD move if page table levels is 2
      mm/mremap: use pmd/pud_poplulate to update page table entries
      mm/mremap: hold the rmap lock in write mode when moving page table entries.
    Patch series "Speedup mremap on ppc64", v8:
      mm/mremap: allow arch runtime override
      powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache
      powerpc/mm: enable HAVE_MOVE_PMD support

 Documentation/core-api/printk-formats.rst           |   11 
 arch/alpha/include/asm/pgtable.h                    |    8 
 arch/arc/mm/init.c                                  |    5 
 arch/arm/include/asm/pgtable-3level.h               |    2 
 arch/arm/kernel/setup.c                             |    5 
 arch/arm64/include/asm/Kbuild                       |    1 
 arch/arm64/include/asm/cacheflush.h                 |    6 
 arch/arm64/include/asm/kfence.h                     |    2 
 arch/arm64/include/asm/pgtable.h                    |    8 
 arch/arm64/include/asm/set_memory.h                 |   17 +
 arch/arm64/include/uapi/asm/unistd.h                |    1 
 arch/arm64/kernel/machine_kexec.c                   |    1 
 arch/arm64/kernel/setup.c                           |    5 
 arch/arm64/kernel/stacktrace.c                      |    2 
 arch/arm64/mm/mmu.c                                 |    7 
 arch/arm64/mm/pageattr.c                            |   13 
 arch/csky/kernel/setup.c                            |    5 
 arch/h8300/kernel/setup.c                           |    5 
 arch/hexagon/Kconfig                                |    1 
 arch/hexagon/kernel/vmlinux.lds.S                   |    9 
 arch/ia64/include/asm/pgtable.h                     |    4 
 arch/m68k/include/asm/motorola_pgtable.h            |    2 
 arch/m68k/kernel/setup_mm.c                         |    5 
 arch/m68k/kernel/setup_no.c                         |    5 
 arch/mips/include/asm/pgtable-64.h                  |    8 
 arch/nds32/kernel/setup.c                           |    5 
 arch/nios2/kernel/setup.c                           |    5 
 arch/openrisc/kernel/setup.c                        |    5 
 arch/parisc/include/asm/pgtable.h                   |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h        |   11 
 arch/powerpc/include/asm/book3s/64/tlbflush-radix.h |    2 
 arch/powerpc/include/asm/nohash/64/pgtable-4k.h     |    6 
 arch/powerpc/include/asm/nohash/64/pgtable.h        |    6 
 arch/powerpc/include/asm/tlb.h                      |    6 
 arch/powerpc/kernel/setup-common.c                  |    5 
 arch/powerpc/mm/book3s64/radix_hugetlbpage.c        |    8 
 arch/powerpc/mm/book3s64/radix_pgtable.c            |    6 
 arch/powerpc/mm/book3s64/radix_tlb.c                |   44 +-
 arch/powerpc/mm/pgtable_64.c                        |    4 
 arch/powerpc/platforms/Kconfig.cputype              |    2 
 arch/riscv/Kconfig                                  |    4 
 arch/riscv/include/asm/pgtable-64.h                 |    4 
 arch/riscv/include/asm/unistd.h                     |    1 
 arch/riscv/kernel/setup.c                           |    5 
 arch/s390/kernel/setup.c                            |    5 
 arch/sh/include/asm/pgtable-3level.h                |    4 
 arch/sh/kernel/setup.c                              |    5 
 arch/sparc/include/asm/pgtable_32.h                 |    6 
 arch/sparc/include/asm/pgtable_64.h                 |   10 
 arch/um/include/asm/pgtable-3level.h                |    2 
 arch/x86/entry/syscalls/syscall_32.tbl              |    1 
 arch/x86/entry/syscalls/syscall_64.tbl              |    1 
 arch/x86/include/asm/pgtable.h                      |    8 
 arch/x86/kernel/dumpstack.c                         |    2 
 arch/x86/kernel/setup.c                             |    5 
 arch/x86/mm/init_64.c                               |    4 
 arch/x86/mm/pat/set_memory.c                        |    4 
 arch/x86/mm/pgtable.c                               |    2 
 include/asm-generic/pgtable-nop4d.h                 |    2 
 include/asm-generic/pgtable-nopmd.h                 |    2 
 include/asm-generic/pgtable-nopud.h                 |    4 
 include/linux/bootconfig.h                          |    4 
 include/linux/buildid.h                             |   10 
 include/linux/compaction.h                          |    4 
 include/linux/cpumask.h                             |    2 
 include/linux/crash_core.h                          |   12 
 include/linux/debugobjects.h                        |    2 
 include/linux/hmm.h                                 |    2 
 include/linux/hugetlb.h                             |    6 
 include/linux/kallsyms.h                            |   21 +
 include/linux/list_lru.h                            |    4 
 include/linux/lru_cache.h                           |    8 
 include/linux/mm.h                                  |    3 
 include/linux/mmu_notifier.h                        |    8 
 include/linux/module.h                              |    9 
 include/linux/nodemask.h                            |    6 
 include/linux/percpu-defs.h                         |    2 
 include/linux/percpu-refcount.h                     |    2 
 include/linux/pgtable.h                             |    4 
 include/linux/scatterlist.h                         |    2 
 include/linux/secretmem.h                           |   54 +++
 include/linux/set_memory.h                          |   12 
 include/linux/shrinker.h                            |    2 
 include/linux/syscalls.h                            |    1 
 include/linux/vmalloc.h                             |    4 
 include/uapi/asm-generic/unistd.h                   |    7 
 include/uapi/linux/magic.h                          |    1 
 init/Kconfig                                        |    1 
 init/main.c                                         |    2 
 kernel/crash_core.c                                 |   50 ---
 kernel/kallsyms.c                                   |  104 +++++--
 kernel/module.c                                     |   42 ++
 kernel/power/hibernate.c                            |    5 
 kernel/sys_ni.c                                     |    2 
 lib/Kconfig.debug                                   |   17 -
 lib/asn1_encoder.c                                  |    2 
 lib/buildid.c                                       |   80 ++++-
 lib/devres.c                                        |    2 
 lib/dump_stack.c                                    |   13 
 lib/dynamic_debug.c                                 |    2 
 lib/fonts/font_pearl_8x8.c                          |    2 
 lib/kfifo.c                                         |    2 
 lib/list_sort.c                                     |    2 
 lib/nlattr.c                                        |    4 
 lib/oid_registry.c                                  |    2 
 lib/pldmfw/pldmfw.c                                 |    2 
 lib/reed_solomon/test_rslib.c                       |    2 
 lib/refcount.c                                      |    2 
 lib/rhashtable.c                                    |    2 
 lib/sbitmap.c                                       |    2 
 lib/scatterlist.c                                   |    4 
 lib/seq_buf.c                                       |    2 
 lib/sort.c                                          |    2 
 lib/stackdepot.c                                    |    2 
 lib/test_bitops.c                                   |    2 
 lib/test_bpf.c                                      |    2 
 lib/test_kasan.c                                    |    2 
 lib/test_kmod.c                                     |    6 
 lib/test_scanf.c                                    |    2 
 lib/vsprintf.c                                      |   10 
 mm/Kconfig                                          |    4 
 mm/Makefile                                         |    1 
 mm/gup.c                                            |   12 
 mm/init-mm.c                                        |    9 
 mm/internal.h                                       |    3 
 mm/mlock.c                                          |    3 
 mm/mmap.c                                           |    5 
 mm/mremap.c                                         |  108 ++++++-
 mm/secretmem.c                                      |  254 +++++++++++++++++
 mm/slub.c                                           |   79 +++--
 scripts/checksyscalls.sh                            |    4 
 scripts/decode_stacktrace.sh                        |   89 +++++-
 tools/testing/selftests/vm/.gitignore               |    1 
 tools/testing/selftests/vm/Makefile                 |    3 
 tools/testing/selftests/vm/memfd_secret.c           |  296 ++++++++++++++++++++
 tools/testing/selftests/vm/mremap_test.c            |  116 ++++---
 tools/testing/selftests/vm/run_vmtests.sh           |   17 +
 137 files changed, 1470 insertions(+), 442 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-07-03  0:28 ` incoming Linus Torvalds
@ 2021-07-03  1:06   ` Linus Torvalds
  0 siblings, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2021-07-03  1:06 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
> at the pulls and merges I've done since, this -mm series looks like
> the obvious culprit.

No, unless my bisection is wrong, the -mm branch is innocent, and was
discarded from the suspects on the very first bisection trial.

So never mind.

             Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-07-01  1:46 incoming Andrew Morton
@ 2021-07-03  0:28 ` Linus Torvalds
  2021-07-03  1:06   ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2021-07-03  0:28 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> This is the rest of the -mm tree, less 66 patches which are dependent on
> things which are (or were recently) in linux-next.  I'll trickle that
> material over next week.

I haven't bisected this yet, but with the current -git I'm getting

   watchdog: BUG: soft lockup - CPU#41 stuck for 49s!

and the common call chain seems to be in flush_tlb_mm_range ->
on_each_cpu_cond_mask.

Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
at the pulls and merges I've done since, this -mm series looks like
the obvious culprit.

I'll go start bisection, but I thought I'd give a heads-up in case
somebody else has seen TLB-flush-related lockups and already figured
out the guilty party..

                 Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-07-01  1:46 Andrew Morton
  2021-07-03  0:28 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-07-01  1:46 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


This is the rest of the -mm tree, less 66 patches which are dependent on
things which are (or were recently) in linux-next.  I'll trickle that
material over next week.


192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the
June 28 sendings.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/kconfig
  mm/proc
  mm/z3fold
  mm/zbud
  mm/ras
  mm/mempolicy
  mm/memblock
  mm/migration
  mm/thp
  mm/nommu
  mm/kconfig
  mm/madvise
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/zram
  mm/cleanups
  mm/kfence
  mm/hmm
  procfs
  sysctl
  misc
  core-kernel
  lib
  lz4
  checkpatch
  init
  kprobes
  nilfs2
  hfs
  signals
  exec
  kcov
  selftests
  compress/decompress
  ipc

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Free some vmemmap pages of HugeTLB page", v23:
      mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c
      mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP
      mm: hugetlb: gather discrete indexes of tail page
      mm: hugetlb: free the vmemmap pages associated with each HugeTLB page
      mm: hugetlb: defer freeing of HugeTLB pages
      mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page
      mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap
      mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled
      mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate

    Shixin Liu <liushixin2@huawei.com>:
      mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE
      mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for huge_memory:, v3:
      mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK
      mm/huge_memory.c: use page->deferred_list
      mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled()
      mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd
      mm/huge_memory.c: don't discard hugepage if other processes are mapping it

    Christophe Leroy <christophe.leroy@csgroup.eu>:
    Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2:
      mm/hugetlb: change parameters of arch_make_huge_pte()
      mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge
      mm/vmalloc: enable mapping of huge pages at pte level in vmap
      mm/vmalloc: enable mapping of huge pages at pte level in vmalloc
      powerpc/8xx: add support for huge pages on VMAP and VMALLOC

    Nanyong Sun <sunnanyong@huawei.com>:
      khugepaged: selftests: remove debug_cow

    Mina Almasry <almasrymina@google.com>:
      mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Split huge PMD mapping of vmemmap pages", v4:
      mm: sparsemem: split the huge PMD mapping of vmemmap pages
      mm: sparsemem: use huge PMD mapping for vmemmap pages
      mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "Fix prep_compound_gigantic_page ref count adjustment":
      hugetlb: remove prep_compound_huge_page cleanup
      hugetlb: address ref count racing in prep_compound_gigantic_page

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: disable pcp for page_handle_poison()

Subsystem: mm/userfaultfd

    Peter Xu <peterx@redhat.com>:
    Patch series "userfaultfd/selftests: A few cleanups", v2:
      userfaultfd/selftests: use user mode only
      userfaultfd/selftests: remove the time() check on delayed uffd
      userfaultfd/selftests: dropping VERIFY check in locking_thread
      userfaultfd/selftests: only dump counts if mode enabled
      userfaultfd/selftests: unify error handling
    Patch series "mm/uffd: Misc fix for uffd-wp and one more test":
      mm/thp: simplify copying of huge zero page pmd when fork
      mm/userfaultfd: fix uffd-wp special cases for fork()
      mm/userfaultfd: fail uffd-wp registration if not supported
      mm/pagemap: export uffd-wp protection information
      userfaultfd/selftests: add pagemap uffd-wp test

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling for shmem", v6:
      userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte
      userfaultfd/shmem: support minor fault registration for shmem
      userfaultfd/shmem: support UFFDIO_CONTINUE for shmem
      userfaultfd/shmem: advertise shmem minor fault support
      userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte()
      userfaultfd/selftests: use memfd_create for shmem test type
      userfaultfd/selftests: create alias mappings in the shmem test
      userfaultfd/selftests: reinitialize test context in each test
      userfaultfd/selftests: exercise minor fault handling shmem support

Subsystem: mm/vmscan

    Yu Zhao <yuzhao@google.com>:
      mm/vmscan.c: fix potential deadlock in reclaim_pages()
      include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: workingset: define macro WORKINGSET_SHIFT

Subsystem: mm/kconfig

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm/kconfig: move HOLES_IN_ZONE into mm

Subsystem: mm/proc

    Mike Rapoport <rppt@linux.ibm.com>:
      docs: proc.rst: meminfo: briefly describe gaps in memory accounting

    David Hildenbrand <david@redhat.com>:
    Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3:
      fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER
      fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM
      fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages
      mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline()
      virtio-mem: use page_offline_(start|end) when setting PageOffline()
      fs/proc/kcore: use page_offline_(freeze|thaw)

Subsystem: mm/z3fold

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for z3fold":
      mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS
      mm/z3fold: avoid possible underflow in z3fold_alloc()
      mm/z3fold: remove magic number in z3fold_create_pool()
      mm/z3fold: remove unused function handle_to_z3fold_header()
      mm/z3fold: fix potential memory leak in z3fold_destroy_pool()
      mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page

Subsystem: mm/zbud

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for zbud", v2:
      mm/zbud: reuse unbuddied[0] as buddied in zbud_pool
      mm/zbud: don't export any zbud API

Subsystem: mm/ras

    YueHaibing <yuehaibing@huawei.com>:
      mm/compaction: use DEVICE_ATTR_WO macro

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm: compaction: remove duplicate !list_empty(&sublist) check

    Wonhyuk Yang <vvghjk1234@gmail.com>:
      mm/compaction: fix 'limit' in fast_isolate_freepages

Subsystem: mm/mempolicy

    Feng Tang <feng.tang@intel.com>:
    Patch series "mm/mempolicy: some fix and semantics cleanup", v4:
      mm/mempolicy: cleanup nodemask intersection check for oom
      mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy
      mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy

    Yang Shi <shy828301@gmail.com>:
      mm: mempolicy: don't have to split pmd for huge zero page

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4:
      include/linux/mmzone.h: add documentation for pfn_valid()
      memblock: update initialization of reserved pages
      arm64: decouple check whether pfn is in linear map from pfn_valid()
      arm64: drop pfn_valid_within() and simplify pfn_valid()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      arm64/mm: drop HAVE_ARCH_PFN_VALID

Subsystem: mm/migration

    Muchun Song <songmuchun@bytedance.com>:
      mm: migrate: fix missing update page_private to hugetlb_page_subpool

Subsystem: mm/thp

    Collin Fijalkovich <cfijalkovich@google.com>:
      mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs

    Yang Shi <shy828301@gmail.com>:
      mm: memory: add orig_pmd to struct vm_fault
      mm: memory: make numa_migrate_prep() non-static
      mm: thp: refactor NUMA fault handling
      mm: migrate: account THP NUMA migration counters correctly
      mm: migrate: don't split THP for misplaced NUMA page
      mm: migrate: check mapcount for THP instead of refcount
      mm: thp: skip make PMD PROT_NONE if THP migration is not supported

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2

    Yang Shi <shy828301@gmail.com>:
      mm: rmap: make try_to_unmap() void function

    Hugh Dickins <hughd@google.com>:
      mm/thp: remap_page() is only needed on anonymous THP
      mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/thp: fix strncpy warning

Subsystem: mm/nommu

    Chen Li <chenli@uniontech.com>:
      nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc

    Liam Howlett <liam.howlett@oracle.com>:
      mm/nommu: unexport do_munmap()

Subsystem: mm/kconfig

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: generalize ZONE_[DMA|DMA32]

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2:
      mm: make variable names for populate_vma_page_range() consistent
      mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables
      MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT
      selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore
      selftests/vm: add test for MADV_POPULATE_(READ|WRITE)

Subsystem: mm/memory-hotplug

    Liam Mark <lmark@codeaurora.org>:
      mm/memory_hotplug: rate limit page migration warnings

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: drop unneeded locking

Subsystem: mm/zswap

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for zswap":
      mm/zswap.c: remove unused function zswap_debugfs_exit()
      mm/zswap.c: avoid unnecessary copy-in at map time
      mm/zswap.c: fix two bugs in zswap_writeback_entry()

Subsystem: mm/zsmalloc

    Zhaoyang Huang <zhaoyang.huang@unisoc.com>:
      mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for zsmalloc":
      mm/zsmalloc.c: remove confusing code in obj_free()
      mm/zsmalloc.c: improve readability for async_free_zspage()

Subsystem: mm/zram

    Yue Hu <huyue2@yulong.com>:
      zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK

Subsystem: mm/cleanups

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm: fix typos and grammar error in comments

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: define default value for FIRST_USER_ADDRESS

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm: fix spelling mistakes

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Clean W=1 build warnings for mm/":
      mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages
      mm/vmalloc: include header for prototype of set_iounmap_nonlazy
      mm/page_alloc: make should_fail_alloc_page() static
      mm/mapping_dirty_helpers: remove double Note in kerneldoc
      mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection
      mm/memory_hotplug: fix kerneldoc comment for __try_online_node
      mm/memory_hotplug: fix kerneldoc comment for __remove_memory
      mm/zbud: add kerneldoc fields for zbud_pool
      mm/z3fold: add kerneldoc fields for z3fold_pool
      mm/swap: make swap_address_space an inline function
      mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations
      mm/page_alloc: move prototype for find_suitable_fallback
      mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: define default pmd_pgtable()

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: unconditionally use unbound work queue

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
    Patch series "Add support for SVM atomics in Nouveau", v11:
      mm: remove special swap entry functions
      mm/swapops: rework swap entry manipulation code
      mm/rmap: split try_to_munlock from try_to_unmap
      mm/rmap: split migration into its own function
      mm: rename migrate_pgmap_owner
      mm/memory.c: allow different return codes for copy_nonpresent_pte()
      mm: device exclusive memory access
      mm: selftests for exclusive device memory
      nouveau/svm: refactor nouveau_range_fault
      nouveau/svm: implement atomic SVM access

Subsystem: procfs

    Marcelo Henrique Cerri <marcelo.cerri@canonical.com>:
      proc: Avoid mixing integer types in mem_rw()

    ZHOUFENG <zhoufeng.zf@bytedance.com>:
      fs/proc/kcore.c: add mmap interface

    Kalesh Singh <kaleshsingh@google.com>:
      procfs: allow reading fdinfo with PTRACE_MODE_READ
      procfs/dmabuf: add inode number to /proc/*/fdinfo

Subsystem: sysctl

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      sysctl: remove redundant assignment to first

Subsystem: misc

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      drm: include only needed headers in ascii85.h

Subsystem: core-kernel

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out panic and oops helpers

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib: decompress_bunzip2: remove an unneeded semicolon

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
    Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3:
      lib/string_helpers: switch to use BIT() macro
      lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop
      lib/string_helpers: drop indentation level in string_escape_mem()
      lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII
      lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable
      lib/string_helpers: allow to append additional characters to be escaped
      lib/test-string_helpers: print flags in hexadecimal format
      lib/test-string_helpers: get rid of trailing comma in terminators
      lib/test-string_helpers: add test cases for new features
      MAINTAINERS: add myself as designated reviewer for generic string library
      seq_file: introduce seq_escape_mem()
      seq_file: add seq_escape_str() as replica of string_escape_str()
      seq_file: convert seq_escape() to use seq_escape_str()
      nfsd: avoid non-flexible API in seq_quote_mem()
      seq_file: drop unused *_escape_mem_ascii()

    Trent Piepho <tpiepho@gmail.com>:
      lib/math/rational.c: fix divide by zero
      lib/math/rational: add Kunit test cases

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/decompressors: fix spelling mistakes
      lib/mpi: fix spelling mistakes

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: memscan() fixlet
      lib: uninline simple_strtoull()

    Matteo Croce <mcroce@microsoft.com>:
      lib/test_string.c: allow module removal

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out kstrtox() and simple_strtox() to a separate header

Subsystem: lz4

    Rajat Asthana <thisisrast7@gmail.com>:
      lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static

    Dimitri John Ledkov <dimitri.ledkov@canonical.com>:
      lib/decompress_unlz4.c: correctly handle zero-padding around initrds.

Subsystem: checkpatch

    Guenter Roeck <linux@roeck-us.net>:
      checkpatch: scripts/spdxcheck.py now requires python3

    Joe Perches <joe@perches.com>:
      checkpatch: improve the indented label test

    Guenter Roeck <linux@roeck-us.net>:
      checkpatch: do not complain about positive return values starting with EPOLL

Subsystem: init

    Andrew Halaney <ahalaney@redhat.com>:
      init: print out unknown kernel parameters

Subsystem: kprobes

    Barry Song <song.bao.hua@hisilicon.com>:
      kprobes: remove duplicated strong free_insn_page in x86 and s390

Subsystem: nilfs2

    Colin Ian King <colin.king@canonical.com>:
      nilfs2: remove redundant continue statement in a while-loop

Subsystem: hfs

    Zhen Lei <thunder.leizhen@huawei.com>:
      hfsplus: remove unnecessary oom message

    Chung-Chiang Cheng <shepjeng@gmail.com>:
      hfsplus: report create_date to kstat.btime

Subsystem: signals

    Al Viro <viro@zeniv.linux.org.uk>:
      x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned

Subsystem: exec

    Alexey Dobriyan <adobriyan@gmail.com>:
      exec: remove checks in __register_bimfmt()

Subsystem: kcov

    Marco Elver <elver@google.com>:
      kcov: add __no_sanitize_coverage to fix noinstr for all architectures

Subsystem: selftests

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "selftests/vm/pkeys: Bug fixes and a new test":
      selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random
      selftests/vm/pkeys: handle negative sys_pkey_alloc() return code
      selftests/vm/pkeys: refill shadow register after implicit kernel write
      selftests/vm/pkeys: exercise x86 XSAVE init state

Subsystem: compress/decompress

    Yu Kuai <yukuai3@huawei.com>:
      lib/decompressors: remove set but not used variabled 'level'

Subsystem: ipc

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "ipc: allocations cleanup", v2:
      ipc sem: use kvmalloc for sem_undo allocation
      ipc: use kmalloc for msg_queue and shmid_kernel

    Manfred Spraul <manfred@colorfullife.com>:
      ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock
      ipc/util.c: use binary search for max_idx

 Documentation/admin-guide/kernel-parameters.txt    |   35 
 Documentation/admin-guide/mm/hugetlbpage.rst       |   11 
 Documentation/admin-guide/mm/memory-hotplug.rst    |   13 
 Documentation/admin-guide/mm/pagemap.rst           |    2 
 Documentation/admin-guide/mm/userfaultfd.rst       |    3 
 Documentation/core-api/kernel-api.rst              |    7 
 Documentation/filesystems/proc.rst                 |   48 
 Documentation/vm/hmm.rst                           |   19 
 Documentation/vm/unevictable-lru.rst               |   33 
 MAINTAINERS                                        |   10 
 arch/alpha/Kconfig                                 |    5 
 arch/alpha/include/asm/pgalloc.h                   |    1 
 arch/alpha/include/asm/pgtable.h                   |    1 
 arch/alpha/include/uapi/asm/mman.h                 |    3 
 arch/alpha/kernel/setup.c                          |    2 
 arch/arc/include/asm/pgalloc.h                     |    2 
 arch/arc/include/asm/pgtable.h                     |    8 
 arch/arm/Kconfig                                   |    3 
 arch/arm/include/asm/pgalloc.h                     |    1 
 arch/arm64/Kconfig                                 |   15 
 arch/arm64/include/asm/hugetlb.h                   |    3 
 arch/arm64/include/asm/memory.h                    |    2 
 arch/arm64/include/asm/page.h                      |    4 
 arch/arm64/include/asm/pgalloc.h                   |    1 
 arch/arm64/include/asm/pgtable.h                   |    2 
 arch/arm64/kernel/setup.c                          |    1 
 arch/arm64/kvm/mmu.c                               |    2 
 arch/arm64/mm/hugetlbpage.c                        |    5 
 arch/arm64/mm/init.c                               |   51 
 arch/arm64/mm/ioremap.c                            |    4 
 arch/arm64/mm/mmu.c                                |   22 
 arch/csky/include/asm/pgalloc.h                    |    2 
 arch/csky/include/asm/pgtable.h                    |    1 
 arch/hexagon/include/asm/pgtable.h                 |    4 
 arch/ia64/Kconfig                                  |    7 
 arch/ia64/include/asm/pal.h                        |    1 
 arch/ia64/include/asm/pgalloc.h                    |    1 
 arch/ia64/include/asm/pgtable.h                    |    1 
 arch/m68k/Kconfig                                  |    5 
 arch/m68k/include/asm/mcf_pgalloc.h                |    2 
 arch/m68k/include/asm/mcf_pgtable.h                |    2 
 arch/m68k/include/asm/motorola_pgalloc.h           |    1 
 arch/m68k/include/asm/motorola_pgtable.h           |    2 
 arch/m68k/include/asm/pgtable_mm.h                 |    1 
 arch/m68k/include/asm/sun3_pgalloc.h               |    1 
 arch/microblaze/Kconfig                            |    4 
 arch/microblaze/include/asm/pgalloc.h              |    2 
 arch/microblaze/include/asm/pgtable.h              |    2 
 arch/mips/Kconfig                                  |   10 
 arch/mips/include/asm/pgalloc.h                    |    1 
 arch/mips/include/asm/pgtable-32.h                 |    1 
 arch/mips/include/asm/pgtable-64.h                 |    1 
 arch/mips/include/uapi/asm/mman.h                  |    3 
 arch/mips/kernel/relocate.c                        |    1 
 arch/mips/sgi-ip22/ip22-reset.c                    |    1 
 arch/mips/sgi-ip32/ip32-reset.c                    |    1 
 arch/nds32/include/asm/pgalloc.h                   |    5 
 arch/nios2/include/asm/pgalloc.h                   |    1 
 arch/nios2/include/asm/pgtable.h                   |    2 
 arch/openrisc/include/asm/pgalloc.h                |    2 
 arch/openrisc/include/asm/pgtable.h                |    1 
 arch/parisc/include/asm/pgalloc.h                  |    1 
 arch/parisc/include/asm/pgtable.h                  |    2 
 arch/parisc/include/uapi/asm/mman.h                |    3 
 arch/parisc/kernel/pdc_chassis.c                   |    1 
 arch/powerpc/Kconfig                               |    6 
 arch/powerpc/include/asm/book3s/pgtable.h          |    1 
 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h   |    5 
 arch/powerpc/include/asm/nohash/32/mmu-8xx.h       |   43 
 arch/powerpc/include/asm/nohash/32/pgtable.h       |    1 
 arch/powerpc/include/asm/nohash/64/pgtable.h       |    2 
 arch/powerpc/include/asm/pgalloc.h                 |    5 
 arch/powerpc/include/asm/pgtable.h                 |    6 
 arch/powerpc/kernel/setup-common.c                 |    1 
 arch/powerpc/platforms/Kconfig.cputype             |    1 
 arch/riscv/Kconfig                                 |    5 
 arch/riscv/include/asm/pgalloc.h                   |    2 
 arch/riscv/include/asm/pgtable.h                   |    2 
 arch/s390/Kconfig                                  |    6 
 arch/s390/include/asm/pgalloc.h                    |    3 
 arch/s390/include/asm/pgtable.h                    |    5 
 arch/s390/kernel/ipl.c                             |    1 
 arch/s390/kernel/kprobes.c                         |    5 
 arch/s390/mm/pgtable.c                             |    2 
 arch/sh/include/asm/pgalloc.h                      |    1 
 arch/sh/include/asm/pgtable.h                      |    2 
 arch/sparc/Kconfig                                 |    5 
 arch/sparc/include/asm/pgalloc_32.h                |    1 
 arch/sparc/include/asm/pgalloc_64.h                |    1 
 arch/sparc/include/asm/pgtable_32.h                |    3 
 arch/sparc/include/asm/pgtable_64.h                |    8 
 arch/sparc/kernel/sstate.c                         |    1 
 arch/sparc/mm/hugetlbpage.c                        |    6 
 arch/sparc/mm/init_64.c                            |    1 
 arch/um/drivers/mconsole_kern.c                    |    1 
 arch/um/include/asm/pgalloc.h                      |    1 
 arch/um/include/asm/pgtable-2level.h               |    1 
 arch/um/include/asm/pgtable-3level.h               |    1 
 arch/um/kernel/um_arch.c                           |    1 
 arch/x86/Kconfig                                   |   17 
 arch/x86/include/asm/desc.h                        |    1 
 arch/x86/include/asm/pgalloc.h                     |    2 
 arch/x86/include/asm/pgtable_types.h               |    2 
 arch/x86/kernel/cpu/mshyperv.c                     |    1 
 arch/x86/kernel/kprobes/core.c                     |    6 
 arch/x86/kernel/setup.c                            |    1 
 arch/x86/mm/init_64.c                              |   21 
 arch/x86/mm/pgtable.c                              |   34 
 arch/x86/purgatory/purgatory.c                     |    2 
 arch/x86/xen/enlighten.c                           |    1 
 arch/xtensa/include/asm/pgalloc.h                  |    2 
 arch/xtensa/include/asm/pgtable.h                  |    1 
 arch/xtensa/include/uapi/asm/mman.h                |    3 
 arch/xtensa/platforms/iss/setup.c                  |    1 
 drivers/block/zram/zram_drv.h                      |    2 
 drivers/bus/brcmstb_gisb.c                         |    1 
 drivers/char/ipmi/ipmi_msghandler.c                |    1 
 drivers/clk/analogbits/wrpll-cln28hpc.c            |    4 
 drivers/edac/altera_edac.c                         |    1 
 drivers/firmware/google/gsmi.c                     |    1 
 drivers/gpu/drm/nouveau/include/nvif/if000c.h      |    1 
 drivers/gpu/drm/nouveau/nouveau_svm.c              |  162 ++-
 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h      |    1 
 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c |    6 
 drivers/hv/vmbus_drv.c                             |    1 
 drivers/hwtracing/coresight/coresight-cpu-debug.c  |    1 
 drivers/leds/trigger/ledtrig-activity.c            |    1 
 drivers/leds/trigger/ledtrig-heartbeat.c           |    1 
 drivers/leds/trigger/ledtrig-panic.c               |    1 
 drivers/misc/bcm-vk/bcm_vk_dev.c                   |    1 
 drivers/misc/ibmasm/heartbeat.c                    |    1 
 drivers/misc/pvpanic/pvpanic.c                     |    1 
 drivers/net/ipa/ipa_smp2p.c                        |    1 
 drivers/parisc/power.c                             |    1 
 drivers/power/reset/ltc2952-poweroff.c             |    1 
 drivers/remoteproc/remoteproc_core.c               |    1 
 drivers/s390/char/con3215.c                        |    1 
 drivers/s390/char/con3270.c                        |    1 
 drivers/s390/char/sclp.c                           |    1 
 drivers/s390/char/sclp_con.c                       |    1 
 drivers/s390/char/sclp_vt220.c                     |    1 
 drivers/s390/char/zcore.c                          |    1 
 drivers/soc/bcm/brcmstb/pm/pm-arm.c                |    1 
 drivers/staging/olpc_dcon/olpc_dcon.c              |    1 
 drivers/video/fbdev/hyperv_fb.c                    |    1 
 drivers/virtio/virtio_mem.c                        |    2 
 fs/Kconfig                                         |   15 
 fs/exec.c                                          |    3 
 fs/hfsplus/inode.c                                 |    5 
 fs/hfsplus/xattr.c                                 |    1 
 fs/nfsd/nfs4state.c                                |    2 
 fs/nilfs2/btree.c                                  |    1 
 fs/open.c                                          |   13 
 fs/proc/base.c                                     |    6 
 fs/proc/fd.c                                       |   20 
 fs/proc/kcore.c                                    |  136 ++
 fs/proc/task_mmu.c                                 |   34 
 fs/seq_file.c                                      |   43 
 fs/userfaultfd.c                                   |   15 
 include/asm-generic/bug.h                          |    3 
 include/linux/ascii85.h                            |    3 
 include/linux/bootmem_info.h                       |   68 +
 include/linux/compat.h                             |    2 
 include/linux/compiler-clang.h                     |   17 
 include/linux/compiler-gcc.h                       |    6 
 include/linux/compiler_types.h                     |    2 
 include/linux/huge_mm.h                            |   74 -
 include/linux/hugetlb.h                            |   80 +
 include/linux/hugetlb_cgroup.h                     |   19 
 include/linux/kcore.h                              |    3 
 include/linux/kernel.h                             |  227 ----
 include/linux/kprobes.h                            |    1 
 include/linux/kstrtox.h                            |  155 ++
 include/linux/memblock.h                           |    4 
 include/linux/memory_hotplug.h                     |   27 
 include/linux/mempolicy.h                          |    9 
 include/linux/memremap.h                           |    2 
 include/linux/migrate.h                            |   27 
 include/linux/mm.h                                 |   18 
 include/linux/mm_types.h                           |    2 
 include/linux/mmu_notifier.h                       |   26 
 include/linux/mmzone.h                             |   27 
 include/linux/mpi.h                                |    4 
 include/linux/page-flags.h                         |   22 
 include/linux/panic.h                              |   98 +
 include/linux/panic_notifier.h                     |   12 
 include/linux/pgtable.h                            |   44 
 include/linux/rmap.h                               |   13 
 include/linux/seq_file.h                           |   10 
 include/linux/shmem_fs.h                           |   19 
 include/linux/signal.h                             |    2 
 include/linux/string.h                             |    7 
 include/linux/string_helpers.h                     |   31 
 include/linux/sunrpc/cache.h                       |    1 
 include/linux/swap.h                               |   19 
 include/linux/swapops.h                            |  171 +--
 include/linux/thread_info.h                        |    1 
 include/linux/userfaultfd_k.h                      |    5 
 include/linux/vmalloc.h                            |   15 
 include/linux/zbud.h                               |   23 
 include/trace/events/vmscan.h                      |   41 
 include/uapi/asm-generic/mman-common.h             |    3 
 include/uapi/linux/mempolicy.h                     |    1 
 include/uapi/linux/userfaultfd.h                   |    7 
 init/main.c                                        |   42 
 ipc/msg.c                                          |    6 
 ipc/sem.c                                          |   25 
 ipc/shm.c                                          |    6 
 ipc/util.c                                         |   44 
 ipc/util.h                                         |    3 
 kernel/hung_task.c                                 |    1 
 kernel/kexec_core.c                                |    1 
 kernel/kprobes.c                                   |    2 
 kernel/panic.c                                     |    1 
 kernel/rcu/tree.c                                  |    2 
 kernel/signal.c                                    |   14 
 kernel/sysctl.c                                    |    4 
 kernel/trace/trace.c                               |    1 
 lib/Kconfig.debug                                  |   12 
 lib/decompress_bunzip2.c                           |    6 
 lib/decompress_unlz4.c                             |    8 
 lib/decompress_unlzo.c                             |    3 
 lib/decompress_unxz.c                              |    2 
 lib/decompress_unzstd.c                            |    4 
 lib/kstrtox.c                                      |    5 
 lib/lz4/lz4_decompress.c                           |    2 
 lib/math/Makefile                                  |    1 
 lib/math/rational-test.c                           |   56 +
 lib/math/rational.c                                |   16 
 lib/mpi/longlong.h                                 |    4 
 lib/mpi/mpicoder.c                                 |    6 
 lib/mpi/mpiutil.c                                  |    2 
 lib/parser.c                                       |    1 
 lib/string.c                                       |    2 
 lib/string_helpers.c                               |  142 +-
 lib/test-string_helpers.c                          |  157 ++-
 lib/test_hmm.c                                     |  127 ++
 lib/test_hmm_uapi.h                                |    2 
 lib/test_string.c                                  |    5 
 lib/vsprintf.c                                     |    1 
 lib/xz/xz_dec_bcj.c                                |    2 
 lib/xz/xz_dec_lzma2.c                              |    8 
 lib/zlib_inflate/inffast.c                         |    2 
 lib/zstd/huf.h                                     |    2 
 mm/Kconfig                                         |   16 
 mm/Makefile                                        |    2 
 mm/bootmem_info.c                                  |  127 ++
 mm/compaction.c                                    |   20 
 mm/debug_vm_pgtable.c                              |  109 --
 mm/gup.c                                           |   58 +
 mm/hmm.c                                           |   12 
 mm/huge_memory.c                                   |  269 ++---
 mm/hugetlb.c                                       |  369 +++++--
 mm/hugetlb_vmemmap.c                               |  332 ++++++
 mm/hugetlb_vmemmap.h                               |   53 -
 mm/internal.h                                      |   29 
 mm/kfence/core.c                                   |    4 
 mm/khugepaged.c                                    |   20 
 mm/madvise.c                                       |   66 +
 mm/mapping_dirty_helpers.c                         |    2 
 mm/memblock.c                                      |   28 
 mm/memcontrol.c                                    |    4 
 mm/memory-failure.c                                |   38 
 mm/memory.c                                        |  239 +++-
 mm/memory_hotplug.c                                |  161 ---
 mm/mempolicy.c                                     |  323 ++----
 mm/migrate.c                                       |  268 +----
 mm/mlock.c                                         |   12 
 mm/mmap_lock.c                                     |   59 -
 mm/mprotect.c                                      |   18 
 mm/nommu.c                                         |    5 
 mm/oom_kill.c                                      |    2 
 mm/page_alloc.c                                    |    5 
 mm/page_vma_mapped.c                               |   15 
 mm/rmap.c                                          |  644 +++++++++---
 mm/shmem.c                                         |  125 --
 mm/sparse-vmemmap.c                                |  432 +++++++-
 mm/sparse.c                                        |    1 
 mm/swap.c                                          |    2 
 mm/swapfile.c                                      |    2 
 mm/userfaultfd.c                                   |  249 ++--
 mm/util.c                                          |   40 
 mm/vmalloc.c                                       |   37 
 mm/vmscan.c                                        |   20 
 mm/workingset.c                                    |   10 
 mm/z3fold.c                                        |   39 
 mm/zbud.c                                          |  235 ++--
 mm/zsmalloc.c                                      |    5 
 mm/zswap.c                                         |   26 
 scripts/checkpatch.pl                              |   16 
 tools/testing/selftests/vm/.gitignore              |    3 
 tools/testing/selftests/vm/Makefile                |    5 
 tools/testing/selftests/vm/hmm-tests.c             |  158 +++
 tools/testing/selftests/vm/khugepaged.c            |    4 
 tools/testing/selftests/vm/madv_populate.c         |  342 ++++++
 tools/testing/selftests/vm/pkey-x86.h              |    1 
 tools/testing/selftests/vm/protection_keys.c       |   85 +
 tools/testing/selftests/vm/run_vmtests.sh          |   16 
 tools/testing/selftests/vm/userfaultfd.c           | 1094 ++++++++++-----------
 299 files changed, 6277 insertions(+), 3183 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-06-29  2:32 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-06-29  2:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2.

Subsystems affected by this patch series:

  mm/gup
  mm/pagealloc
  kthread
  ia64
  scripts
  ntfs
  squashfs
  ocfs2
  z
  kernel/watchdog
  mm/slab
  mm/slub
  mm/kmemleak
  mm/dax
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/bootmem
  mm/dma
  mm/tracing
  mm/vmalloc
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/memory-failure

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mm/gup: fix try_grab_compound_head() race with split_huge_page()

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc: fix memory map initialization for descending nodes

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: correct return value of populated elements if bulk array is populated

Subsystem: kthread

    Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
      kthread: switch to new kerneldoc syntax for named variable macro argument

    Petr Mladek <pmladek@suse.com>:
      kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: headers: drop duplicated words

    Arnd Bergmann <arnd@arndb.de>:
      ia64: mca_drv: fix incorrect array size calculation

Subsystem: scripts

    "Steven Rostedt (VMware)" <rostedt@goodmis.org>:
    Patch series "streamline_config.pl: Fix Perl spacing":
      streamline_config.pl: make spacing consistent
      streamline_config.pl: add softtabstop=4 for vim users

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
      ntfs: fix validity check for file name attribute

Subsystem: squashfs

    Vincent Whitchurch <vincent.whitchurch@axis.com>:
      squashfs: add option to panic on errors

Subsystem: ocfs2

    Yang Yingliang <yangyingliang@huawei.com>:
      ocfs2: remove unnecessary INIT_LIST_HEAD()

Subsystem: z

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: fix snprintf() checking

    Colin Ian King <colin.king@canonical.com>:
      ocfs2: remove redundant assignment to pointer queue

    Wan Jiabing <wanjiabing@vivo.com>:
      ocfs2: remove repeated uptodate check for buffer

    Chen Huang <chenhuang5@huawei.com>:
      ocfs2: replace simple_strtoull() with kstrtoull()

    Colin Ian King <colin.king@canonical.com>:
      ocfs2: remove redundant initialization of variable ret

Subsystem: kernel/watchdog

    Wang Qing <wangqing@vivo.com>:
      kernel: watchdog: modify the explanation related to watchdog thread
      doc: watchdog: modify the explanation related to watchdog thread
      doc: watchdog: modify the doc related to "watchdog/%u"

Subsystem: mm/slab

    gumingtao <gumingtao1225@gmail.com>:
      slab: use __func__ to trace function name

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      kunit: make test->lock irq safe

    Oliver Glitta <glittao@gmail.com>:
      mm/slub, kunit: add a KUnit test for SLUB debugging functionality
      slub: remove resiliency_test() function

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm, slub: change run-time assertion in kmalloc_index() to compile-time

    Stephen Boyd <swboyd@chromium.org>:
      slub: restore slub_debug=- behavior
      slub: actually use 'message' in restore_bytes()

    Joe Perches <joe@perches.com>:
      slub: indicate slab_fix() uses printf formats

    Stephen Boyd <swboyd@chromium.org>:
      slub: force on no_hash_pointers when slub_debug is enabled

    Faiyaz Mohammed <faiyazm@codeaurora.org>:
      mm: slub: move sysfs slab alloc/free interfaces to debugfs

    Georgi Djakov <quic_c_gdjako@quicinc.com>:
      mm/slub: add taint after the errors are printed

Subsystem: mm/kmemleak

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/kmemleak: fix possible wrong memory scanning period

Subsystem: mm/dax

    Jan Kara <jack@suse.cz>:
      dax: fix ENOMEM handling in grab_mapping_entry()

Subsystem: mm/debug

    Tang Bin <tangbin@cmss.chinamobile.com>:
      tools/vm/page_owner_sort.c: check malloc() return

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage()

    Nicolas Saenz Julienne <nsaenzju@redhat.com>:
      mm: mmap_lock: use local locks instead of disabling preemption

    Gavin Shan <gshan@redhat.com>:
    Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4:
      mm/page_reporting: fix code style in __page_reporting_request()
      mm/page_reporting: export reporting order as module parameter
      mm/page_reporting: allow driver to specify reporting order
      virtio_balloon: specify page reporting order if needed

Subsystem: mm/pagecache

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: page-writeback: kill get_writeback_state() comments

    Chi Wu <wuchi.zero@gmail.com>:
      mm/page-writeback: Fix performance when BDI's share of ratio is 0.
      mm/page-writeback: update the comment of Dirty position control
      mm/page-writeback: use __this_cpu_inc() in account_page_dirtied()

    Roman Gushchin <guro@fb.com>:
    Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9:
      writeback, cgroup: do not switch inodes with I_WILL_FREE flag
      writeback, cgroup: add smp_mb() to cgroup_writeback_umount()
      writeback, cgroup: increment isw_nr_in_flight before grabbing an inode
      writeback, cgroup: switch to rcu_work API in inode_switch_wbs()
      writeback, cgroup: keep list of inodes attached to bdi_writeback
      writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn()
      writeback, cgroup: support switching multiple inodes at once
      writeback, cgroup: release dying cgwbs by switching attached inodes

    Christoph Hellwig <hch@lst.de>:
    Patch series "remove the implicit .set_page_dirty default":
      fs: unexport __set_page_dirty
      fs: move ramfs_aops to libfs
      mm: require ->set_page_dirty to be explicitly wired up

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Further set_page_dirty cleanups":
      mm/writeback: move __set_page_dirty() to core mm
      mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers
      iomap: use __set_page_dirty_nobuffers
      fs: remove anon_set_page_dirty()
      fs: remove noop_set_page_dirty()
      mm: move page dirtying prototypes from mm.h

Subsystem: mm/gup

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2:
      mm/gup_benchmark: support threading

    Andrea Arcangeli <aarcange@redhat.com>:
      mm: gup: allow FOLL_PIN to scale in SMP
      mm: gup: pack has_pinned in MMF_HAS_PINNED

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: pagewalk: fix walk for hugepage tables

Subsystem: mm/swap

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "close various race windows for swap", v6:
      mm/swapfile: use percpu_ref to serialize against concurrent swapoff
      swap: fix do_swap_page() race with swapoff
      mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info()
      mm/shmem: fix shmem_swapin() race with swapoff
    Patch series "Cleanups for swap", v2:
      mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION
      mm/swap: remove unused local variable nr_shadows
      mm/swap_slots.c: delete meaningless forward declarations

    Huang Ying <ying.huang@intel.com>:
      mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info()
      mm: free idle swap cache page after COW
      swap: check mapping_empty() for swap cache before being freed

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
    Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6:
      mm/memcg: move mod_objcg_state() to memcontrol.c
      mm/memcg: cache vmstat data in percpu memcg_stock_pcp
      mm/memcg: improve refill_obj_stock() performance
      mm/memcg: optimize user context object stock access
    Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4:
      mm: memcg/slab: properly set up gfp flags for objcg pointer array
      mm: memcg/slab: create a new set of kmalloc-cg-<n> caches
      mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix root_mem_cgroup charging
    Patch series "memcontrol code cleanup and simplification", v3:
      mm: memcontrol: fix page charging in page replacement
      mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm
      mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec
      mm: memcontrol: simplify lruvec_holds_page_lru_lock
      mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec
      mm: memcontrol: simplify the logic of objcg pinning memcg
      mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock
      mm: vmscan: remove noinline_for_stack

    wenhuizhang <wenhui@gwmail.gwu.edu>:
      memcontrol: use flexible-array member

    Dan Schatzberg <schatzberg.dan@gmail.com>:
    Patch series "Charge loop device i/o to issuing cgroup", v14:
      loop: use worker per cgroup instead of kworker
      mm: charge active memcg when no mm is set
      loop: charge i/o to mem and blk cg

    Huilong Deng <denghuilong@cdjrlc.com>:
      mm: memcontrol: remove trailing semicolon in macros

Subsystem: mm/pagemap

    David Hildenbrand <david@redhat.com>:
    Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE":
      perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC
      binfmt: remove in-tree usage of MAP_EXECUTABLE
      mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff()

    Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>:
      mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap: introduce unlock_range() for code cleanup
      mm/mmap: use find_vma_intersection() in do_mmap() for overlap

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm/memory.c: fix comment of finish_mkwrite_fault()

    Liam Howlett <liam.howlett@oracle.com>:
    Patch series "mm: Add vma_lookup()", v2:
      mm: add vma_lookup(), update find_vma_intersection() comments
      drm/i915/selftests: use vma_lookup() in __igt_mmap()
      arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma()
      arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection()
      arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection()
      arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma()
      arch/mips/kernel/traps: use vma_lookup() instead of find_vma()
      arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush()
      x86/sgx: use vma_lookup() in sgx_encl_find()
      virt/kvm: use vma_lookup() instead of find_vma_intersection()
      vfio: use vma_lookup() instead of find_vma_intersection()
      net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive()
      drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages()
      media: videobuf2: use vma_lookup() in get_vaddr_frames()
      misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma()
      kernel/events/uprobes: use vma_lookup() in find_active_uprobe()
      lib/test_hmm: use vma_lookup() in dmirror_migrate()
      mm/ksm: use vma_lookup() in find_mergeable_vma()
      mm/migrate: use vma_lookup() in do_pages_stat_array()
      mm/mremap: use vma_lookup() in vma_to_resize()
      mm/memory.c: use vma_lookup() in __access_remote_vm()
      mm/mempolicy: use vma_lookup() in __access_remote_vm()

    Chen Li <chenli@uniontech.com>:
      mm: update legacy flush_tlb_* to use vma

Subsystem: mm/mprotect

    Peter Collingbourne <pcc@google.com>:
      mm: improve mprotect(R|W) efficiency on pages referenced once

Subsystem: mm/bootmem

    Souptick Joarder <jrdr.linux@gmail.com>:
      h8300: remove unused variable

Subsystem: mm/dma

    YueHaibing <yuehaibing@huawei.com>:
      mm/dmapool: use DEVICE_ATTR_RO macro

Subsystem: mm/tracing

    Vincent Whitchurch <vincent.whitchurch@axis.com>:
      mm, tracing: unify PFN format strings

Subsystem: mm/vmalloc

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
    Patch series "vmalloc() vs bulk allocator", v2:
      mm/page_alloc: add an alloc_pages_bulk_array_node() helper
      mm/vmalloc: switch to bulk allocator in __vmalloc_area_node()
      mm/vmalloc: print a warning message first on failure
      mm/vmalloc: remove quoted strings split across lines

    Uladzislau Rezki <urezki@gmail.com>:
      mm/vmalloc: fallback to a single page allocator

    Rafael Aquini <aquini@redhat.com>:
      mm: vmalloc: add cond_resched() in __vunmap()

Subsystem: mm/kasan

    Alexander Potapenko <glider@google.com>:
      printk: introduce dump_stack_lvl()
      kasan: use dump_stack_lvl(KERN_ERR) to print stacks

    David Gow <davidgow@google.com>:
      kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL()

    Daniel Axtens <dja@axtens.net>:
    Patch series "KASAN core changes for ppc64 radix KASAN", v16:
      kasan: allow an architecture to disable inline instrumentation
      kasan: allow architectures to provide an outline readiness check
      mm: define default MAX_PTRS_PER_* in include/pgtable.h
      kasan: use MAX_PTRS_PER_* for early shadow tables

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
    Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4:
      kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY
      kasan: integrate the common part of two KASAN tag-based modes
      kasan: add memory corruption identification support for hardware tag-based mode

Subsystem: mm/initialization

    Jungseung Lee <js07.lee@samsung.com>:
      mm: report which part of mem is being freed on initmem case

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/mmzone.h: simplify is_highmem_idx()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Constify struct page arguments":
      mm: make __dump_page static

    Aaron Tomlin <atomlin@redhat.com>:
      mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug: factor PagePoisoned out of __dump_page
      mm/page_owner: constify dump_page_owner
      mm: make compound_head const-preserving
      mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype
      mm: constify page_count and page_ref_count
      mm: optimise nth_page for contiguous memmap

    Heiner Kallweit <hkallweit1@gmail.com>:
      mm/page_alloc: switch to pr_debug

    Andrii Nakryiko <andrii@kernel.org>:
      kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: split per cpu page lists and zone stats
      mm/page_alloc: convert per-cpu list protection to local_lock
      mm/vmstat: convert NUMA statistics to basic NUMA counters
      mm/vmstat: inline NUMA event counter updates
      mm/page_alloc: batch the accounting updates in the bulk allocator
      mm/page_alloc: reduce duration that IRQs are disabled for VM counters
      mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok
      mm/page_alloc: avoid conflating IRQs disabled with zone->lock
      mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok

    Minchan Kim <minchan@kernel.org>:
      mm: page_alloc: dump migrate-failed pages only at -EBUSY

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2:
      mm/page_alloc: delete vm.percpu_pagelist_fraction
      mm/page_alloc: disassociate the pcp->high from pcp->batch
      mm/page_alloc: adjust pcp->high after CPU hotplug events
      mm/page_alloc: scale the number of pages that are batch freed
      mm/page_alloc: limit the number of pages on PCP lists when reclaim is active
      mm/page_alloc: introduce vm.percpu_pagelist_high_fraction

    Dong Aisheng <aisheng.dong@nxp.com>:
      mm: drop SECTION_SHIFT in code comments
      mm/page_alloc: improve memmap_pages dbg msg

    Liu Shixin <liushixin2@huawei.com>:
      mm/page_alloc: fix counting of managed_pages

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Allow high order pages to be stored on PCP", v2:
      mm/page_alloc: move free_the_page

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "Remove DISCONTIGMEM memory model", v3:
      alpha: remove DISCONTIGMEM and NUMA
      arc: update comment about HIGHMEM implementation
      arc: remove support for DISCONTIGMEM
      m68k: remove support for DISCONTIGMEM
      mm: remove CONFIG_DISCONTIGMEM
      arch, mm: remove stale mentions of DISCONIGMEM
      docs: remove description of DISCONTIGMEM
      mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA
      mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: allow high-order pages to be stored on the per-cpu lists
      mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: send SIGBUS with error virutal address
      mm,hwpoison: make get_hwpoison_page() call get_any_page()

 Documentation/admin-guide/kernel-parameters.txt    |    6 
 Documentation/admin-guide/lockup-watchdogs.rst     |    4 
 Documentation/admin-guide/sysctl/kernel.rst        |   10 
 Documentation/admin-guide/sysctl/vm.rst            |   52 -
 Documentation/dev-tools/kasan.rst                  |    9 
 Documentation/vm/memory-model.rst                  |   45 
 arch/alpha/Kconfig                                 |   22 
 arch/alpha/include/asm/machvec.h                   |    6 
 arch/alpha/include/asm/mmzone.h                    |  100 --
 arch/alpha/include/asm/pgtable.h                   |    4 
 arch/alpha/include/asm/topology.h                  |   39 
 arch/alpha/kernel/core_marvel.c                    |   53 -
 arch/alpha/kernel/core_wildfire.c                  |   29 
 arch/alpha/kernel/pci_iommu.c                      |   29 
 arch/alpha/kernel/proto.h                          |    8 
 arch/alpha/kernel/setup.c                          |   16 
 arch/alpha/kernel/sys_marvel.c                     |    5 
 arch/alpha/kernel/sys_wildfire.c                   |    5 
 arch/alpha/mm/Makefile                             |    2 
 arch/alpha/mm/init.c                               |    3 
 arch/alpha/mm/numa.c                               |  223 ----
 arch/arc/Kconfig                                   |   13 
 arch/arc/include/asm/mmzone.h                      |   40 
 arch/arc/kernel/troubleshoot.c                     |    8 
 arch/arc/mm/init.c                                 |   21 
 arch/arm/include/asm/tlbflush.h                    |   13 
 arch/arm/mm/tlb-v6.S                               |    2 
 arch/arm/mm/tlb-v7.S                               |    2 
 arch/arm64/Kconfig                                 |    2 
 arch/arm64/kvm/mmu.c                               |    2 
 arch/h8300/kernel/setup.c                          |    2 
 arch/ia64/Kconfig                                  |    2 
 arch/ia64/include/asm/pal.h                        |    2 
 arch/ia64/include/asm/spinlock.h                   |    2 
 arch/ia64/include/asm/uv/uv_hub.h                  |    2 
 arch/ia64/kernel/efi_stub.S                        |    2 
 arch/ia64/kernel/mca_drv.c                         |    2 
 arch/ia64/kernel/topology.c                        |    5 
 arch/ia64/mm/numa.c                                |    5 
 arch/m68k/Kconfig.cpu                              |   10 
 arch/m68k/include/asm/mmzone.h                     |   10 
 arch/m68k/include/asm/page.h                       |    2 
 arch/m68k/include/asm/page_mm.h                    |   35 
 arch/m68k/include/asm/tlbflush.h                   |    2 
 arch/m68k/kernel/sys_m68k.c                        |    4 
 arch/m68k/mm/init.c                                |   20 
 arch/mips/Kconfig                                  |    2 
 arch/mips/include/asm/mmzone.h                     |    8 
 arch/mips/include/asm/page.h                       |    2 
 arch/mips/kernel/traps.c                           |    4 
 arch/mips/mm/init.c                                |    7 
 arch/nds32/include/asm/memory.h                    |    6 
 arch/openrisc/include/asm/tlbflush.h               |    2 
 arch/powerpc/Kconfig                               |    2 
 arch/powerpc/include/asm/mmzone.h                  |    4 
 arch/powerpc/kernel/setup_64.c                     |    2 
 arch/powerpc/kernel/smp.c                          |    2 
 arch/powerpc/kexec/core.c                          |    4 
 arch/powerpc/kvm/book3s_hv.c                       |    4 
 arch/powerpc/kvm/book3s_hv_uvmem.c                 |    2 
 arch/powerpc/mm/Makefile                           |    2 
 arch/powerpc/mm/mem.c                              |    4 
 arch/riscv/Kconfig                                 |    2 
 arch/s390/Kconfig                                  |    2 
 arch/s390/include/asm/pgtable.h                    |    2 
 arch/sh/include/asm/mmzone.h                       |    4 
 arch/sh/kernel/topology.c                          |    2 
 arch/sh/mm/Kconfig                                 |    2 
 arch/sh/mm/init.c                                  |    2 
 arch/sparc/Kconfig                                 |    2 
 arch/sparc/include/asm/mmzone.h                    |    4 
 arch/sparc/kernel/smp_64.c                         |    2 
 arch/sparc/mm/init_64.c                            |   12 
 arch/x86/Kconfig                                   |    2 
 arch/x86/ia32/ia32_aout.c                          |    4 
 arch/x86/kernel/cpu/mce/core.c                     |   13 
 arch/x86/kernel/cpu/sgx/encl.h                     |    4 
 arch/x86/kernel/setup_percpu.c                     |    6 
 arch/x86/mm/init_32.c                              |    4 
 arch/xtensa/include/asm/page.h                     |    4 
 arch/xtensa/include/asm/tlbflush.h                 |    4 
 drivers/base/node.c                                |   18 
 drivers/block/loop.c                               |  270 ++++-
 drivers/block/loop.h                               |   15 
 drivers/dax/device.c                               |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c            |    4 
 drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c |    2 
 drivers/media/common/videobuf2/frame_vector.c      |    2 
 drivers/misc/sgi-gru/grufault.c                    |    4 
 drivers/vfio/vfio_iommu_type1.c                    |    2 
 drivers/virtio/virtio_balloon.c                    |   17 
 fs/adfs/inode.c                                    |    1 
 fs/affs/file.c                                     |    2 
 fs/bfs/file.c                                      |    1 
 fs/binfmt_aout.c                                   |    4 
 fs/binfmt_elf.c                                    |    2 
 fs/binfmt_elf_fdpic.c                              |   11 
 fs/binfmt_flat.c                                   |    2 
 fs/block_dev.c                                     |    1 
 fs/buffer.c                                        |   25 
 fs/configfs/inode.c                                |    8 
 fs/dax.c                                           |    3 
 fs/ecryptfs/mmap.c                                 |   13 
 fs/exfat/inode.c                                   |    1 
 fs/ext2/inode.c                                    |    4 
 fs/ext4/inode.c                                    |    2 
 fs/fat/inode.c                                     |    1 
 fs/fs-writeback.c                                  |  366 +++++---
 fs/fuse/dax.c                                      |    3 
 fs/gfs2/aops.c                                     |    2 
 fs/gfs2/meta_io.c                                  |    2 
 fs/hfs/inode.c                                     |    2 
 fs/hfsplus/inode.c                                 |    2 
 fs/hpfs/file.c                                     |    1 
 fs/iomap/buffered-io.c                             |   27 
 fs/jfs/inode.c                                     |    1 
 fs/kernfs/inode.c                                  |    8 
 fs/libfs.c                                         |   44 
 fs/minix/inode.c                                   |    1 
 fs/nilfs2/mdt.c                                    |    1 
 fs/ntfs/inode.c                                    |    2 
 fs/ocfs2/aops.c                                    |    4 
 fs/ocfs2/cluster/heartbeat.c                       |    7 
 fs/ocfs2/cluster/nodemanager.c                     |    2 
 fs/ocfs2/dlm/dlmmaster.c                           |    2 
 fs/ocfs2/filecheck.c                               |    6 
 fs/ocfs2/stackglue.c                               |    8 
 fs/omfs/file.c                                     |    1 
 fs/proc/task_mmu.c                                 |    2 
 fs/ramfs/inode.c                                   |    9 
 fs/squashfs/block.c                                |    5 
 fs/squashfs/squashfs_fs_sb.h                       |    1 
 fs/squashfs/super.c                                |   86 +
 fs/sysv/itree.c                                    |    1 
 fs/udf/file.c                                      |    1 
 fs/udf/inode.c                                     |    1 
 fs/ufs/inode.c                                     |    1 
 fs/xfs/xfs_aops.c                                  |    4 
 fs/zonefs/super.c                                  |    4 
 include/asm-generic/memory_model.h                 |   37 
 include/asm-generic/pgtable-nop4d.h                |    1 
 include/asm-generic/topology.h                     |    2 
 include/kunit/test.h                               |    5 
 include/linux/backing-dev-defs.h                   |   20 
 include/linux/cpuhotplug.h                         |    2 
 include/linux/fs.h                                 |    6 
 include/linux/gfp.h                                |   13 
 include/linux/iomap.h                              |    1 
 include/linux/kasan.h                              |    7 
 include/linux/kernel.h                             |    2 
 include/linux/kthread.h                            |    2 
 include/linux/memblock.h                           |    6 
 include/linux/memcontrol.h                         |   60 -
 include/linux/mm.h                                 |   53 -
 include/linux/mm_types.h                           |   10 
 include/linux/mman.h                               |    2 
 include/linux/mmdebug.h                            |    3 
 include/linux/mmzone.h                             |   96 +-
 include/linux/page-flags.h                         |   10 
 include/linux/page_owner.h                         |    6 
 include/linux/page_ref.h                           |    4 
 include/linux/page_reporting.h                     |    3 
 include/linux/pageblock-flags.h                    |    2 
 include/linux/pagemap.h                            |    4 
 include/linux/pgtable.h                            |   22 
 include/linux/printk.h                             |    5 
 include/linux/sched/coredump.h                     |    8 
 include/linux/slab.h                               |   59 +
 include/linux/swap.h                               |   19 
 include/linux/swapops.h                            |    5 
 include/linux/vmstat.h                             |   69 -
 include/linux/writeback.h                          |    1 
 include/trace/events/cma.h                         |    4 
 include/trace/events/filemap.h                     |    2 
 include/trace/events/kmem.h                        |   12 
 include/trace/events/page_pool.h                   |    4 
 include/trace/events/pagemap.h                     |    4 
 include/trace/events/vmscan.h                      |    2 
 kernel/cgroup/cgroup.c                             |    1 
 kernel/crash_core.c                                |    4 
 kernel/events/core.c                               |    2 
 kernel/events/uprobes.c                            |    4 
 kernel/fork.c                                      |    1 
 kernel/kthread.c                                   |   19 
 kernel/sysctl.c                                    |   16 
 kernel/watchdog.c                                  |   12 
 lib/Kconfig.debug                                  |   15 
 lib/Kconfig.kasan                                  |   16 
 lib/Makefile                                       |    1 
 lib/dump_stack.c                                   |   20 
 lib/kunit/test.c                                   |   18 
 lib/slub_kunit.c                                   |  152 +++
 lib/test_hmm.c                                     |    5 
 lib/test_kasan.c                                   |   11 
 lib/vsprintf.c                                     |    2 
 mm/Kconfig                                         |   38 
 mm/backing-dev.c                                   |   66 +
 mm/compaction.c                                    |    2 
 mm/debug.c                                         |   27 
 mm/debug_vm_pgtable.c                              |   63 +
 mm/dmapool.c                                       |    5 
 mm/filemap.c                                       |    2 
 mm/gup.c                                           |   81 +
 mm/hugetlb.c                                       |    2 
 mm/internal.h                                      |    9 
 mm/kasan/Makefile                                  |    4 
 mm/kasan/common.c                                  |    6 
 mm/kasan/generic.c                                 |    3 
 mm/kasan/hw_tags.c                                 |   22 
 mm/kasan/init.c                                    |    6 
 mm/kasan/kasan.h                                   |   12 
 mm/kasan/report.c                                  |    6 
 mm/kasan/report_hw_tags.c                          |    5 
 mm/kasan/report_sw_tags.c                          |   45 
 mm/kasan/report_tags.c                             |   51 +
 mm/kasan/shadow.c                                  |    6 
 mm/kasan/sw_tags.c                                 |   45 
 mm/kasan/tags.c                                    |   59 +
 mm/kfence/kfence_test.c                            |    5 
 mm/kmemleak.c                                      |   18 
 mm/ksm.c                                           |    6 
 mm/memblock.c                                      |    8 
 mm/memcontrol.c                                    |  385 ++++++--
 mm/memory-failure.c                                |  344 +++++--
 mm/memory.c                                        |   22 
 mm/memory_hotplug.c                                |    6 
 mm/mempolicy.c                                     |    4 
 mm/migrate.c                                       |    4 
 mm/mmap.c                                          |   54 -
 mm/mmap_lock.c                                     |   33 
 mm/mprotect.c                                      |   52 +
 mm/mremap.c                                        |    5 
 mm/nommu.c                                         |    2 
 mm/page-writeback.c                                |   89 +
 mm/page_alloc.c                                    |  950 +++++++++++++--------
 mm/page_ext.c                                      |    2 
 mm/page_owner.c                                    |    2 
 mm/page_reporting.c                                |   19 
 mm/page_reporting.h                                |    5 
 mm/pagewalk.c                                      |   58 +
 mm/shmem.c                                         |   18 
 mm/slab.h                                          |   24 
 mm/slab_common.c                                   |   60 -
 mm/slub.c                                          |  420 +++++----
 mm/sparse.c                                        |    2 
 mm/swap.c                                          |    4 
 mm/swap_slots.c                                    |    2 
 mm/swap_state.c                                    |   20 
 mm/swapfile.c                                      |  177 +--
 mm/vmalloc.c                                       |  181 ++--
 mm/vmscan.c                                        |   43 
 mm/vmstat.c                                        |  282 ++----
 mm/workingset.c                                    |    2 
 net/ipv4/tcp.c                                     |    4 
 scripts/kconfig/streamline_config.pl               |   76 -
 scripts/link-vmlinux.sh                            |    4 
 scripts/spelling.txt                               |   16 
 tools/testing/selftests/vm/gup_test.c              |   96 +-
 tools/vm/page_owner_sort.c                         |    4 
 virt/kvm/kvm_main.c                                |    2 
 260 files changed, 3989 insertions(+), 2996 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-06-25  1:38 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-06-25  1:38 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6.

Subsystems affected by this patch series:

  mm/thp
  nilfs2
  mm/vmalloc
  kthread
  mm/hugetlb
  mm/memory-failure
  mm/pagealloc
  MAINTAINERS
  mailmap

Subsystem: mm/thp

    Hugh Dickins <hughd@google.com>:
    Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes":
      mm: page_vma_mapped_walk(): use page for pvmw->page
      mm: page_vma_mapped_walk(): settle PageHuge on entry
      mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd
      mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block
      mm: page_vma_mapped_walk(): crossing page table boundary
      mm: page_vma_mapped_walk(): add a level of indentation
      mm: page_vma_mapped_walk(): use goto instead of while (1)
      mm: page_vma_mapped_walk(): get vma_address_end() earlier
      mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes
      mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk()

Subsystem: nilfs2

    Pavel Skripkin <paskripkin@gmail.com>:
      nilfs2: fix memory leak in nilfs_sysfs_delete_device_group

Subsystem: mm/vmalloc

    Claudio Imbrenda <imbrenda@linux.ibm.com>:
    Patch series "mm: add vmalloc_no_huge and use it", v4:
      mm/vmalloc: add vmalloc_no_huge
      KVM: s390: prepare for hugepage vmalloc

    Daniel Axtens <dja@axtens.net>:
      mm/vmalloc: unbreak kasan vmalloc support

Subsystem: kthread

    Petr Mladek <pmladek@suse.com>:
    Patch series "kthread_worker: Fix race between kthread_mod_delayed_work():
      kthread_worker: split code for canceling the delayed work timer
      kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()

Subsystem: mm/hugetlb

    Hugh Dickins <hughd@google.com>:
      mm, futex: fix shared futex pgoff on shmem huge page

Subsystem: mm/memory-failure

    Tony Luck <tony.luck@intel.com>:
    Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5:
      mm/memory-failure: use a mutex to avoid memory_failure() races

    Aili Yao <yaoaili@kingsoft.com>:
      mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: do not lock page again when me_huge_page() successfully recovers

Subsystem: mm/pagealloc

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: do bulk array bounds check after checking populated elements

Subsystem: MAINTAINERS

    Marek Behún <kabel@kernel.org>:
      MAINTAINERS: fix Marek's identity again

Subsystem: mailmap

    Marek Behún <kabel@kernel.org>:
      mailmap: add Marek's other e-mail address and identity without diacritics

 .mailmap                |    2 
 MAINTAINERS             |    4 
 arch/s390/kvm/pv.c      |    7 +
 fs/nilfs2/sysfs.c       |    1 
 include/linux/hugetlb.h |   16 ---
 include/linux/pagemap.h |   13 +-
 include/linux/vmalloc.h |    1 
 kernel/futex.c          |    3 
 kernel/kthread.c        |   81 ++++++++++------
 mm/hugetlb.c            |    5 -
 mm/memory-failure.c     |   83 +++++++++++------
 mm/page_alloc.c         |    6 +
 mm/page_vma_mapped.c    |  233 +++++++++++++++++++++++++++---------------------
 mm/vmalloc.c            |   41 ++++++--
 14 files changed, 297 insertions(+), 199 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-06-16  1:22 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-06-16  1:22 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71.

Subsystems affected by this patch series:

  mm/memory-failure
  mm/swap
  mm/slub
  mm/hugetlb
  mm/memory-failure
  coredump
  mm/slub
  mm/thp
  mm/sparsemem

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: fix race with hugetlb page allocation

Subsystem: mm/swap

    Peter Xu <peterx@redhat.com>:
      mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare

Subsystem: mm/slub

    Kees Cook <keescook@chromium.org>:
    Patch series "Actually fix freelist pointer vs redzoning", v4:
      mm/slub: clarify verification reporting
      mm/slub: fix redzoning for small allocations
      mm/slub: actually fix freelist pointer vs redzoning

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: expand restore_reserve_on_error functionality

Subsystem: mm/memory-failure

    yangerkun <yangerkun@huawei.com>:
      mm/memory-failure: make sure wait for page writeback in memory_failure

Subsystem: coredump

    Pingfan Liu <kernelfans@gmail.com>:
      crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo

Subsystem: mm/slub

    Andrew Morton <akpm@linux-foundation.org>:
      mm/slub.c: include swab.h

Subsystem: mm/thp

    Xu Yu <xuyu@linux.alibaba.com>:
      mm, thp: use head page in __migration_entry_wait()

    Hugh Dickins <hughd@google.com>:
    Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10:
      mm/thp: fix __split_huge_pmd_locked() on shmem migration entry
      mm/thp: make is_huge_zero_pmd() safe and quicker
      mm/thp: try_to_unmap() use TTU_SYNC for safe splitting
      mm/thp: fix vma_address() if virtual address below file offset

    Jue Wang <juew@google.com>:
      mm/thp: fix page_address_in_vma() on file THP tails

    Hugh Dickins <hughd@google.com>:
      mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page()

    Yang Shi <shy828301@gmail.com>:
      mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split

Subsystem: mm/sparsemem

    Miles Chen <miles.chen@mediatek.com>:
      mm/sparse: fix check_usemap_section_nr warnings

 Documentation/vm/slub.rst |   10 +--
 fs/hugetlbfs/inode.c      |    1 
 include/linux/huge_mm.h   |    8 ++
 include/linux/hugetlb.h   |    8 ++
 include/linux/mm.h        |    3 +
 include/linux/rmap.h      |    1 
 include/linux/swapops.h   |   15 +++--
 kernel/crash_core.c       |    1 
 mm/huge_memory.c          |   58 ++++++++++---------
 mm/hugetlb.c              |  137 +++++++++++++++++++++++++++++++++++++---------
 mm/internal.h             |   51 ++++++++++++-----
 mm/memory-failure.c       |   36 +++++++++++-
 mm/memory.c               |   41 +++++++++++++
 mm/migrate.c              |    1 
 mm/page_vma_mapped.c      |   27 +++++----
 mm/pgtable-generic.c      |    5 -
 mm/rmap.c                 |   41 +++++++++----
 mm/slab_common.c          |    3 -
 mm/slub.c                 |   37 +++++-------
 mm/sparse.c               |   13 +++-
 mm/swapfile.c             |    2 
 mm/truncate.c             |   43 ++++++--------
 22 files changed, 388 insertions(+), 154 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-06-05  3:00 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-06-05  3:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c.

Subsystems affected by this patch series:

  mips
  mm/kfence
  init
  mm/debug
  mm/pagealloc
  mm/memory-hotplug
  mm/hugetlb
  proc
  mm/kasan
  mm/hugetlb
  lib
  ocfs2
  mailmap

Subsystem: mips

    Thomas Bogendoerfer <tsbogend@alpha.franken.de>:
      Revert "MIPS: make userspace mapping young by default"

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: use TASK_IDLE when awaiting allocation

Subsystem: init

    Mark Rutland <mark.rutland@arm.com>:
      pid: take a reference when initializing `cad_pid`

Subsystem: mm/debug

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests()

Subsystem: mm/pagealloc

    Ding Hui <dinghui@sangfor.com.cn>:
      mm/page_alloc: fix counting of free pages after take off from buddy

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64

Subsystem: mm/hugetlb

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      hugetlb: pass head page to remove_hugetlb_page()

Subsystem: proc

    David Matlack <dmatlack@google.com>:
      proc: add .gitignore for proc-subset-pid selftest

Subsystem: mm/kasan

    Yu Kuai <yukuai3@huawei.com>:
      mm/kasan/init.c: fix doc warning

Subsystem: mm/hugetlb

    Mina Almasry <almasrymina@google.com>:
      mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY

Subsystem: lib

    YueHaibing <yuehaibing@huawei.com>:
      lib: crc64: fix kernel-doc warning

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: fix data corruption by fallocate

Subsystem: mailmap

    Michel Lespinasse <michel@lespinasse.org>:
      mailmap: use private address for Michel Lespinasse

 .mailmap                                |    3 +
 arch/mips/mm/cache.c                    |   30 ++++++++---------
 drivers/base/memory.c                   |    6 +--
 fs/ocfs2/file.c                         |   55 +++++++++++++++++++++++++++++---
 include/linux/pgtable.h                 |    8 ++++
 init/main.c                             |    2 -
 lib/crc64.c                             |    2 -
 mm/debug_vm_pgtable.c                   |    4 +-
 mm/hugetlb.c                            |   16 +++++++--
 mm/kasan/init.c                         |    4 +-
 mm/kfence/core.c                        |    6 +--
 mm/memory.c                             |    4 ++
 mm/page_alloc.c                         |    2 +
 tools/testing/selftests/proc/.gitignore |    1 
 14 files changed, 107 insertions(+), 36 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-05-23  0:41 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-05-23  0:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c.

Subsystems affected by this patch series:

  mm/pagealloc
  mm/gup
  ipc
  selftests
  mm/kasan
  kernel/watchdog
  bitmap
  procfs
  lib
  mm/userfaultfd

Subsystem: mm/pagealloc

    Arnd Bergmann <arnd@arndb.de>:
      mm/shuffle: fix section mismatch warning

Subsystem: mm/gup

    Michal Hocko <mhocko@suse.com>:
      Revert "mm/gup: check page posion status for coredump."

Subsystem: ipc

    Varad Gautam <varad.gautam@suse.com>:
      ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry

Subsystem: selftests

    Yang Yingliang <yangyingliang@huawei.com>:
      tools/testing/selftests/exec: fix link error

Subsystem: mm/kasan

    Alexander Potapenko <glider@google.com>:
      kasan: slab: always reset the tag in get_freepointer_safe()

Subsystem: kernel/watchdog

    Petr Mladek <pmladek@suse.com>:
      watchdog: reliable handling of timestamps

Subsystem: bitmap

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      linux/bits.h: fix compilation error with GENMASK

Subsystem: procfs

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: remove Alexey from MAINTAINERS

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib: kunit: suppress a compilation warning of frame size

Subsystem: mm/userfaultfd

    Mike Kravetz <mike.kravetz@oracle.com>:
      userfaultfd: hugetlbfs: fix new flag usage in error path

 MAINTAINERS                           |    1 -
 fs/hugetlbfs/inode.c                  |    2 +-
 include/linux/bits.h                  |    2 +-
 include/linux/const.h                 |    8 ++++++++
 include/linux/minmax.h                |   10 ++--------
 ipc/mqueue.c                          |    6 ++++--
 ipc/msg.c                             |    6 ++++--
 ipc/sem.c                             |    6 ++++--
 kernel/watchdog.c                     |   34 ++++++++++++++++++++--------------
 lib/Makefile                          |    1 +
 mm/gup.c                              |    4 ----
 mm/internal.h                         |   20 --------------------
 mm/shuffle.h                          |    4 ++--
 mm/slub.c                             |    1 +
 mm/userfaultfd.c                      |   28 ++++++++++++++--------------
 tools/include/linux/bits.h            |    2 +-
 tools/include/linux/const.h           |    8 ++++++++
 tools/testing/selftests/exec/Makefile |    6 +++---
 18 files changed, 74 insertions(+), 75 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-05-15  0:26 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-05-15  0:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/slub
  resource
  squashfs
  mm/userfaultfd
  mm/ksm
  mm/pagealloc
  mm/kasan
  mm/pagemap
  hfsplus
  modprobe
  mm/ioremap

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2:
      mm/hugetlb: fix F_SEAL_FUTURE_WRITE
      mm/hugetlb: fix cow where page writtable in child

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: move slub_debug static key enabling outside slab_mutex

Subsystem: resource

    Alistair Popple <apopple@nvidia.com>:
      kernel/resource: fix return code check in __request_free_mem_region

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix divide error in calculate_skip()

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: release page in error path to avoid BUG_ON

Subsystem: mm/ksm

    Hugh Dickins <hughd@google.com>:
      ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()"

Subsystem: mm/pagealloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix struct page layout on 32-bit systems

Subsystem: mm/kasan

    Peter Collingbourne <pcc@google.com>:
      kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled

Subsystem: mm/pagemap

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap: fix readahead return types

Subsystem: hfsplus

    Jouni Roivas <jouni.roivas@tuxera.com>:
      hfsplus: prevent corruption in shrinking truncate

Subsystem: modprobe

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      docs: admin-guide: update description for kernel.modprobe sysctl

Subsystem: mm/ioremap

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm/ioremap: fix iomap_max_page_shift

 Documentation/admin-guide/sysctl/kernel.rst |    9 ++++---
 fs/hfsplus/extents.c                        |    7 +++--
 fs/hugetlbfs/inode.c                        |    5 ++++
 fs/iomap/buffered-io.c                      |    4 +--
 fs/squashfs/file.c                          |    6 ++--
 include/linux/mm.h                          |   32 ++++++++++++++++++++++++++
 include/linux/mm_types.h                    |    4 +--
 include/linux/pagemap.h                     |    6 ++--
 include/net/page_pool.h                     |   12 +++++++++
 kernel/resource.c                           |    2 -
 lib/test_kasan.c                            |   29 ++++++++++++++++++-----
 mm/hugetlb.c                                |    1 
 mm/ioremap.c                                |    6 ++--
 mm/ksm.c                                    |    3 +-
 mm/shmem.c                                  |   34 ++++++++++++----------------
 mm/slab_common.c                            |   10 ++++++++
 mm/slub.c                                   |    9 -------
 net/core/page_pool.c                        |   12 +++++----
 18 files changed, 129 insertions(+), 62 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-05-07  1:01 incoming Andrew Morton
@ 2021-05-07  7:12 ` Linus Torvalds
  0 siblings, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2021-05-07  7:12 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> I've been wobbly about the secretmem patches due to doubts about
> whether the feature is sufficiently useful to justify inclusion, but
> developers are now weighing in with helpful information and I've asked Mike
> for an extensively updated [0/n] changelog.  This will take a few days
> to play out so it is possible that I will prevail upon you for a post-rc1
> merge.

Oh, much too late for this release by now.

> If that's a problem, there's always 5.13-rc1.

5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time -
and version numbers - fly.

             Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-05-07  1:01 Andrew Morton
  2021-05-07  7:12 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-05-07  1:01 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


This is everything else from -mm for this merge window, with the
possible exception of Mike Rapoport's "secretmem" syscall patch series
(https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org).

I've been wobbly about the secretmem patches due to doubts about
whether the feature is sufficiently useful to justify inclusion, but
developers are now weighing in with helpful information and I've asked Mike
for an extensively updated [0/n] changelog.  This will take a few days
to play out so it is possible that I will prevail upon you for a post-rc1
merge.  If that's a problem, there's always 5.13-rc1.

91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Thanks.



Subsystems affected by this patch series:

  alpha
  procfs
  sysctl
  misc
  core-kernel
  bitmap
  lib
  compat
  checkpatch
  epoll
  isofs
  nilfs2
  hpfs
  exit
  fork
  kexec
  gcov
  panic
  delayacct
  gdb
  resource
  selftests
  async
  initramfs
  ipc
  mm/cleanups
  drivers/char
  mm/slub
  spelling

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: eliminate old-style function definitions
      alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h>

Subsystem: procfs

    Colin Ian King <colin.king@canonical.com>:
      fs/proc/generic.c: fix incorrect pde_is_permanent check

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: save LOC in __xlate_proc_name()
      proc: mandate ->proc_lseek in "struct proc_ops"
      proc: delete redundant subset=pid check
      selftests: proc: test subset=pid

Subsystem: sysctl

    zhouchuangao <zhouchuangao@vivo.com>:
      proc/sysctl: fix function name error in comments

Subsystem: misc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include: remove pagemap.h from blkdev.h

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: drop inclusion in bitmap.h

    Wan Jiabing <wanjiabing@vivo.com>:
      linux/profile.h: remove unnecessary declaration

Subsystem: core-kernel

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      kernel/async.c: fix pr_debug statement
      kernel/cred.c: make init_groups static

Subsystem: bitmap

    Yury Norov <yury.norov@gmail.com>:
    Patch series "lib/find_bit: fast path for small bitmaps", v6:
      tools: disable -Wno-type-limits
      tools: bitmap: sync function declarations with the kernel
      tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel
      arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300
      lib: extend the scope of small_const_nbits() macro
      tools: sync small_const_nbits() macro with the kernel
      lib: inline _find_next_bit() wrappers
      tools: sync find_next_bit implementation
      lib: add fast path for find_next_*_bit()
      lib: add fast path for find_first_*_bit() and find_last_bit()
      tools: sync lib/find_bit implementation
      MAINTAINERS: add entry for the bitmap API

Subsystem: lib

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      lib/bch.c: fix a typo in the file bch.c

    Wang Qing <wangqing@vivo.com>:
      lib: fix inconsistent indenting in process_bit1()

    ToastC <mrtoastcheng@gmail.com>:
      lib/list_sort.c: fix typo in function description

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      lib/genalloc.c: Fix a typo

    Richard Fitzgerald <rf@opensource.cirrus.com>:
      lib: crc8: pointer to data block should be const

    Zqiang <qiang.zhang@windriver.com>:
      lib: stackdepot: turn depot_lock spinlock to raw_spinlock

    Alex Shi <alexs@kernel.org>:
      lib/percpu_counter: tame kernel-doc compile warning
      lib/genalloc: add parameter description to fix doc compile warning

    Randy Dunlap <rdunlap@infradead.org>:
      lib: parser: clean up kernel-doc

Subsystem: compat

    Masahiro Yamada <masahiroy@kernel.org>:
      include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx()

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: warn when missing newline in return sysfs_emit() formats

    Vincent Mailhol <mailhol.vincent@wanadoo.fr>:
      checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      checkpatch: improve ALLOC_ARRAY_ARGS test

Subsystem: epoll

    Davidlohr Bueso <dave@stgolabs.net>:
    Patch series "fs/epoll: restore user-visible behavior upon event ready":
      kselftest: introduce new epoll test case
      fs/epoll: restore waking from ep_done_scan()

Subsystem: isofs

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      isofs: fix fall-through warnings for Clang

Subsystem: nilfs2

    Liu xuzhi <liu.xuzhi@zte.com.cn>:
      fs/nilfs2: fix misspellings using codespell tool

    Lu Jialin <lujialin4@huawei.com>:
      nilfs2: fix typos in comments

Subsystem: hpfs

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      hpfs: replace one-element array with flexible-array member

Subsystem: exit

    Jim Newsome <jnewsome@torproject.org>:
      do_wait: make PIDTYPE_PID case O(1) instead of O(n)

Subsystem: fork

    Rolf Eike Beer <eb@emlix.com>:
      kernel/fork.c: simplify copy_mm()

    Xiaofeng Cao <cxfcosmos@gmail.com>:
      kernel/fork.c: fix typos

Subsystem: kexec

    Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>:
      kernel/crash_core: add crashkernel=auto for vmcore creation

    Joe LeVeque <jolevequ@microsoft.com>:
      kexec: Add kexec reboot string

    Jia-Ju Bai <baijiaju1990@gmail.com>:
      kernel: kexec_file: fix error return code of kexec_calculate_store_digests()

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      kexec: dump kmessage before machine_kexec

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      gcov: combine common code
      gcov: simplify buffer allocation
      gcov: use kvmalloc()

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: clang: drop support for clang-10 and older

Subsystem: panic

    He Ying <heying24@huawei.com>:
      smp: kernel/panic.c - silence warnings

Subsystem: delayacct

    Yafang Shao <laoar.shao@gmail.com>:
      delayacct: clear right task's flag after blkio completes

Subsystem: gdb

    Johannes Berg <johannes.berg@intel.com>:
      gdb: lx-symbols: store the abspath()

    Barry Song <song.bao.hua@hisilicon.com>:
    Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2:
      scripts/gdb: document lx_current is only supported by x86
      scripts/gdb: add lx_current support for arm64

Subsystem: resource

    David Hildenbrand <david@redhat.com>:
    Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2:
      kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources
      kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources
      kernel/resource: remove first_lvl / siblings_only logic

    Alistair Popple <apopple@nvidia.com>:
      kernel/resource: allow region_intersects users to hold resource_lock
      kernel/resource: refactor __request_region to allow external locking
      kernel/resource: fix locking in request_free_mem_region

Subsystem: selftests

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      selftests: remove duplicate include

Subsystem: async

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      kernel/async.c: stop guarding pr_debug() statements
      kernel/async.c: remove async_unregister_domain()

Subsystem: initramfs

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
    Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3:
      init/initramfs.c: do unpacking asynchronously
      modules: add CONFIG_MODPROBE_PATH

Subsystem: ipc

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ipc/sem.c: mundane typo fixes

Subsystem: mm/cleanups

    Shijie Luo <luoshijie1@huawei.com>:
      mm: fix some typos and code style problems

Subsystem: drivers/char

    David Hildenbrand <david@redhat.com>:
    Patch series "drivers/char: remove /dev/kmem for good":
      drivers/char: remove /dev/kmem for good
      mm: remove xlate_dev_kmem_ptr()
      mm/vmalloc: remove vwrite()

Subsystem: mm/slub

    Maninder Singh <maninder1.s@samsung.com>:
      arm: print alloc free paths for address in registers

Subsystem: spelling

    Drew Fustini <drew@beagleboard.org>:
      scripts/spelling.txt: add "overlfow"

    zuoqilin <zuoqilin@yulong.com>:
      scripts/spelling.txt: Add "diabled" typo

    Drew Fustini <drew@beagleboard.org>:
      scripts/spelling.txt: add "overflw"

    Colin Ian King <colin.king@canonical.com>:
      mm/slab.c: fix spelling mistake "disired" -> "desired"

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      include/linux/pgtable.h: few spelling fixes

    zhouchuangao <zhouchuangao@vivo.com>:
      kernel/umh.c: fix some spelling mistakes

    Xiaofeng Cao <cxfcosmos@gmail.com>:
      kernel/user_namespace.c: fix typos

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      kernel/up.c: fix typo

    Xiaofeng Cao <caoxiaofeng@yulong.com>:
      kernel/sys.c: fix typo

    dingsenjie <dingsenjie@yulong.com>:
      fs: fat: fix spelling typo of values

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ipc/sem.c: spelling fix

    Masahiro Yamada <masahiroy@kernel.org>:
      treewide: remove editor modelines and cruft

    Ingo Molnar <mingo@kernel.org>:
      mm: fix typos in comments

    Lu Jialin <lujialin4@huawei.com>:
      mm: fix typos in comments

 Documentation/admin-guide/devices.txt                         |    2 
 Documentation/admin-guide/kdump/kdump.rst                     |    3 
 Documentation/admin-guide/kernel-parameters.txt               |   18 
 Documentation/dev-tools/gdb-kernel-debugging.rst              |    4 
 MAINTAINERS                                                   |   16 
 arch/Kconfig                                                  |   20 
 arch/alpha/include/asm/io.h                                   |    5 
 arch/alpha/kernel/pc873xx.c                                   |    4 
 arch/alpha/lib/csum_partial_copy.c                            |    1 
 arch/arm/configs/dove_defconfig                               |    1 
 arch/arm/configs/magician_defconfig                           |    1 
 arch/arm/configs/moxart_defconfig                             |    1 
 arch/arm/configs/mps2_defconfig                               |    1 
 arch/arm/configs/mvebu_v5_defconfig                           |    1 
 arch/arm/configs/xcep_defconfig                               |    1 
 arch/arm/include/asm/bug.h                                    |    1 
 arch/arm/include/asm/io.h                                     |    5 
 arch/arm/kernel/process.c                                     |   11 
 arch/arm/kernel/traps.c                                       |    1 
 arch/h8300/include/asm/bitops.h                               |    8 
 arch/hexagon/configs/comet_defconfig                          |    1 
 arch/hexagon/include/asm/io.h                                 |    1 
 arch/ia64/include/asm/io.h                                    |    1 
 arch/ia64/include/asm/uaccess.h                               |   18 
 arch/m68k/atari/time.c                                        |    7 
 arch/m68k/configs/amcore_defconfig                            |    1 
 arch/m68k/include/asm/bitops.h                                |    6 
 arch/m68k/include/asm/io_mm.h                                 |    5 
 arch/mips/include/asm/io.h                                    |    5 
 arch/openrisc/configs/or1ksim_defconfig                       |    1 
 arch/parisc/include/asm/io.h                                  |    5 
 arch/parisc/include/asm/pdc_chassis.h                         |    1 
 arch/powerpc/include/asm/io.h                                 |    5 
 arch/s390/include/asm/io.h                                    |    5 
 arch/sh/configs/edosk7705_defconfig                           |    1 
 arch/sh/configs/se7206_defconfig                              |    1 
 arch/sh/configs/sh2007_defconfig                              |    1 
 arch/sh/configs/sh7724_generic_defconfig                      |    1 
 arch/sh/configs/sh7770_generic_defconfig                      |    1 
 arch/sh/configs/sh7785lcr_32bit_defconfig                     |    1 
 arch/sh/include/asm/bitops.h                                  |    5 
 arch/sh/include/asm/io.h                                      |    5 
 arch/sparc/configs/sparc64_defconfig                          |    1 
 arch/sparc/include/asm/io_64.h                                |    5 
 arch/um/drivers/cow.h                                         |    7 
 arch/xtensa/configs/xip_kc705_defconfig                       |    1 
 block/blk-settings.c                                          |    1 
 drivers/auxdisplay/panel.c                                    |    7 
 drivers/base/firmware_loader/main.c                           |    2 
 drivers/block/brd.c                                           |    1 
 drivers/block/loop.c                                          |    1 
 drivers/char/Kconfig                                          |   10 
 drivers/char/mem.c                                            |  231 --------
 drivers/gpu/drm/qxl/qxl_drv.c                                 |    1 
 drivers/isdn/capi/kcapi_proc.c                                |    1 
 drivers/md/bcache/super.c                                     |    1 
 drivers/media/usb/pwc/pwc-uncompress.c                        |    3 
 drivers/net/ethernet/adaptec/starfire.c                       |    8 
 drivers/net/ethernet/amd/atarilance.c                         |    8 
 drivers/net/ethernet/amd/pcnet32.c                            |    7 
 drivers/net/wireless/intersil/hostap/hostap_proc.c            |    1 
 drivers/net/wireless/intersil/orinoco/orinoco_nortel.c        |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_pci.c           |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_plx.c           |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_tmd.c           |    8 
 drivers/nvdimm/btt.c                                          |    1 
 drivers/nvdimm/pmem.c                                         |    1 
 drivers/parport/parport_ip32.c                                |   12 
 drivers/platform/x86/dell/dell_rbu.c                          |    3 
 drivers/scsi/53c700.c                                         |    1 
 drivers/scsi/53c700.h                                         |    1 
 drivers/scsi/ch.c                                             |    6 
 drivers/scsi/esas2r/esas2r_main.c                             |    1 
 drivers/scsi/ips.c                                            |   20 
 drivers/scsi/ips.h                                            |   20 
 drivers/scsi/lasi700.c                                        |    1 
 drivers/scsi/megaraid/mbox_defs.h                             |    2 
 drivers/scsi/megaraid/mega_common.h                           |    2 
 drivers/scsi/megaraid/megaraid_mbox.c                         |    2 
 drivers/scsi/megaraid/megaraid_mbox.h                         |    2 
 drivers/scsi/qla1280.c                                        |   12 
 drivers/scsi/scsicam.c                                        |    1 
 drivers/scsi/sni_53c710.c                                     |    1 
 drivers/video/fbdev/matrox/matroxfb_base.c                    |    9 
 drivers/video/fbdev/vga16fb.c                                 |   10 
 fs/configfs/configfs_internal.h                               |    4 
 fs/configfs/dir.c                                             |    4 
 fs/configfs/file.c                                            |    4 
 fs/configfs/inode.c                                           |    4 
 fs/configfs/item.c                                            |    4 
 fs/configfs/mount.c                                           |    4 
 fs/configfs/symlink.c                                         |    4 
 fs/eventpoll.c                                                |    6 
 fs/fat/fatent.c                                               |    2 
 fs/hpfs/hpfs.h                                                |    3 
 fs/isofs/rock.c                                               |    1 
 fs/nfs/dir.c                                                  |    7 
 fs/nfs/nfs4proc.c                                             |    6 
 fs/nfs/nfs4renewd.c                                           |    6 
 fs/nfs/nfs4state.c                                            |    6 
 fs/nfs/nfs4xdr.c                                              |    6 
 fs/nfsd/nfs4proc.c                                            |    6 
 fs/nfsd/nfs4xdr.c                                             |    6 
 fs/nfsd/xdr4.h                                                |    6 
 fs/nilfs2/cpfile.c                                            |    2 
 fs/nilfs2/ioctl.c                                             |    4 
 fs/nilfs2/segment.c                                           |    4 
 fs/nilfs2/the_nilfs.c                                         |    2 
 fs/ocfs2/acl.c                                                |    4 
 fs/ocfs2/acl.h                                                |    4 
 fs/ocfs2/alloc.c                                              |    4 
 fs/ocfs2/alloc.h                                              |    4 
 fs/ocfs2/aops.c                                               |    4 
 fs/ocfs2/aops.h                                               |    4 
 fs/ocfs2/blockcheck.c                                         |    4 
 fs/ocfs2/blockcheck.h                                         |    4 
 fs/ocfs2/buffer_head_io.c                                     |    4 
 fs/ocfs2/buffer_head_io.h                                     |    4 
 fs/ocfs2/cluster/heartbeat.c                                  |    4 
 fs/ocfs2/cluster/heartbeat.h                                  |    4 
 fs/ocfs2/cluster/masklog.c                                    |    4 
 fs/ocfs2/cluster/masklog.h                                    |    4 
 fs/ocfs2/cluster/netdebug.c                                   |    4 
 fs/ocfs2/cluster/nodemanager.c                                |    4 
 fs/ocfs2/cluster/nodemanager.h                                |    4 
 fs/ocfs2/cluster/ocfs2_heartbeat.h                            |    4 
 fs/ocfs2/cluster/ocfs2_nodemanager.h                          |    4 
 fs/ocfs2/cluster/quorum.c                                     |    4 
 fs/ocfs2/cluster/quorum.h                                     |    4 
 fs/ocfs2/cluster/sys.c                                        |    4 
 fs/ocfs2/cluster/sys.h                                        |    4 
 fs/ocfs2/cluster/tcp.c                                        |    4 
 fs/ocfs2/cluster/tcp.h                                        |    4 
 fs/ocfs2/cluster/tcp_internal.h                               |    4 
 fs/ocfs2/dcache.c                                             |    4 
 fs/ocfs2/dcache.h                                             |    4 
 fs/ocfs2/dir.c                                                |    4 
 fs/ocfs2/dir.h                                                |    4 
 fs/ocfs2/dlm/dlmapi.h                                         |    4 
 fs/ocfs2/dlm/dlmast.c                                         |    4 
 fs/ocfs2/dlm/dlmcommon.h                                      |    4 
 fs/ocfs2/dlm/dlmconvert.c                                     |    4 
 fs/ocfs2/dlm/dlmconvert.h                                     |    4 
 fs/ocfs2/dlm/dlmdebug.c                                       |    4 
 fs/ocfs2/dlm/dlmdebug.h                                       |    4 
 fs/ocfs2/dlm/dlmdomain.c                                      |    4 
 fs/ocfs2/dlm/dlmdomain.h                                      |    4 
 fs/ocfs2/dlm/dlmlock.c                                        |    4 
 fs/ocfs2/dlm/dlmmaster.c                                      |    4 
 fs/ocfs2/dlm/dlmrecovery.c                                    |    4 
 fs/ocfs2/dlm/dlmthread.c                                      |    4 
 fs/ocfs2/dlm/dlmunlock.c                                      |    4 
 fs/ocfs2/dlmfs/dlmfs.c                                        |    4 
 fs/ocfs2/dlmfs/userdlm.c                                      |    4 
 fs/ocfs2/dlmfs/userdlm.h                                      |    4 
 fs/ocfs2/dlmglue.c                                            |    4 
 fs/ocfs2/dlmglue.h                                            |    4 
 fs/ocfs2/export.c                                             |    4 
 fs/ocfs2/export.h                                             |    4 
 fs/ocfs2/extent_map.c                                         |    4 
 fs/ocfs2/extent_map.h                                         |    4 
 fs/ocfs2/file.c                                               |    4 
 fs/ocfs2/file.h                                               |    4 
 fs/ocfs2/filecheck.c                                          |    4 
 fs/ocfs2/filecheck.h                                          |    4 
 fs/ocfs2/heartbeat.c                                          |    4 
 fs/ocfs2/heartbeat.h                                          |    4 
 fs/ocfs2/inode.c                                              |    4 
 fs/ocfs2/inode.h                                              |    4 
 fs/ocfs2/journal.c                                            |    4 
 fs/ocfs2/journal.h                                            |    4 
 fs/ocfs2/localalloc.c                                         |    4 
 fs/ocfs2/localalloc.h                                         |    4 
 fs/ocfs2/locks.c                                              |    4 
 fs/ocfs2/locks.h                                              |    4 
 fs/ocfs2/mmap.c                                               |    4 
 fs/ocfs2/move_extents.c                                       |    4 
 fs/ocfs2/move_extents.h                                       |    4 
 fs/ocfs2/namei.c                                              |    4 
 fs/ocfs2/namei.h                                              |    4 
 fs/ocfs2/ocfs1_fs_compat.h                                    |    4 
 fs/ocfs2/ocfs2.h                                              |    4 
 fs/ocfs2/ocfs2_fs.h                                           |    4 
 fs/ocfs2/ocfs2_ioctl.h                                        |    4 
 fs/ocfs2/ocfs2_lockid.h                                       |    4 
 fs/ocfs2/ocfs2_lockingver.h                                   |    4 
 fs/ocfs2/refcounttree.c                                       |    4 
 fs/ocfs2/refcounttree.h                                       |    4 
 fs/ocfs2/reservations.c                                       |    4 
 fs/ocfs2/reservations.h                                       |    4 
 fs/ocfs2/resize.c                                             |    4 
 fs/ocfs2/resize.h                                             |    4 
 fs/ocfs2/slot_map.c                                           |    4 
 fs/ocfs2/slot_map.h                                           |    4 
 fs/ocfs2/stack_o2cb.c                                         |    4 
 fs/ocfs2/stack_user.c                                         |    4 
 fs/ocfs2/stackglue.c                                          |    4 
 fs/ocfs2/stackglue.h                                          |    4 
 fs/ocfs2/suballoc.c                                           |    4 
 fs/ocfs2/suballoc.h                                           |    4 
 fs/ocfs2/super.c                                              |    4 
 fs/ocfs2/super.h                                              |    4 
 fs/ocfs2/symlink.c                                            |    4 
 fs/ocfs2/symlink.h                                            |    4 
 fs/ocfs2/sysfile.c                                            |    4 
 fs/ocfs2/sysfile.h                                            |    4 
 fs/ocfs2/uptodate.c                                           |    4 
 fs/ocfs2/uptodate.h                                           |    4 
 fs/ocfs2/xattr.c                                              |    4 
 fs/ocfs2/xattr.h                                              |    4 
 fs/proc/generic.c                                             |   13 
 fs/proc/inode.c                                               |   18 
 fs/proc/proc_sysctl.c                                         |    2 
 fs/reiserfs/procfs.c                                          |   10 
 include/asm-generic/bitops/find.h                             |  108 +++
 include/asm-generic/bitops/le.h                               |   38 +
 include/asm-generic/bitsperlong.h                             |   12 
 include/asm-generic/io.h                                      |   11 
 include/linux/align.h                                         |   15 
 include/linux/async.h                                         |    1 
 include/linux/bitmap.h                                        |   11 
 include/linux/bitops.h                                        |   12 
 include/linux/blkdev.h                                        |    1 
 include/linux/compat.h                                        |    1 
 include/linux/configfs.h                                      |    4 
 include/linux/crc8.h                                          |    2 
 include/linux/cred.h                                          |    1 
 include/linux/delayacct.h                                     |   20 
 include/linux/fs.h                                            |    2 
 include/linux/genl_magic_func.h                               |    1 
 include/linux/genl_magic_struct.h                             |    1 
 include/linux/gfp.h                                           |    2 
 include/linux/init_task.h                                     |    1 
 include/linux/initrd.h                                        |    2 
 include/linux/kernel.h                                        |    9 
 include/linux/mm.h                                            |    2 
 include/linux/mmzone.h                                        |    2 
 include/linux/pgtable.h                                       |   10 
 include/linux/proc_fs.h                                       |    1 
 include/linux/profile.h                                       |    3 
 include/linux/smp.h                                           |    8 
 include/linux/swap.h                                          |    1 
 include/linux/vmalloc.h                                       |    7 
 include/uapi/linux/if_bonding.h                               |   11 
 include/uapi/linux/nfs4.h                                     |    6 
 include/xen/interface/elfnote.h                               |   10 
 include/xen/interface/hvm/hvm_vcpu.h                          |   10 
 include/xen/interface/io/xenbus.h                             |   10 
 init/Kconfig                                                  |   12 
 init/initramfs.c                                              |   38 +
 init/main.c                                                   |    1 
 ipc/sem.c                                                     |   12 
 kernel/async.c                                                |   68 --
 kernel/configs/android-base.config                            |    1 
 kernel/crash_core.c                                           |    7 
 kernel/cred.c                                                 |    2 
 kernel/exit.c                                                 |   67 ++
 kernel/fork.c                                                 |   23 
 kernel/gcov/Kconfig                                           |    1 
 kernel/gcov/base.c                                            |   49 +
 kernel/gcov/clang.c                                           |  282 ----------
 kernel/gcov/fs.c                                              |  146 ++++-
 kernel/gcov/gcc_4_7.c                                         |  173 ------
 kernel/gcov/gcov.h                                            |   14 
 kernel/kexec_core.c                                           |    4 
 kernel/kexec_file.c                                           |    4 
 kernel/kmod.c                                                 |    2 
 kernel/resource.c                                             |  198 ++++---
 kernel/sys.c                                                  |   14 
 kernel/umh.c                                                  |    8 
 kernel/up.c                                                   |    2 
 kernel/user_namespace.c                                       |    6 
 lib/bch.c                                                     |    2 
 lib/crc8.c                                                    |    2 
 lib/decompress_unlzma.c                                       |    2 
 lib/find_bit.c                                                |   68 --
 lib/genalloc.c                                                |    7 
 lib/list_sort.c                                               |    2 
 lib/parser.c                                                  |   61 +-
 lib/percpu_counter.c                                          |    2 
 lib/stackdepot.c                                              |    6 
 mm/balloon_compaction.c                                       |    4 
 mm/compaction.c                                               |    4 
 mm/filemap.c                                                  |    2 
 mm/gup.c                                                      |    2 
 mm/highmem.c                                                  |    2 
 mm/huge_memory.c                                              |    6 
 mm/hugetlb.c                                                  |    6 
 mm/internal.h                                                 |    2 
 mm/kasan/kasan.h                                              |    8 
 mm/kasan/quarantine.c                                         |    4 
 mm/kasan/shadow.c                                             |    4 
 mm/kfence/report.c                                            |    2 
 mm/khugepaged.c                                               |    2 
 mm/ksm.c                                                      |    6 
 mm/madvise.c                                                  |    4 
 mm/memcontrol.c                                               |   18 
 mm/memory-failure.c                                           |    2 
 mm/memory.c                                                   |   18 
 mm/mempolicy.c                                                |    6 
 mm/migrate.c                                                  |    8 
 mm/mmap.c                                                     |    4 
 mm/mprotect.c                                                 |    2 
 mm/mremap.c                                                   |    2 
 mm/nommu.c                                                    |   10 
 mm/oom_kill.c                                                 |    2 
 mm/page-writeback.c                                           |    4 
 mm/page_alloc.c                                               |   16 
 mm/page_owner.c                                               |    2 
 mm/page_vma_mapped.c                                          |    2 
 mm/percpu-internal.h                                          |    2 
 mm/percpu.c                                                   |    2 
 mm/pgalloc-track.h                                            |    6 
 mm/rmap.c                                                     |    2 
 mm/slab.c                                                     |    8 
 mm/slub.c                                                     |    2 
 mm/swap.c                                                     |    4 
 mm/swap_slots.c                                               |    2 
 mm/swap_state.c                                               |    2 
 mm/vmalloc.c                                                  |  124 ----
 mm/vmstat.c                                                   |    2 
 mm/z3fold.c                                                   |    2 
 mm/zpool.c                                                    |    2 
 mm/zsmalloc.c                                                 |    6 
 samples/configfs/configfs_sample.c                            |    2 
 scripts/checkpatch.pl                                         |   15 
 scripts/gdb/linux/cpus.py                                     |   23 
 scripts/gdb/linux/symbols.py                                  |    3 
 scripts/spelling.txt                                          |    3 
 tools/include/asm-generic/bitops/find.h                       |   85 ++-
 tools/include/asm-generic/bitsperlong.h                       |    3 
 tools/include/linux/bitmap.h                                  |   18 
 tools/lib/bitmap.c                                            |    4 
 tools/lib/find_bit.c                                          |   56 -
 tools/scripts/Makefile.include                                |    1 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   44 +
 tools/testing/selftests/kvm/lib/sparsebit.c                   |    1 
 tools/testing/selftests/mincore/mincore_selftest.c            |    1 
 tools/testing/selftests/powerpc/mm/tlbie_test.c               |    1 
 tools/testing/selftests/proc/Makefile                         |    1 
 tools/testing/selftests/proc/proc-subset-pid.c                |  121 ++++
 tools/testing/selftests/proc/read.c                           |    4 
 tools/usb/hcd-tests.sh                                        |    2 
 343 files changed, 1383 insertions(+), 2119 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-05-05 17:44       ` incoming Andrew Morton
@ 2021-05-06  3:19         ` Anshuman Khandual
  0 siblings, 0 replies; 188+ messages in thread
From: Anshuman Khandual @ 2021-05-06  3:19 UTC (permalink / raw)
  To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits



On 5/5/21 11:14 PM, Andrew Morton wrote:
> On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> 
>> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>>> Let me resend right now with the same in-reply-to.  Hopefully they will
>>> land in the correct place.
>> Well, you re-sent it twice, and I have three copies in my own mailbox,
>> bot they still don't show up on the mm-commits mailing list.
>>
>> So the list hates them for some odd reason.
>>
>> I've picked them up locally, but adding Konstantin to the participants
>> to see if he can see what's up.
>>
>> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
>> series of 143. Odd.
> It's weird.  They don't turn up on linux-mm either, and that's running
> at kvack.org, also majordomo.  They don't get through when sent with
> either heirloom-mailx or with sylpheed.
> 
> Also, it seems that when Anshuman originally sent the patch, linux-mm
> and linux-kernel didn't send it back out.  So perhaps a spam filter
> triggered?
> 
> I'm seeing
> 
> https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
> 
> which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
> server massacred that patch series.  Searching
> https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
> email series.

Yeah these patches faced problem from the very beginning getting
into the MM/LKML list for some strange reason.


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-05-05 17:10     ` incoming Linus Torvalds
@ 2021-05-05 17:44       ` Andrew Morton
  2021-05-06  3:19         ` incoming Anshuman Khandual
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits

[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]

On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to.  Hopefully they will
> > land in the correct place.
> 
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
> 
> So the list hates them for some odd reason.
> 
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
> 
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.

It's weird.  They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo.  They don't get through when sent with
either heirloom-mailx or with sylpheed.

Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out.  So perhaps a spam filter
triggered?

I'm seeing

https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/

which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series.  Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.

One of the emails (as sent my me) is attached, if that helps.



[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]

Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
	USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
	by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
	for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
	by localhost.localdomain with IMAP (fetchmail-6.3.26)
	for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
	 by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
	 Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
  by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
	by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
    by mx6.messagingengine.com (Authentication Milter) with ESMTP
    id 14870833D7F;
    Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
    1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
    yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
    djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
    Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
    RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
    tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
    messagingengine.com; h=date:from:to:subject:message-id
    :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
    uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
    gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
    Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
    YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
    zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
    7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
    smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
    header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
    header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
    policy.applied-disposition=none policy.evaluated-disposition=none
    (p=none,d=none,d.eval=none) policy.policy-from=p
    header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
    smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
    (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
    smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
    x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
    header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
    policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
    smtp.bits=256/256;
    x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
      smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
      header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
      header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
      policy.applied-disposition=none policy.evaluated-disposition=none
      (p=none,d=none,d.eval=none) policy.policy-from=p
      header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
      smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
      (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
      smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
      x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
      header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
      policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
      smtp.bits=256/256;
    x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
    fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
    rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
    hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
    peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
    honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
    geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
    enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
    uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
    iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
    ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
    epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
    (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
    receiver=mx6.messagingengine.com;
    identity=mailfrom;
    envelope-from="akpm@linux-foundation.org";
    helo=mail-pg1-f198.google.com;
    client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
	(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
	 key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
	(No client certificate requested)
	by mx6.messagingengine.com (Postfix) with ESMTPS
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
        for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=1e100.net; s=20161025;
        h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
         :in-reply-to:user-agent;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
         NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
         feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
         25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
         ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
         vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
	tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
	xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
        Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
        d=google.com; s=arc-20160816;
        b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
         /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
         50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
         8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
         DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
         pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
        h=user-agent:in-reply-to:message-id:subject:to:from:date
         :dkim-signature;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
         Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
         uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
         XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
         TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
         rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
        by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
        (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
	Wed,  5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
	s=korg; t=1620184587;
	bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
	h=Date:From:To:Subject:In-Reply-To:From;
	b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
	 D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
	 H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)

SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it.  Instead, just make it a generic option which can be
selected on applicable platforms.  Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead.  This reduces code duplication and makes
it cleaner.

Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com>	[riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au>		[powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm/Kconfig                       |    5 +----
 arch/arm64/Kconfig                     |    4 +---
 arch/mips/Kconfig                      |    6 +-----
 arch/parisc/Kconfig                    |    5 +----
 arch/powerpc/Kconfig                   |    3 ---
 arch/powerpc/platforms/Kconfig.cputype |    6 +++---
 arch/riscv/Kconfig                     |    5 +----
 arch/sh/Kconfig                        |    5 +----
 fs/Kconfig                             |    5 ++++-
 9 files changed, 13 insertions(+), 31 deletions(-)

--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
 	select ARCH_USE_QUEUED_SPINLOCKS
 	select ARCH_USE_SYM_ANNOTATIONS
 	select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
 	select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y
-
 config ARCH_HAS_FILTER_PGPROT
 	def_bool y
 
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
 	select ARCH_SUPPORTS_ATOMIC_RMW
+	select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
 	select ARCH_USE_BUILTIN_BSWAP
 	select ARCH_USE_CMPXCHG_LOCKREF
 	select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-       def_bool y
-       depends on ARM_LPAE
-
 config HAVE_ARCH_TRANSPARENT_HUGEPAGE
        def_bool y
        depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
 	select ARCH_USE_MEMTEST
 	select ARCH_USE_QUEUED_RWLOCKS
 	select ARCH_USE_QUEUED_SPINLOCKS
+	select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_IPC_PARSE_VERSION
 	select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
 config SYS_SUPPORTS_LITTLE_ENDIAN
 	bool
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-	depends on CPU_SUPPORTS_HUGEPAGES
-	default y
-
 config MIPS_HUGE_TLB_SUPPORT
 	def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
 
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
 	select ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_HAS_UBSAN_SANITIZE_ALL
 	select ARCH_NO_SG_CHAIN
+	select ARCH_SUPPORTS_HUGETLBFS if PA20
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select DMA_OPS
 	select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
 	default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
 	default 2
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y if PA20
-
-
 menu "Processor type and features"
 
 choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
 	def_bool y
 	depends on PPC_BOOK3S_64
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config ILLEGAL_POINTER_VALUE
 	hex
 	# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
 
 config PPC_8xx
 	bool "Freescale 8xx"
+	select ARCH_SUPPORTS_HUGETLBFS
 	select FSL_SOC
-	select SYS_SUPPORTS_HUGETLBFS
 	select PPC_HAVE_KUEP
 	select PPC_HAVE_KUAP
 	select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
 	bool "Server processors"
 	select PPC_FPU
 	select PPC_HAVE_PMU_SUPPORT
-	select SYS_SUPPORTS_HUGETLBFS
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
 	select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_NUMA_BALANCING
 	select IRQ_WORK
 	select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
 # this is for common code between PPC32 & PPC64 FSL BOOKE
 config PPC_FSL_BOOK3E
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select FSL_EMB_PERFMON
 	select PPC_SMP_MUXED_IPI
-	select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select PPC_DOORBELL
 	default y if FSL_BOOKE
 
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
 	select ARCH_HAS_STRICT_KERNEL_RWX if MMU
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_FRAME_POINTERS
 	select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
 config ARCH_SUPPORTS_UPROBES
 	def_bool y
 
-config SYS_SUPPORTS_HUGETLBFS
-	depends on MMU
-	def_bool y
-
 config STACKTRACE_SUPPORT
 	def_bool y
 
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
 	bool
 	select ARCH_SUSPEND_POSSIBLE
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config SYS_SUPPORTS_SMP
 	bool
 
@@ -175,12 +172,12 @@ config CPU_SH3
 
 config CPU_SH4
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select CPU_HAS_INTEVT
 	select CPU_HAS_SR_RB
 	select CPU_HAS_FPU if !CPU_SH4AL_DSP
 	select SH_INTC
 	select SYS_SUPPORTS_SH_TMU
-	select SYS_SUPPORTS_HUGETLBFS if MMU
 
 config CPU_SH4A
 	bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
 
 	  If unsure, say N.
 
+config ARCH_SUPPORTS_HUGETLBFS
+	def_bool n
+
 config HUGETLBFS
 	bool "HugeTLB file system support"
 	depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
-		   SYS_SUPPORTS_HUGETLBFS || BROKEN
+		   ARCH_SUPPORTS_HUGETLBFS || BROKEN
 	help
 	  hugetlbfs is a filesystem backing for HugeTLB pages, based on
 	  ramfs. For architectures that support it, say Y here and read
_

^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-05-05  3:16   ` incoming Andrew Morton
@ 2021-05-05 17:10     ` Linus Torvalds
  2021-05-05 17:44       ` incoming Andrew Morton
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits

On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Let me resend right now with the same in-reply-to.  Hopefully they will
> land in the correct place.

Well, you re-sent it twice, and I have three copies in my own mailbox,
bot they still don't show up on the mm-commits mailing list.

So the list hates them for some odd reason.

I've picked them up locally, but adding Konstantin to the participants
to see if he can see what's up.

Konstantin: patches 103/106/107 are missing on lore out of Andrew's
series of 143. Odd.

             Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-05-05  1:47 ` incoming Linus Torvalds
@ 2021-05-05  3:16   ` Andrew Morton
  2021-05-05 17:10     ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-05-05  3:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Linux-MM, mm-commits

On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 143 patches
> 
> Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
> 
> Maybe just some mail delay? But at least right now
> 
>    https://lore.kernel.org/mm-commits/
> 
> doesn't show them (and thus 'b4' doesn't work).
> 
> I'll check again later.
> 

Well that's strange.  I see all three via cc:me, but not on linux-mm or
mm-commits.

Let me resend right now with the same in-reply-to.  Hopefully they will
land in the correct place.


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-05-05  1:32 incoming Andrew Morton
@ 2021-05-05  1:47 ` Linus Torvalds
  2021-05-05  3:16   ` incoming Andrew Morton
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2021-05-05  1:47 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 143 patches

Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.

Maybe just some mail delay? But at least right now

   https://lore.kernel.org/mm-commits/

doesn't show them (and thus 'b4' doesn't work).

I'll check again later.

             Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-05-05  1:32 Andrew Morton
  2021-05-05  1:47 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-05-05  1:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


The remainder of the main mm/ queue.

143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Subsystems affected by this patch series:

  mm/pagecache
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/migration
  mm/cma
  mm/ksm
  mm/vmstat
  mm/mmap
  mm/kconfig
  mm/util
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/highmem
  mm/cleanups
  mm/kfence

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Remove nrexceptional tracking", v2:
      mm: introduce and use mapping_empty()
      mm: stop accounting shadow entries
      dax: account DAX entries as nrpages
      mm: remove nrexceptional from inode

    Hugh Dickins <hughd@google.com>:
      mm: remove nrexceptional from inode: remove BUG_ON

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4:
      hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
      hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
      mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
      hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: generalize HUGETLB_PAGE_SIZE_VARIABLE

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Some cleanups for hugetlb":
      mm/hugetlb: use some helper functions to cleanup code
      mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
      mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
      mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
      mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
    Patch series "Cleanup and fixup for khugepaged", v2:
      khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
      khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
      khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
      khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
      mm/huge_memory.c: remove unnecessary local variable ret2
    Patch series "Some cleanups for huge_memory", v3:
      mm/huge_memory.c: rework the function vma_adjust_trans_huge()
      mm/huge_memory.c: make get_huge_zero_page() return bool
      mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
      mm/huge_memory.c: remove redundant PageCompound() check
      mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
      mm/huge_memory.c: use helper function migration_entry_to_page()

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for khugepaged":
      khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
      khugepaged: remove unnecessary out label in collapse_huge_page()
      khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()

    Zi Yan <ziy@nvidia.com>:
      mm: huge_memory: a new debugfs interface for splitting THP tests
      mm: huge_memory: debugfs for file-backed THP split

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for hugetlb", v2:
      mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
      mm/hugeltb: simplify the return code of __vma_reservation_common()
      mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
      mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
      mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "make hugetlb put_page safe for all calling contexts", v5:
      mm/cma: change cma mutex to irq safe spinlock
      hugetlb: no need to drop hugetlb_lock to call cma_release
      hugetlb: add per-hstate mutex to synchronize user adjustments
      hugetlb: create remove_hugetlb_page() to separate functionality
      hugetlb: call update_and_free_page without hugetlb_lock
      hugetlb: change free_pool_huge_page to remove_pool_huge_page
      hugetlb: make free_huge_page irq safe
      hugetlb: add lockdep_assert_held() calls for hugetlb_lock

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Make alloc_contig_range handle Hugetlb pages", v10:
      mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
      mm,compaction: let isolate_migratepages_{range,block} return error codes
      mm,hugetlb: drop clearing of flag from prep_new_huge_page
      mm,hugetlb: split prep_new_huge_page functionality
      mm: make alloc_contig_range handle free hugetlb pages
      mm: make alloc_contig_range handle in-use hugetlb pages
      mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling", v9:
      userfaultfd: add minor fault registration mode
      userfaultfd: disable huge PMD sharing for MINOR registered VMAs
      userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
      userfaultfd: add UFFDIO_CONTINUE ioctl
      userfaultfd: update documentation to describe minor fault handling
      userfaultfd/selftests: add test exercising minor fault handling

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: move RECLAIM* bits to uapi header
      mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks

    Yang Shi <shy828301@gmail.com>:
    Patch series "Make shrinker's nr_deferred memcg aware", v10:
      mm: vmscan: use nid from shrink_control for tracepoint
      mm: vmscan: consolidate shrinker_maps handling code
      mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
      mm: vmscan: remove memcg_shrinker_map_size
      mm: vmscan: use kvfree_rcu instead of call_rcu
      mm: memcontrol: rename shrinker_map to shrinker_info
      mm: vmscan: add shrinker_info_protected() helper
      mm: vmscan: use a new flag to indicate shrinker is registered
      mm: vmscan: add per memcg shrinker nr_deferred
      mm: vmscan: use per memcg nr_deferred of shrinker
      mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
      mm: memcontrol: reparent nr_deferred when memcg offline
      mm: vmscan: shrink deferred objects proportional to priority

Subsystem: mm/compaction

    Pintu Kumar <pintu@codeaurora.org>:
      mm/compaction: remove unused variable sysctl_compact_memory

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: update the COMPACT[STALL|FAIL] events properly

Subsystem: mm/migration

    Minchan Kim <minchan@kernel.org>:
      mm: disable LRU pagevec during the migration temporarily
      mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
      mm: fs: invalidate BH LRU during page migration

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for mm/migrate.c", v3:
      mm/migrate.c: make putback_movable_page() static
      mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
      mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
      mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
      Revert "mm: migrate: skip shared exec THP for NUMA balancing"

Subsystem: mm/cma

    Minchan Kim <minchan@kernel.org>:
      mm: vmstat: add cma statistics

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: cma: use pr_err_ratelimited for CMA warning

    Liam Mark <lmark@codeaurora.org>:
      mm: cma: add trace events for CMA alloc perf testing

    Minchan Kim <minchan@kernel.org>:
      mm: cma: support sysfs
      mm: cma: add the CMA instance name to cma trace events
      mm: use proper type for cma_[alloc|release]

Subsystem: mm/ksm

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for ksm":
      ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
      ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
      ksm: remove dedicated macro KSM_FLAG_MASK
      ksm: fix potential missing rmap_item for stable_node

    Chengyang Fan <cy.fan@huawei.com>:
      mm/ksm: remove unused parameter from remove_trailing_rmap_items()

Subsystem: mm/vmstat

    Hugh Dickins <hughd@google.com>:
      mm: restore node stat checking in /proc/sys/vm/stat_refresh
      mm: no more EINVAL from /proc/sys/vm/stat_refresh
      mm: /proc/sys/vm/stat_refresh skip checking known negative stats
      mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats

    Saravanan D <saravanand@fb.com>:
      x86/mm: track linear mapping split events

Subsystem: mm/mmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap.c: don't unlock VMAs in remap_file_pages()

Subsystem: mm/kconfig

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm: some config cleanups", v2:
      mm: generalize ARCH_HAS_CACHE_LINE_SIZE
      mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
      mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
      mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
      mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK
      mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE

Subsystem: mm/util

    Joe Perches <joe@perches.com>:
      mm/util.c: reduce mem_dump_obj() object size

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/util.c: fix typo

Subsystem: mm/memory-hotplug

    Pavel Tatashin <pasha.tatashin@soleen.com>:
    Patch series "prohibit pinning pages in ZONE_MOVABLE", v11:
      mm/gup: don't pin migrated cma pages in movable zone
      mm/gup: check every subpage of a compound page during isolation
      mm/gup: return an error on migration failure
      mm/gup: check for isolation errors
      mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
      mm: apply per-task gfp constraints in fast path
      mm: honor PF_MEMALLOC_PIN for all movable pages
      mm/gup: do not migrate zero page
      mm/gup: migrate pinned pages out of movable zone
      memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
      mm/gup: change index type to long as it counts pages
      mm/gup: longterm pin migration cleanup
      selftests/vm: gup_test: fix test flag
      selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages

    Mel Gorman <mgorman@techsingularity.net>:
      mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Allocate memmap from hotadded memory (per device)", v10:
      drivers/base/memory: introduce memory_block_{online,offline}
      mm,memory_hotplug: relax fully spanned sections check

    David Hildenbrand <david@redhat.com>:
      mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: allocate memmap from the added memory range
      acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
      mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
      x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
      arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE

Subsystem: mm/zswap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/zswap.c: switch from strlcpy to strscpy

Subsystem: mm/zsmalloc

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
    Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()":
      iov_iter: lift memzero_page() to highmem.h
      btrfs: use memzero_page() instead of open coded kmap pattern

    songqiang <songqiang@uniontech.com>:
      mm/highmem.c: fix coding style issue

Subsystem: mm/cleanups

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/mempool: minor coding style tweaks

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      mm/process_vm_access.c: remove duplicate include

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: zero guard page after out-of-bounds access
    Patch series "kfence: optimize timer scheduling", v2:
      kfence: await for allocation using wait_event
      kfence: maximize allocation wait timeout duration
      kfence: use power-efficient work queue to run delayed work

 Documentation/ABI/testing/sysfs-kernel-mm-cma     |   25 
 Documentation/admin-guide/kernel-parameters.txt   |   17 
 Documentation/admin-guide/mm/memory-hotplug.rst   |    9 
 Documentation/admin-guide/mm/userfaultfd.rst      |  105 +-
 arch/arc/Kconfig                                  |    9 
 arch/arm/Kconfig                                  |   10 
 arch/arm64/Kconfig                                |   34 
 arch/arm64/mm/hugetlbpage.c                       |    7 
 arch/ia64/Kconfig                                 |   14 
 arch/ia64/mm/hugetlbpage.c                        |    3 
 arch/mips/Kconfig                                 |    6 
 arch/mips/mm/hugetlbpage.c                        |    4 
 arch/parisc/Kconfig                               |    5 
 arch/parisc/mm/hugetlbpage.c                      |    2 
 arch/powerpc/Kconfig                              |   17 
 arch/powerpc/mm/hugetlbpage.c                     |    3 
 arch/powerpc/platforms/Kconfig.cputype            |   16 
 arch/riscv/Kconfig                                |    5 
 arch/s390/Kconfig                                 |   12 
 arch/s390/mm/hugetlbpage.c                        |    2 
 arch/sh/Kconfig                                   |    7 
 arch/sh/mm/Kconfig                                |    8 
 arch/sh/mm/hugetlbpage.c                          |    2 
 arch/sparc/mm/hugetlbpage.c                       |    2 
 arch/x86/Kconfig                                  |   33 
 arch/x86/mm/pat/set_memory.c                      |    8 
 drivers/acpi/acpi_memhotplug.c                    |    5 
 drivers/base/memory.c                             |  105 ++
 fs/Kconfig                                        |    5 
 fs/block_dev.c                                    |    2 
 fs/btrfs/compression.c                            |    5 
 fs/btrfs/extent_io.c                              |   22 
 fs/btrfs/inode.c                                  |   33 
 fs/btrfs/reflink.c                                |    6 
 fs/btrfs/zlib.c                                   |    5 
 fs/btrfs/zstd.c                                   |    5 
 fs/buffer.c                                       |   36 
 fs/dax.c                                          |    8 
 fs/gfs2/glock.c                                   |    3 
 fs/hugetlbfs/inode.c                              |    9 
 fs/inode.c                                        |   11 
 fs/proc/task_mmu.c                                |    3 
 fs/userfaultfd.c                                  |  149 +++
 include/linux/buffer_head.h                       |    4 
 include/linux/cma.h                               |    4 
 include/linux/compaction.h                        |    1 
 include/linux/fs.h                                |    2 
 include/linux/gfp.h                               |    2 
 include/linux/highmem.h                           |    7 
 include/linux/huge_mm.h                           |    3 
 include/linux/hugetlb.h                           |   37 
 include/linux/memcontrol.h                        |   27 
 include/linux/memory.h                            |    8 
 include/linux/memory_hotplug.h                    |   15 
 include/linux/memremap.h                          |    2 
 include/linux/migrate.h                           |   11 
 include/linux/mm.h                                |   28 
 include/linux/mmzone.h                            |   20 
 include/linux/pagemap.h                           |    5 
 include/linux/pgtable.h                           |   12 
 include/linux/sched.h                             |    2 
 include/linux/sched/mm.h                          |   27 
 include/linux/shrinker.h                          |    7 
 include/linux/swap.h                              |   21 
 include/linux/userfaultfd_k.h                     |   55 +
 include/linux/vm_event_item.h                     |    8 
 include/trace/events/cma.h                        |   92 +-
 include/trace/events/migrate.h                    |   25 
 include/trace/events/mmflags.h                    |    7 
 include/uapi/linux/mempolicy.h                    |    7 
 include/uapi/linux/userfaultfd.h                  |   36 
 init/Kconfig                                      |    5 
 kernel/sysctl.c                                   |    2 
 lib/Kconfig.kfence                                |    1 
 lib/iov_iter.c                                    |    8 
 mm/Kconfig                                        |   28 
 mm/Makefile                                       |    6 
 mm/cma.c                                          |   70 +
 mm/cma.h                                          |   25 
 mm/cma_debug.c                                    |    8 
 mm/cma_sysfs.c                                    |  112 ++
 mm/compaction.c                                   |  113 ++
 mm/filemap.c                                      |   24 
 mm/frontswap.c                                    |   12 
 mm/gup.c                                          |  264 +++---
 mm/gup_test.c                                     |   29 
 mm/gup_test.h                                     |    3 
 mm/highmem.c                                      |   11 
 mm/huge_memory.c                                  |  326 +++++++-
 mm/hugetlb.c                                      |  843 ++++++++++++++--------
 mm/hugetlb_cgroup.c                               |    9 
 mm/internal.h                                     |   10 
 mm/kfence/core.c                                  |   61 +
 mm/khugepaged.c                                   |   63 -
 mm/ksm.c                                          |   17 
 mm/list_lru.c                                     |    6 
 mm/memcontrol.c                                   |  137 ---
 mm/memory_hotplug.c                               |  220 +++++
 mm/mempolicy.c                                    |   16 
 mm/mempool.c                                      |    2 
 mm/migrate.c                                      |  103 --
 mm/mlock.c                                        |    4 
 mm/mmap.c                                         |   18 
 mm/oom_kill.c                                     |    2 
 mm/page_alloc.c                                   |   83 +-
 mm/process_vm_access.c                            |    1 
 mm/shmem.c                                        |    2 
 mm/sparse.c                                       |    4 
 mm/swap.c                                         |   69 +
 mm/swap_state.c                                   |    4 
 mm/swapfile.c                                     |    4 
 mm/truncate.c                                     |   19 
 mm/userfaultfd.c                                  |   39 -
 mm/util.c                                         |   26 
 mm/vmalloc.c                                      |    2 
 mm/vmscan.c                                       |  543 +++++++++-----
 mm/vmstat.c                                       |   45 -
 mm/workingset.c                                   |    1 
 mm/zsmalloc.c                                     |    6 
 mm/zswap.c                                        |    2 
 tools/testing/selftests/vm/.gitignore             |    1 
 tools/testing/selftests/vm/Makefile               |    1 
 tools/testing/selftests/vm/gup_test.c             |   38 
 tools/testing/selftests/vm/split_huge_page_test.c |  400 ++++++++++
 tools/testing/selftests/vm/userfaultfd.c          |  164 ++++
 125 files changed, 3596 insertions(+), 1668 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-04-30  5:52 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-04-30  5:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A few misc subsystems and some of MM.


178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0.

Subsystems affected by this patch series:

  ia64
  kbuild
  scripts
  sh
  ocfs2
  kfifo
  vfs
  kernel/watchdog
  mm/slab-generic
  mm/slub
  mm/kmemleak
  mm/debug
  mm/pagecache
  mm/msync
  mm/gup
  mm/memremap
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/dma
  mm/sparsemem
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/memory-failure

Subsystem: ia64

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      arch/ia64/kernel/head.S: remove duplicate include

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      arch/ia64/kernel/fsys.S: fix typos
      arch/ia64/include/asm/pgtable.h: minor typo fixes

    Valentin Schneider <valentin.schneider@arm.com>:
      ia64: ensure proper NUMA distance and possible map initialization

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: drop unused IA64_FW_EMU ifdef
      ia64: simplify code flow around swiotlb init

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ia64: trivial spelling fixes

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix EFI_DEBUG build
      ia64: mca: always make IA64_MCA_DEBUG an expression
      ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP
      ia64: module: fix symbolizer crash on fdescr

Subsystem: kbuild

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*()

Subsystem: scripts

    Tom Saeger <tom.saeger@oracle.com>:
      scripts/spelling.txt: add entries for recent discoveries

    Wan Jiabing <wanjiabing@vivo.com>:
      scripts: a new script for checking duplicate struct declaration

Subsystem: sh

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      arch/sh/include/asm/tlb.h: remove duplicate include

Subsystem: ocfs2

    Yang Li <yang.lee@linux.alibaba.com>:
      ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: map flags directly in flags_to_o2dlm()

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ocfs2: fix a typo

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      ocfs2/dlm: remove unused function

Subsystem: kfifo

    Dan Carpenter <dan.carpenter@oracle.com>:
      kfifo: fix ternary sign extension bugs

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      vfs: fs_parser: clean up kernel-doc warnings

Subsystem: kernel/watchdog

    Petr Mladek <pmladek@suse.com>:
    Patch series "watchdog/softlockup: Report overall time and some cleanup", v2:
      watchdog: rename __touch_watchdog() to a better descriptive name
      watchdog: explicitly update timestamp when reporting softlockup
      watchdog/softlockup: report the overall time of softlockups
      watchdog/softlockup: remove logic that tried to prevent repeated reports
      watchdog: fix barriers when printing backtraces from all CPUs
      watchdog: cleanup handling of false positives

Subsystem: mm/slab-generic

    Rafael Aquini <aquini@redhat.com>:
      mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: enable slub_debug static key when creating cache with explicit debug flags

    Oliver Glitta <glittao@gmail.com>:
      kunit: add a KUnit test for SLUB debugging functionality
      slub: remove resiliency_test() function

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/slub.c: trivial typo fixes

Subsystem: mm/kmemleak

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/kmemleak.c: fix a typo

Subsystem: mm/debug

    Georgi Djakov <georgi.djakov@linaro.org>:
      mm/page_owner: record the timestamp of all pages during free

    zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
      mm, page_owner: remove unused parameter in __set_page_owner_handle

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_owner: fetch backtrace only for tracked pages
      mm: page_owner: use kstrtobool() to parse bool option
      mm: page_owner: detect page_owner recursion via task_struct
      mm: page_poison: print page info when corruption is caught

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memtest: add ARCH_USE_MEMTEST

Subsystem: mm/pagecache

    Jens Axboe <axboe@kernel.dk>:
    Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3:
      mm: provide filemap_range_needs_writeback() helper
      mm: use filemap_range_needs_writeback() for O_DIRECT reads
      iomap: use filemap_range_needs_writeback() for O_DIRECT reads

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap: use filemap_read_page in filemap_fault
      mm/filemap: drop check for truncated page after I/O

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page-writeback: simplify memcg handling in test_clear_page_writeback()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move page_mapping_file to pagemap.h

    Rui Sun <sunrui26@huawei.com>:
      mm/filemap: update stale comment

Subsystem: mm/msync

    Nikita Ermakov <sh1r4s3@mail.si-head.nl>:
      mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start

Subsystem: mm/gup

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm/gup: page unpining improvements", v4:
      mm/gup: add compound page list iterator
      mm/gup: decrement head page once for group of subpages
      mm/gup: add a range variant of unpin_user_pages_dirty_lock()
      RDMA/umem: batch page unpin in __ib_umem_release()

    Yang Shi <shy828301@gmail.com>:
      mm: gup: remove FOLL_SPLIT

Subsystem: mm/memremap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/memremap.c: fix improper SPDX comment style

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix kernel stack account

    Shakeel Butt <shakeelb@google.com>:
      memcg: cleanup root memcg checks
      memcg: enable memcg oom-kill for __GFP_NOFAIL

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "mm: memcontrol: switch to rstat", v3:
      mm: memcontrol: fix cpuhotplug statistics flushing
      mm: memcontrol: kill mem_cgroup_nodeinfo()
      mm: memcontrol: privatize memcg_page_state query functions
      cgroup: rstat: support cgroup1
      cgroup: rstat: punt root-level optimization to individual controllers
      mm: memcontrol: switch to rstat
      mm: memcontrol: consolidate lruvec stat flushing
      kselftests: cgroup: update kmem test for new vmstat implementation

    Shakeel Butt <shakeelb@google.com>:
      memcg: charge before adding to swapcache on swapin

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Use obj_cgroup APIs to charge kmem pages", v5:
      mm: memcontrol: slab: fix obtain a reference to a freeing memcg
      mm: memcontrol: introduce obj_cgroup_{un}charge_pages
      mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c
      mm: memcontrol: change ug->dummy_page only if memcg changed
      mm: memcontrol: use obj_cgroup APIs to charge kmem pages
      mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages()
      mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM

    Wan Jiabing <wanjiabing@vivo.com>:
      linux/memcontrol.h: remove duplicate struct declaration

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page_counter: mitigate consequences of a page_counter underflow

Subsystem: mm/pagemap

    Wang Qing <wangqing@vivo.com>:
      mm/memory.c: do_numa_page(): delete bool "migrated"

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/interval_tree: add comments to improve code readability

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Cleanup and fixups for vmemmap handling", v6:
      x86/vmemmap: drop handling of 4K unaligned vmemmap range
      x86/vmemmap: drop handling of 1GB vmemmap ranges
      x86/vmemmap: handle unpopulated sub-pmd ranges
      x86/vmemmap: optimize for consecutive sections in partial populated PMDs

    Ovidiu Panait <ovidiu.panait@windriver.com>:
      mm, tracing: improve rss_stat tracepoint message

    Christoph Hellwig <hch@lst.de>:
    Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2:
      mm: add remap_pfn_range_notrack
      mm: add a io_mapping_map_user helper
      i915: use io_mapping_map_user
      i915: fix remap_io_sg to verify the pgprot

    Huang Ying <ying.huang@intel.com>:
      NUMA balancing: reduce TLB flush via delaying mapping on hint page fault

Subsystem: mm/mremap

    Brian Geffon <bgeffon@google.com>:
    Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5:
      mm: extend MREMAP_DONTUNMAP to non-anonymous mappings
      Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio"
      selftests: add a MREMAP_DONTUNMAP selftest for shmem

Subsystem: mm/dma

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/dmapool: switch from strlcpy to strscpy

Subsystem: mm/sparsemem

    Wang Wensheng <wangwensheng4@huawei.com>:
      mm/sparse: add the missing sparse_buffer_fini() in error branch

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
    Patch series "remap_vmalloc_range cleanups":
      samples/vfio-mdev/mdpy: use remap_vmalloc_range
      mm: unexport remap_vmalloc_range_partial

    Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>:
      mm/vmalloc: use rb_tree instead of list for vread() lookups

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "huge vmalloc mappings", v13:
      ARM: mm: add missing pud_page define to 2-level page tables
      mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page
      mm: apply_to_pte_range warn and fail if a large pte is encountered
      mm/vmalloc: rename vmap_*_range vmap_pages_*_range
      mm/ioremap: rename ioremap_*_range to vmap_*_range
      mm: HUGE_VMAP arch support cleanup
      powerpc: inline huge vmap supported functions
      arm64: inline huge vmap supported functions
      x86: inline huge vmap supported functions
      mm/vmalloc: provide fallback arch huge vmap support functions
      mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c
      mm/vmalloc: add vmap_range_noflush variant
      mm/vmalloc: hugepage vmalloc mappings
    Patch series "mm/vmalloc: cleanup after hugepage series", v2:
      mm/vmalloc: remove map_kernel_range
      kernel/dma: remove unnecessary unmap_kernel_range
      powerpc/xive: remove unnecessary unmap_kernel_range
      mm/vmalloc: remove unmap_kernel_range
      mm/vmalloc: improve allocation failure error messages

    Vijayanand Jitta <vjitta@codeaurora.org>:
      mm: vmalloc: prevent use after free in _vm_unmap_aliases

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      lib/test_vmalloc.c: remove two kvfree_rcu() tests
      lib/test_vmalloc.c: add a new 'nr_threads' parameter
      vm/test_vmalloc.sh: adapt for updated driver interface
      mm/vmalloc: refactor the preloading loagic
      mm/vmalloc: remove an empty line

Subsystem: mm/documentation

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/doc: fix fault_flag_allow_retry_first kerneldoc
      mm/doc: fix page_maybe_dma_pinned kerneldoc
      mm/doc: turn fault flags into an enum
      mm/doc: add mm.h and mm_types.h to the mm-api document

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
    Patch series "kernel-doc and MAINTAINERS clean-up":
      MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT
      pagewalk: prefix struct kernel-doc descriptions

Subsystem: mm/kasan

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/kasan: switch from strlcpy to strscpy

    Peter Collingbourne <pcc@google.com>:
      kasan: fix kasan_byte_accessible() to be consistent with actual checks

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: initialize shadow to TAG_INVALID for SW_TAGS
      mm, kasan: don't poison boot memory with tag-based modes
    Patch series "kasan: integrate with init_on_alloc/free", v3:
      arm64: kasan: allow to init memory when setting tags
      kasan: init memory in kasan_(un)poison for HW_TAGS
      kasan, mm: integrate page_alloc init with HW_TAGS
      kasan, mm: integrate slab init_on_alloc with HW_TAGS
      kasan, mm: integrate slab init_on_free with HW_TAGS
      kasan: docs: clean up sections
      kasan: docs: update overview section
      kasan: docs: update usage section
      kasan: docs: update error reports section
      kasan: docs: update boot parameters section
      kasan: docs: update GENERIC implementation details section
      kasan: docs: update SW_TAGS implementation details section
      kasan: docs: update HW_TAGS implementation details section
      kasan: docs: update shadow memory section
      kasan: docs: update ignoring accesses section
      kasan: docs: update tests section

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: record task_work_add() call stack

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: detect false-positives in tests

    Zqiang <qiang.zhang@windriver.com>:
      irq_work: record irq_work_queue() call stack

Subsystem: mm/initialization

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: move mem_init_print_info() into mm_init()

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range()

    Minchan Kim <minchan@kernel.org>:
      mm: remove lru_add_drain_all in alloc_contig_range

    Yu Zhao <yuzhao@google.com>:
      include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH
      include/linux/page-flags-layout.h: cleanups

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Rationalise __alloc_pages wrappers", v3:
      mm/page_alloc: rename alloc_mask to alloc_gfp
      mm/page_alloc: rename gfp_mask to gfp
      mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask
      mm/mempolicy: rename alloc_pages_current to alloc_pages
      mm/mempolicy: rewrite alloc_pages documentation
      mm/mempolicy: rewrite alloc_pages_vma documentation
      mm/mempolicy: fix mpol_misplaced kernel-doc

    Minchan Kim <minchan@kernel.org>:
      mm: page_alloc: dump migrate-failed pages

    Geert Uytterhoeven <geert@linux-m68k.org>:
      mm/Kconfig: remove default DISCONTIGMEM_MANUAL

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm, page_alloc: avoid page_to_pfn() in move_freepages()

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/page_alloc: duplicate include linux/vmalloc.h

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6:
      mm/page_alloc: rename alloced to allocated
      mm/page_alloc: add a bulk page allocator
      mm/page_alloc: add an array-based interface to the bulk page allocator

    Jesper Dangaard Brouer <brouer@redhat.com>:
      mm/page_alloc: optimize code layout for __alloc_pages_bulk
      mm/page_alloc: inline __rmqueue_pcplist

    Chuck Lever <chuck.lever@oracle.com>:
    Patch series "SUNRPC consumer for the bulk page allocator":
      SUNRPC: set rq_page_end differently
      SUNRPC: refresh rq_pages using a bulk page allocator

    Jesper Dangaard Brouer <brouer@redhat.com>:
      net: page_pool: refactor dma_map into own function page_pool_dma_map
      net: page_pool: use alloc_pages_bulk in refill code path

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1

    huxiang <huxiang@uniontech.com>:
      mm/page_alloc: redundant definition variables of pfn in for loop

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/mmzone.h: fix existing kernel-doc comments and link them to core-api

Subsystem: mm/memory-failure

    Jane Chu <jane.chu@oracle.com>:
      mm/memory-failure: unnecessary amount of unmapping

 Documentation/admin-guide/kernel-parameters.txt |    7 
 Documentation/admin-guide/mm/transhuge.rst      |    2 
 Documentation/core-api/cachetlb.rst             |    4 
 Documentation/core-api/mm-api.rst               |    6 
 Documentation/dev-tools/kasan.rst               |  355 +++++-----
 Documentation/vm/page_owner.rst                 |    2 
 Documentation/vm/transhuge.rst                  |    5 
 MAINTAINERS                                     |    1 
 arch/Kconfig                                    |   11 
 arch/alpha/mm/init.c                            |    1 
 arch/arc/mm/init.c                              |    1 
 arch/arm/Kconfig                                |    1 
 arch/arm/include/asm/pgtable-3level.h           |    2 
 arch/arm/include/asm/pgtable.h                  |    3 
 arch/arm/mm/copypage-v4mc.c                     |    1 
 arch/arm/mm/copypage-v6.c                       |    1 
 arch/arm/mm/copypage-xscale.c                   |    1 
 arch/arm/mm/init.c                              |    2 
 arch/arm64/Kconfig                              |    1 
 arch/arm64/include/asm/memory.h                 |    4 
 arch/arm64/include/asm/mte-kasan.h              |   39 -
 arch/arm64/include/asm/vmalloc.h                |   38 -
 arch/arm64/mm/init.c                            |    4 
 arch/arm64/mm/mmu.c                             |   36 -
 arch/csky/abiv1/cacheflush.c                    |    1 
 arch/csky/mm/init.c                             |    1 
 arch/h8300/mm/init.c                            |    2 
 arch/hexagon/mm/init.c                          |    1 
 arch/ia64/Kconfig                               |   23 
 arch/ia64/configs/bigsur_defconfig              |    1 
 arch/ia64/include/asm/meminit.h                 |   11 
 arch/ia64/include/asm/module.h                  |    6 
 arch/ia64/include/asm/page.h                    |   25 
 arch/ia64/include/asm/pgtable.h                 |    7 
 arch/ia64/kernel/Makefile                       |    2 
 arch/ia64/kernel/acpi.c                         |    7 
 arch/ia64/kernel/efi.c                          |   11 
 arch/ia64/kernel/fsys.S                         |    4 
 arch/ia64/kernel/head.S                         |    6 
 arch/ia64/kernel/ia64_ksyms.c                   |   12 
 arch/ia64/kernel/machine_kexec.c                |    2 
 arch/ia64/kernel/mca.c                          |    4 
 arch/ia64/kernel/module.c                       |   29 
 arch/ia64/kernel/pal.S                          |    6 
 arch/ia64/mm/Makefile                           |    1 
 arch/ia64/mm/contig.c                           |    4 
 arch/ia64/mm/discontig.c                        |   21 
 arch/ia64/mm/fault.c                            |   15 
 arch/ia64/mm/init.c                             |  221 ------
 arch/m68k/mm/init.c                             |    1 
 arch/microblaze/mm/init.c                       |    1 
 arch/mips/Kconfig                               |    1 
 arch/mips/loongson64/numa.c                     |    1 
 arch/mips/mm/cache.c                            |    1 
 arch/mips/mm/init.c                             |    1 
 arch/mips/sgi-ip27/ip27-memory.c                |    1 
 arch/nds32/mm/init.c                            |    1 
 arch/nios2/mm/cacheflush.c                      |    1 
 arch/nios2/mm/init.c                            |    1 
 arch/openrisc/mm/init.c                         |    2 
 arch/parisc/mm/init.c                           |    2 
 arch/powerpc/Kconfig                            |    1 
 arch/powerpc/include/asm/vmalloc.h              |   34 -
 arch/powerpc/kernel/isa-bridge.c                |    4 
 arch/powerpc/kernel/pci_64.c                    |    2 
 arch/powerpc/mm/book3s64/radix_pgtable.c        |   29 
 arch/powerpc/mm/ioremap.c                       |    2 
 arch/powerpc/mm/mem.c                           |    1 
 arch/powerpc/sysdev/xive/common.c               |    4 
 arch/riscv/mm/init.c                            |    1 
 arch/s390/mm/init.c                             |    2 
 arch/sh/include/asm/tlb.h                       |   10 
 arch/sh/mm/cache-sh4.c                          |    1 
 arch/sh/mm/cache-sh7705.c                       |    1 
 arch/sh/mm/init.c                               |    1 
 arch/sparc/include/asm/pgtable_32.h             |    3 
 arch/sparc/mm/init_32.c                         |    2 
 arch/sparc/mm/init_64.c                         |    1 
 arch/sparc/mm/tlb.c                             |    1 
 arch/um/kernel/mem.c                            |    1 
 arch/x86/Kconfig                                |    1 
 arch/x86/include/asm/vmalloc.h                  |   42 -
 arch/x86/kernel/cpu/resctrl/pseudo_lock.c       |    2 
 arch/x86/mm/init_32.c                           |    2 
 arch/x86/mm/init_64.c                           |  222 ++++--
 arch/x86/mm/ioremap.c                           |   33 
 arch/x86/mm/pgtable.c                           |   13 
 arch/xtensa/Kconfig                             |    1 
 arch/xtensa/mm/init.c                           |    1 
 block/blk-cgroup.c                              |   17 
 drivers/gpu/drm/i915/Kconfig                    |    1 
 drivers/gpu/drm/i915/gem/i915_gem_mman.c        |    9 
 drivers/gpu/drm/i915/i915_drv.h                 |    3 
 drivers/gpu/drm/i915/i915_mm.c                  |  117 ---
 drivers/infiniband/core/umem.c                  |   12 
 drivers/pci/pci.c                               |    2 
 fs/aio.c                                        |    5 
 fs/fs_parser.c                                  |    2 
 fs/iomap/direct-io.c                            |   24 
 fs/ocfs2/blockcheck.c                           |    2 
 fs/ocfs2/dlm/dlmrecovery.c                      |    7 
 fs/ocfs2/stack_o2cb.c                           |   36 -
 fs/ocfs2/stackglue.c                            |    2 
 include/linux/compiler-gcc.h                    |    8 
 include/linux/fs.h                              |    2 
 include/linux/gfp.h                             |   45 -
 include/linux/io-mapping.h                      |    3 
 include/linux/io.h                              |    9 
 include/linux/kasan.h                           |   51 +
 include/linux/memcontrol.h                      |  271 ++++----
 include/linux/mm.h                              |   50 -
 include/linux/mmzone.h                          |   43 -
 include/linux/page-flags-layout.h               |   64 -
 include/linux/pagemap.h                         |   10 
 include/linux/pagewalk.h                        |    4 
 include/linux/sched.h                           |    4 
 include/linux/slab.h                            |    2 
 include/linux/slub_def.h                        |    2 
 include/linux/vmalloc.h                         |   73 +-
 include/linux/vmstat.h                          |   24 
 include/net/page_pool.h                         |    2 
 include/trace/events/kmem.h                     |   24 
 init/main.c                                     |    2 
 kernel/cgroup/cgroup.c                          |   34 -
 kernel/cgroup/rstat.c                           |   61 +
 kernel/dma/remap.c                              |    1 
 kernel/fork.c                                   |   13 
 kernel/irq_work.c                               |    7 
 kernel/task_work.c                              |    3 
 kernel/watchdog.c                               |  102 +--
 lib/Kconfig.debug                               |   14 
 lib/Makefile                                    |    1 
 lib/test_kasan.c                                |   59 -
 lib/test_slub.c                                 |  124 +++
 lib/test_vmalloc.c                              |  128 +--
 mm/Kconfig                                      |    4 
 mm/Makefile                                     |    1 
 mm/debug_vm_pgtable.c                           |    4 
 mm/dmapool.c                                    |    2 
 mm/filemap.c                                    |   61 +
 mm/gup.c                                        |  145 +++-
 mm/hugetlb.c                                    |    2 
 mm/internal.h                                   |   25 
 mm/interval_tree.c                              |    2 
 mm/io-mapping.c                                 |   29 
 mm/ioremap.c                                    |  361 ++--------
 mm/kasan/common.c                               |   53 -
 mm/kasan/generic.c                              |   12 
 mm/kasan/kasan.h                                |   28 
 mm/kasan/report_generic.c                       |    2 
 mm/kasan/shadow.c                               |   10 
 mm/kasan/sw_tags.c                              |   12 
 mm/kmemleak.c                                   |    2 
 mm/memcontrol.c                                 |  798 ++++++++++++------------
 mm/memory-failure.c                             |    2 
 mm/memory.c                                     |  191 +++--
 mm/mempolicy.c                                  |   78 --
 mm/mempool.c                                    |    4 
 mm/memremap.c                                   |    2 
 mm/migrate.c                                    |    2 
 mm/mm_init.c                                    |    4 
 mm/mmap.c                                       |    6 
 mm/mremap.c                                     |    6 
 mm/msync.c                                      |    6 
 mm/page-writeback.c                             |    9 
 mm/page_alloc.c                                 |  430 +++++++++---
 mm/page_counter.c                               |    8 
 mm/page_owner.c                                 |   68 --
 mm/page_poison.c                                |    6 
 mm/percpu-vm.c                                  |    7 
 mm/slab.c                                       |   43 -
 mm/slab.h                                       |   24 
 mm/slab_common.c                                |   10 
 mm/slub.c                                       |  215 ++----
 mm/sparse.c                                     |    1 
 mm/swap_state.c                                 |   13 
 mm/util.c                                       |   10 
 mm/vmalloc.c                                    |  728 ++++++++++++++++-----
 net/core/page_pool.c                            |  127 ++-
 net/sunrpc/svc_xprt.c                           |   38 -
 samples/kfifo/bytestream-example.c              |    8 
 samples/kfifo/inttype-example.c                 |    8 
 samples/kfifo/record-example.c                  |    8 
 samples/vfio-mdev/mdpy.c                        |    4 
 scripts/checkdeclares.pl                        |   53 +
 scripts/spelling.txt                            |   26 
 tools/testing/selftests/cgroup/test_kmem.c      |   22 
 tools/testing/selftests/vm/mremap_dontunmap.c   |   52 +
 tools/testing/selftests/vm/test_vmalloc.sh      |   21 
 189 files changed, 3642 insertions(+), 3013 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-04-23 21:28 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966.

Subsystems affected by this patch series:

  coda
  overlayfs
  mm/pagecache
  mm/memcg

Subsystem: coda

    Christian König <christian.koenig@amd.com>:
      coda: fix reference counting in coda_file_mmap error path

Subsystem: overlayfs

    Christian König <christian.koenig@amd.com>:
      ovl: fix reference counting in ovl_mmap error path

Subsystem: mm/pagecache

    Hugh Dickins <hughd@google.com>:
      mm/filemap: fix find_lock_entries hang on 32-bit THP
      mm/filemap: fix mapping_seek_hole_data on THP & 32-bit

Subsystem: mm/memcg

    Vasily Averin <vvs@virtuozzo.com>:
      tools/cgroup/slabinfo.py: updated to work on current kernel

 fs/coda/file.c                 |    6 +++---
 fs/overlayfs/file.c            |   11 +----------
 mm/filemap.c                   |   31 +++++++++++++++++++------------
 tools/cgroup/memcg_slabinfo.py |    8 ++++----
 4 files changed, 27 insertions(+), 29 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-04-16 22:45 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7.

Subsystems affected by this patch series:

  mm/documentation
  mm/kasan
  csky
  ia64
  mm/pagemap
  gcov
  lib

Subsystem: mm/documentation

    Randy Dunlap <rdunlap@infradead.org>:
      mm: eliminate "expecting prototype" kernel-doc warnings

Subsystem: mm/kasan

    Arnd Bergmann <arnd@arndb.de>:
      kasan: fix hwasan build for gcc

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: csky

    Randy Dunlap <rdunlap@infradead.org>:
      csky: change a Kconfig symbol name to fix e1000 build error

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: remove duplicate entries in generic_defconfig
      ia64: fix discontig.c section mismatches

    John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>:
      ia64: tools: remove inclusion of ia64-specific version of errno.h header

    John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>:
      ia64: tools: remove duplicate definition of ia64_mf() on ia64

Subsystem: mm/pagemap

    Zack Rusin <zackr@vmware.com>:
      mm/mapping_dirty_helpers: guard hugepage pud's usage

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: ptdump: fix build failure

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      gcov: clang: fix clang-11+ build

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: remove "expecting prototype" kernel-doc warnings

 arch/arm64/kernel/sleep.S             |    2 +-
 arch/csky/Kconfig                     |    2 +-
 arch/csky/include/asm/page.h          |    2 +-
 arch/ia64/configs/generic_defconfig   |    2 --
 arch/ia64/mm/discontig.c              |    6 +++---
 arch/x86/kernel/acpi/wakeup_64.S      |    2 +-
 include/linux/kasan.h                 |    2 +-
 kernel/gcov/clang.c                   |    2 +-
 lib/Kconfig.kasan                     |    9 ++-------
 lib/earlycpio.c                       |    4 ++--
 lib/lru_cache.c                       |    3 ++-
 lib/parman.c                          |    4 ++--
 lib/radix-tree.c                      |   11 ++++++-----
 mm/kasan/common.c                     |    2 +-
 mm/kasan/kasan.h                      |    2 +-
 mm/kasan/report_generic.c             |    2 +-
 mm/mapping_dirty_helpers.c            |    2 ++
 mm/mmu_gather.c                       |   29 +++++++++++++++++++----------
 mm/oom_kill.c                         |    2 +-
 mm/ptdump.c                           |    2 +-
 mm/shuffle.c                          |    4 ++--
 scripts/Makefile.kasan                |   22 ++++++++++++++--------
 security/Kconfig.hardening            |    4 ++--
 tools/arch/ia64/include/asm/barrier.h |    3 ---
 tools/include/uapi/asm/errno.h        |    2 --
 25 files changed, 67 insertions(+), 60 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-04-09 20:26 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9.

Subsystems affected by this patch series:

  MAINTAINERS
  mailmap
  mm/kasan
  mm/gup
  nds32
  gcov
  ocfs2
  ia64
  mm/pagecache
  mm/kasan
  mm/kfence
  lib

Subsystem: MAINTAINERS

    Marek Behún <kabel@kernel.org>:
      MAINTAINERS: update CZ.NIC's Turris information
      treewide: change my e-mail address, fix my name

Subsystem: mailmap

    Jordan Crouse <jordan@cosmicpenguin.net>:
      mailmap: update email address for Jordan Crouse

    Matthew Wilcox <willy@infradead.org>:
      .mailmap: fix old email addresses

Subsystem: mm/kasan

    Arnd Bergmann <arnd@arndb.de>:
      kasan: fix hwasan build for gcc

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: mm/gup

    Aili Yao <yaoaili@kingsoft.com>:
      mm/gup: check page posion status for coredump.

Subsystem: nds32

    Mike Rapoport <rppt@linux.ibm.com>:
      nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: re-fix clang-11+ support

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: fix deadlock between setattr and dio_end_io_write

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix user_stack_pointer() for ptrace()

Subsystem: mm/pagecache

    Jack Qiu <jack.qiu@huawei.com>:
      fs: direct-io: fix missing sdio->boundary

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix conflict with page poisoning

    Andrew Morton <akpm@linux-foundation.org>:
      lib/test_kasan_module.c: suppress unused var warning

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence, x86: fix preemptible warning on KPTI-enabled systems

Subsystem: lib

    Julian Braha <julianbraha@gmail.com>:
      lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS

 .mailmap                                                            |    7 ++
 Documentation/ABI/testing/debugfs-moxtet                            |    4 -
 Documentation/ABI/testing/debugfs-turris-mox-rwtm                   |    2 
 Documentation/ABI/testing/sysfs-bus-moxtet-devices                  |    6 +-
 Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia       |    2 
 Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm            |   10 +--
 Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml |    2 
 MAINTAINERS                                                         |   13 +++-
 arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts              |    2 
 arch/arm64/kernel/sleep.S                                           |    2 
 arch/ia64/include/asm/ptrace.h                                      |    8 --
 arch/nds32/mm/cacheflush.c                                          |    2 
 arch/x86/include/asm/kfence.h                                       |    7 ++
 arch/x86/kernel/acpi/wakeup_64.S                                    |    2 
 drivers/bus/moxtet.c                                                |    4 -
 drivers/firmware/turris-mox-rwtm.c                                  |    4 -
 drivers/gpio/gpio-moxtet.c                                          |    4 -
 drivers/leds/leds-turris-omnia.c                                    |    4 -
 drivers/mailbox/armada-37xx-rwtm-mailbox.c                          |    4 -
 drivers/watchdog/armada_37xx_wdt.c                                  |    4 -
 fs/direct-io.c                                                      |    5 +
 fs/ocfs2/aops.c                                                     |   11 ---
 fs/ocfs2/file.c                                                     |    8 ++
 include/dt-bindings/bus/moxtet.h                                    |    2 
 include/linux/armada-37xx-rwtm-mailbox.h                            |    2 
 include/linux/kasan.h                                               |    2 
 include/linux/moxtet.h                                              |    2 
 kernel/gcov/clang.c                                                 |   29 ++++++----
 lib/Kconfig.debug                                                   |    6 +-
 lib/Kconfig.kasan                                                   |    9 ---
 lib/test_kasan_module.c                                             |    2 
 mm/gup.c                                                            |    4 +
 mm/internal.h                                                       |   20 ++++++
 mm/kasan/common.c                                                   |    2 
 mm/kasan/kasan.h                                                    |    2 
 mm/kasan/report_generic.c                                           |    2 
 mm/page_poison.c                                                    |    4 +
 scripts/Makefile.kasan                                              |   18 ++++--
 security/Kconfig.hardening                                          |    4 -
 39 files changed, 136 insertions(+), 91 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-03-13  5:06 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-03-13  5:06 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50.

Subsystems affected by this patch series:

  mm/memblock
  core-kernel
  kconfig
  mm/pagealloc
  fork
  mm/hugetlb
  mm/highmem
  binfmt
  MAINTAINERS
  kbuild
  mm/kfence
  mm/oom-kill
  mm/madvise
  mm/kasan
  mm/userfaultfd
  mm/memory-failure
  ia64
  mm/memcg
  mm/zram

Subsystem: mm/memblock

    Arnd Bergmann <arnd@arndb.de>:
      memblock: fix section mismatch warning

Subsystem: core-kernel

    Arnd Bergmann <arnd@arndb.de>:
      stop_machine: mark helpers __always_inline

Subsystem: kconfig

    Masahiro Yamada <masahiroy@kernel.org>:
      init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc.c: refactor initialization of struct page for holes in memory layout

Subsystem: fork

    Fenghua Yu <fenghua.yu@intel.com>:
      mm/fork: clear PASID for new mm

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5:
      hugetlb: dedup the code to add a new file_region
      hugetlb: break earlier in add_reservation_in_range() when we can
      mm: introduce page_needs_cow_for_dma() for deciding whether cow
      mm: use is_cow_mapping() across tree where proper
      hugetlb: do early cow when page pinned on src mm

Subsystem: mm/highmem

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      mm/highmem.c: fix zero_user_segments() with start > end

Subsystem: binfmt

    Lior Ribak <liorribak@gmail.com>:
      binfmt_misc: fix possible deadlock in bm_register_write

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: exclude uapi directories in API/ABI section

Subsystem: kbuild

    Arnd Bergmann <arnd@arndb.de>:
      linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP*

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: fix printk format for ptrdiff_t
      kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations
      kfence: fix reports if constant function prefixes exist

Subsystem: mm/oom-kill

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include/linux/sched/mm.h: use rcu_dereference in in_vfork()

Subsystem: mm/madvise

    Suren Baghdasaryan <surenb@google.com>:
      mm/madvise: replace ptrace attach requirement for process_madvise

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC
      kasan: fix KASAN_STACK dependency for HW_TAGS

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
      mm/userfaultfd: fix memory corruption due to writeprotect

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm, hwpoison: do not lock page again when me_huge_page() successfully recovers

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls
      ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign

Subsystem: mm/memcg

    Zhou Guanghui <zhouguanghui1@huawei.com>:
      mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument
      mm/memcg: set memcg when splitting page

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      zram: fix return value on writeback_store
      zram: fix broken page writeback

 MAINTAINERS                                |    4 
 arch/ia64/include/asm/syscall.h            |    2 
 arch/ia64/kernel/ptrace.c                  |   24 +++-
 drivers/block/zram/zram_drv.c              |   17 +-
 drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c |    4 
 drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c   |    2 
 fs/binfmt_misc.c                           |   29 ++---
 fs/proc/task_mmu.c                         |    2 
 include/linux/compiler-clang.h             |    6 +
 include/linux/memblock.h                   |    4 
 include/linux/memcontrol.h                 |    6 -
 include/linux/mm.h                         |   21 +++
 include/linux/mm_types.h                   |    1 
 include/linux/sched/mm.h                   |    3 
 include/linux/stop_machine.h               |   11 +
 init/Kconfig                               |    3 
 kernel/fork.c                              |    8 +
 lib/Kconfig.kasan                          |    1 
 mm/highmem.c                               |   17 ++
 mm/huge_memory.c                           |   10 -
 mm/hugetlb.c                               |  123 +++++++++++++++------
 mm/internal.h                              |    5 
 mm/kfence/report.c                         |   30 +++--
 mm/madvise.c                               |   13 ++
 mm/memcontrol.c                            |   15 +-
 mm/memory-failure.c                        |    4 
 mm/memory.c                                |   16 +-
 mm/page_alloc.c                            |  167 ++++++++++++++---------------
 mm/slab.c                                  |    2 
 29 files changed, 334 insertions(+), 216 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-02-26 17:55 ` incoming Linus Torvalds
@ 2021-02-26 19:16   ` Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, Linux-MM

On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - The rest of MM.
> >
> >   Includes kfence - another runtime memory validator.  Not as
> >   thorough as KASAN, but it has unmeasurable overhead and is intended
> >   to be usable in production builds.
> >
> > - Everything else
> 
> Just to clarify: you have nothing else really pending?

Yes, that's it from me for -rc1.




^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-02-26  1:14 incoming Andrew Morton
@ 2021-02-26 17:55 ` Linus Torvalds
  2021-02-26 19:16   ` incoming Andrew Morton
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - The rest of MM.
>
>   Includes kfence - another runtime memory validator.  Not as
>   thorough as KASAN, but it has unmeasurable overhead and is intended
>   to be usable in production builds.
>
> - Everything else

Just to clarify: you have nothing else really pending?

I'm hoping to just do -rc1 this weekend after all - despite my late
start due to loss of power for several days.

I'll allow late stragglers with good reason through, but the fewer of
those there are, the better, of course.

Thanks,
                   Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-02-26  1:14 Andrew Morton
  2021-02-26 17:55 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-02-26  1:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- The rest of MM.

  Includes kfence - another runtime memory validator.  Not as
  thorough as KASAN, but it has unmeasurable overhead and is intended
  to be usable in production builds.

- Everything else


118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab.

Subsystems affected by this patch series:

  mm/thp
  mm/cma
  mm/vmstat
  mm/memory-hotplug
  mm/mlock
  mm/rmap
  mm/zswap
  mm/zsmalloc
  mm/cleanups
  mm/kfence
  mm/kasan2
  alpha
  procfs
  sysctl
  misc
  core-kernel
  MAINTAINERS
  lib
  bitops
  checkpatch
  init
  coredump
  seq_file
  gdb
  ubsan
  initramfs
  mm/pagemap2

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Overhaul multi-page lookups for THP", v4:
      mm: make pagecache tagged lookups return only head pages
      mm/shmem: use pagevec_lookup in shmem_unlock_mapping
      mm/swap: optimise get_shadow_from_swap_cache
      mm: add FGP_ENTRY
      mm/filemap: rename find_get_entry to mapping_get_entry
      mm/filemap: add helper for finding pages
      mm/filemap: add mapping_seek_hole_data
      iomap: use mapping_seek_hole_data
      mm: add and use find_lock_entries
      mm: add an 'end' parameter to find_get_entries
      mm: add an 'end' parameter to pagevec_lookup_entries
      mm: remove nr_entries parameter from pagevec_lookup_entries
      mm: pass pvec directly to find_get_entries
      mm: remove pagevec_lookup_entries

    Rik van Riel <riel@surriel.com>:
    Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6:
      mm,thp,shmem: limit shmem THP alloc gfp_mask
      mm,thp,shm: limit gfp mask to no more than specified
      mm,thp,shmem: make khugepaged obey tmpfs mount flags
      mm,shmem,thp: limit shmem THP allocations to requested zones

Subsystem: mm/cma

    Roman Gushchin <guro@fb.com>:
      mm: cma: allocate cma areas bottom-up

    David Hildenbrand <david@redhat.com>:
      mm/cma: expose all pages to the buddy if activation of an area fails
      mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo

    Patrick Daly <pdaly@codeaurora.org>:
      mm: cma: print region name on failure

Subsystem: mm/vmstat

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: vmstat: fix NOHZ wakeups for node stat changes
      mm: vmstat: add some comments on internal storage of byte items

    Jiang Biao <benbjiang@tencent.com>:
      mm/vmstat.c: erase latency in vmstat_shepherd

Subsystem: mm/memory-hotplug

    Dan Williams <dan.j.williams@intel.com>:
    Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4:
      mm: move pfn_to_online_page() out of line
      mm: teach pfn_to_online_page() to consider subsection validity
      mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions
      mm: fix memory_failure() handling of dax-namespace metadata

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memory_hotplug: rename all existing 'memhp' into 'mhp'

    David Hildenbrand <david@redhat.com>:
      mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: don't store phys_device in memory blocks
      Documentation: sysfs/memory: clarify some memory block device properties

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5:
      mm/memory_hotplug: prevalidate the address range being added with platform
      arm64/mm: define arch_get_mappable_range()
      s390/mm: define arch_get_mappable_range()

    David Hildenbrand <david@redhat.com>:
      virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug

Subsystem: mm/mlock

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mlock: stop counting mlocked pages when none vma is found

Subsystem: mm/rmap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/rmap: correct some obsolete comments of anon_vma
      mm/rmap: remove unneeded semicolon in page_not_mapped()
      mm/rmap: fix obsolete comment in __page_check_anon_rmap()
      mm/rmap: use page_not_mapped in try_to_unmap()
      mm/rmap: correct obsolete comment of page_get_anon_vma()
      mm/rmap: fix potential pte_unmap on an not mapped pte

Subsystem: mm/zswap

    Randy Dunlap <rdunlap@infradead.org>:
      mm: zswap: clean up confusing comment

    Tian Tao <tiantao6@hisilicon.com>:
    Patch series "Fix the compatibility of zsmalloc and zswap":
      mm/zswap: add the flag can_sleep_mapped
      mm: set the sleep_mapped to true for zbud and z3fold

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage()

    Rokudo Yan <wu-yan@tcl.com>:
      zsmalloc: account the number of compacted pages correctly

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: use page_private() to access page->private

Subsystem: mm/cleanups

    Guo Ren <guoren@linux.alibaba.com>:
      mm: page-flags.h: Typo fix (It -> If)

    Daniel Vetter <daniel.vetter@ffwll.ch>:
      mm/dmapool: use might_alloc()
      mm/backing-dev.c: use might_alloc()

    Stephen Zhang <stephenzhangzsd@gmail.com>:
      mm/early_ioremap.c: use __func__ instead of function name

Subsystem: mm/kfence

    Alexander Potapenko <glider@google.com>:
    Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7:
      mm: add Kernel Electric-Fence infrastructure
      x86, kfence: enable KFENCE for x86

    Marco Elver <elver@google.com>:
      arm64, kfence: enable KFENCE for ARM64
      kfence: use pt_regs to generate stack trace on faults

    Alexander Potapenko <glider@google.com>:
      mm, kfence: insert KFENCE hooks for SLAB
      mm, kfence: insert KFENCE hooks for SLUB
      kfence, kasan: make KFENCE compatible with KASAN

    Marco Elver <elver@google.com>:
      kfence, Documentation: add KFENCE documentation
      kfence: add test suite
      MAINTAINERS: add entry for KFENCE
      kfence: report sensitive information based on no_hash_pointers

    Alexander Potapenko <glider@google.com>:
    Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3:
      tracing: add error_report_end trace point
      kfence: use error_report_end tracepoint
      kasan: use error_report_end tracepoint

Subsystem: mm/kasan2

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: optimizations and fixes for HW_TAGS", v4:
      kasan, mm: don't save alloc stacks twice
      kasan, mm: optimize kmalloc poisoning
      kasan: optimize large kmalloc poisoning
      kasan: clean up setting free info in kasan_slab_free
      kasan: unify large kfree checks
      kasan: rework krealloc tests
      kasan, mm: fail krealloc on freed objects
      kasan, mm: optimize krealloc poisoning
      kasan: ensure poisoning size alignment
      arm64: kasan: simplify and inline MTE functions
      kasan: inline HW_TAGS helper functions
      kasan: clarify that only first bug is reported in HW_TAGS

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: remove CONFIG_EXPERIMENTAL from defconfigs

Subsystem: procfs

    Helge Deller <deller@gmx.de>:
      proc/wchan: use printk format instead of lookup_symbol_name()

    Josef Bacik <josef@toxicpanda.com>:
      proc: use kvzalloc for our kernel buffer

Subsystem: sysctl

    Lin Feng <linf@wangsu.com>:
      sysctl.c: fix underflow value setting risk in vm_table

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      include/linux: remove repeated words

    Miguel Ojeda <ojeda@kernel.org>:
      treewide: Miguel has moved

Subsystem: core-kernel

    Hubert Jasudowicz <hubert.jasudowicz@gmail.com>:
      groups: use flexible-array member in struct group_info
      groups: simplify struct group_info allocation

    Randy Dunlap <rdunlap@infradead.org>:
      kernel: delete repeated words in comments

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: add uapi directories to API/ABI section

Subsystem: lib

    Huang Shijie <sjhuang@iluvatar.ai>:
      lib/genalloc.c: change return type to unsigned long for bitmap_set_ll

    Francis Laniel <laniel_francis@privacyrequired.com>:
      string.h: move fortified functions definitions in a dedicated header.

    Yogesh Lal <ylal@codeaurora.org>:
      lib: stackdepot: add support to configure STACK_HASH_SIZE

    Vijayanand Jitta <vjitta@codeaurora.org>:
      lib: stackdepot: add support to disable stack depot
      lib: stackdepot: fix ignoring return value warning

    Masahiro Yamada <masahiroy@kernel.org>:
      lib/cmdline: remove an unneeded local variable in next_arg()

Subsystem: bitops

    Geert Uytterhoeven <geert+renesas@glider.be>:
      include/linux/bitops.h: spelling s/synomyn/synonym/

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: improve blank line after declaration test

    Peng Wang <rocking@linux.alibaba.com>:
      checkpatch: ignore warning designated initializers using NR_CPUS

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: trivial style fixes

    Joe Perches <joe@perches.com>:
      checkpatch: prefer ftrace over function entry/exit printks
      checkpatch: improve TYPECAST_INT_CONSTANT test message

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add warning for avoiding .L prefix symbols in assembly files

    Joe Perches <joe@perches.com>:
      checkpatch: add kmalloc_array_node to unnecessary OOM message check

    Chris Down <chris@chrisdown.name>:
      checkpatch: don't warn about colon termination in linker scripts

    Song Liu <songliubraving@fb.com>:
      checkpatch: do not apply "initialise globals to 0" check to BPF progs

Subsystem: init

    Masahiro Yamada <masahiroy@kernel.org>:
      init/version.c: remove Version_<LINUX_VERSION_CODE> symbol
      init: clean up early_param_on_off() macro

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      init/Kconfig: fix a typo in CC_VERSION_TEXT help text

Subsystem: coredump

    Ira Weiny <ira.weiny@intel.com>:
      fs/coredump: use kmap_local_page()

Subsystem: seq_file

    NeilBrown <neilb@suse.de>:
    Patch series "Fix some seq_file users that were recently broken":
      seq_file: document how per-entry resources are managed.
      x86: fix seq_file iteration for pat/memtype.c

Subsystem: gdb

    George Prekas <prekageo@amazon.com>:
      scripts/gdb: fix list_for_each

    Sumit Garg <sumit.garg@linaro.org>:
      kgdb: fix to kill breakpoints on initmem after boot

Subsystem: ubsan

    Andrey Ryabinin <ryabinin.a.a@gmail.com>:
      ubsan: remove overflow checks

Subsystem: initramfs

    Florian Fainelli <f.fainelli@gmail.com>:
      initramfs: panic with memory information

Subsystem: mm/pagemap2

    Huang Pei <huangpei@loongson.cn>:
      MIPS: make userspace mapping young by default

 .mailmap                                            |    1 
 CREDITS                                             |    9 
 Documentation/ABI/testing/sysfs-devices-memory      |   58 -
 Documentation/admin-guide/auxdisplay/cfag12864b.rst |    2 
 Documentation/admin-guide/auxdisplay/ks0108.rst     |    2 
 Documentation/admin-guide/kernel-parameters.txt     |    6 
 Documentation/admin-guide/mm/memory-hotplug.rst     |   20 
 Documentation/dev-tools/index.rst                   |    1 
 Documentation/dev-tools/kasan.rst                   |    8 
 Documentation/dev-tools/kfence.rst                  |  318 +++++++
 Documentation/filesystems/seq_file.rst              |    6 
 MAINTAINERS                                         |   26 
 arch/alpha/configs/defconfig                        |    1 
 arch/arm64/Kconfig                                  |    1 
 arch/arm64/include/asm/cache.h                      |    1 
 arch/arm64/include/asm/kasan.h                      |    1 
 arch/arm64/include/asm/kfence.h                     |   26 
 arch/arm64/include/asm/mte-def.h                    |    2 
 arch/arm64/include/asm/mte-kasan.h                  |   65 +
 arch/arm64/include/asm/mte.h                        |    2 
 arch/arm64/kernel/mte.c                             |   46 -
 arch/arm64/lib/mte.S                                |   16 
 arch/arm64/mm/fault.c                               |    8 
 arch/arm64/mm/mmu.c                                 |   23 
 arch/mips/mm/cache.c                                |   30 
 arch/s390/mm/init.c                                 |    1 
 arch/s390/mm/vmem.c                                 |   14 
 arch/x86/Kconfig                                    |    1 
 arch/x86/include/asm/kfence.h                       |   76 +
 arch/x86/mm/fault.c                                 |   10 
 arch/x86/mm/pat/memtype.c                           |    4 
 drivers/auxdisplay/cfag12864b.c                     |    4 
 drivers/auxdisplay/cfag12864bfb.c                   |    4 
 drivers/auxdisplay/ks0108.c                         |    4 
 drivers/base/memory.c                               |   35 
 drivers/block/zram/zram_drv.c                       |    2 
 drivers/hv/hv_balloon.c                             |    2 
 drivers/virtio/virtio_mem.c                         |   43 
 drivers/xen/balloon.c                               |    2 
 fs/coredump.c                                       |    4 
 fs/iomap/seek.c                                     |  125 --
 fs/proc/base.c                                      |   21 
 fs/proc/proc_sysctl.c                               |    4 
 include/linux/bitops.h                              |    2 
 include/linux/cfag12864b.h                          |    2 
 include/linux/cred.h                                |    2 
 include/linux/fortify-string.h                      |  302 ++++++
 include/linux/gfp.h                                 |    2 
 include/linux/init.h                                |    4 
 include/linux/kasan.h                               |   25 
 include/linux/kfence.h                              |  230 +++++
 include/linux/kgdb.h                                |    2 
 include/linux/khugepaged.h                          |    2 
 include/linux/ks0108.h                              |    2 
 include/linux/mdev.h                                |    2 
 include/linux/memory.h                              |    3 
 include/linux/memory_hotplug.h                      |   33 
 include/linux/memremap.h                            |    6 
 include/linux/mmzone.h                              |   49 -
 include/linux/page-flags.h                          |    4 
 include/linux/pagemap.h                             |   10 
 include/linux/pagevec.h                             |   10 
 include/linux/pgtable.h                             |    8 
 include/linux/ptrace.h                              |    2 
 include/linux/rmap.h                                |    3 
 include/linux/slab_def.h                            |    3 
 include/linux/slub_def.h                            |    3 
 include/linux/stackdepot.h                          |    9 
 include/linux/string.h                              |  282 ------
 include/linux/vmstat.h                              |    6 
 include/linux/zpool.h                               |    3 
 include/linux/zsmalloc.h                            |    2 
 include/trace/events/error_report.h                 |   74 +
 include/uapi/linux/firewire-cdev.h                  |    2 
 include/uapi/linux/input.h                          |    2 
 init/Kconfig                                        |    2 
 init/initramfs.c                                    |   19 
 init/main.c                                         |    6 
 init/version.c                                      |    8 
 kernel/debug/debug_core.c                           |   11 
 kernel/events/core.c                                |    8 
 kernel/events/uprobes.c                             |    2 
 kernel/groups.c                                     |    7 
 kernel/locking/rtmutex.c                            |    4 
 kernel/locking/rwsem.c                              |    2 
 kernel/locking/semaphore.c                          |    2 
 kernel/sched/fair.c                                 |    2 
 kernel/sched/membarrier.c                           |    2 
 kernel/sysctl.c                                     |    8 
 kernel/trace/Makefile                               |    1 
 kernel/trace/error_report-traces.c                  |   12 
 lib/Kconfig                                         |    9 
 lib/Kconfig.debug                                   |    1 
 lib/Kconfig.kfence                                  |   84 +
 lib/Kconfig.ubsan                                   |   17 
 lib/cmdline.c                                       |    7 
 lib/genalloc.c                                      |    3 
 lib/stackdepot.c                                    |   41 
 lib/test_kasan.c                                    |  111 ++
 lib/test_ubsan.c                                    |   49 -
 lib/ubsan.c                                         |   68 -
 mm/Makefile                                         |    1 
 mm/backing-dev.c                                    |    3 
 mm/cma.c                                            |   64 -
 mm/dmapool.c                                        |    3 
 mm/early_ioremap.c                                  |   12 
 mm/filemap.c                                        |  361 +++++---
 mm/huge_memory.c                                    |    6 
 mm/internal.h                                       |    6 
 mm/kasan/common.c                                   |  213 +++-
 mm/kasan/generic.c                                  |    3 
 mm/kasan/hw_tags.c                                  |    2 
 mm/kasan/kasan.h                                    |   97 +-
 mm/kasan/report.c                                   |    8 
 mm/kasan/shadow.c                                   |   78 +
 mm/kfence/Makefile                                  |    6 
 mm/kfence/core.c                                    |  875 +++++++++++++++++++-
 mm/kfence/kfence.h                                  |  126 ++
 mm/kfence/kfence_test.c                             |  860 +++++++++++++++++++
 mm/kfence/report.c                                  |  350 ++++++--
 mm/khugepaged.c                                     |   22 
 mm/memory-failure.c                                 |    6 
 mm/memory.c                                         |    4 
 mm/memory_hotplug.c                                 |  178 +++-
 mm/memremap.c                                       |   23 
 mm/mlock.c                                          |    2 
 mm/page_alloc.c                                     |    1 
 mm/rmap.c                                           |   24 
 mm/shmem.c                                          |  160 +--
 mm/slab.c                                           |   38 
 mm/slab_common.c                                    |   29 
 mm/slub.c                                           |   63 +
 mm/swap.c                                           |   54 -
 mm/swap_state.c                                     |    7 
 mm/truncate.c                                       |  141 ---
 mm/vmstat.c                                         |   35 
 mm/z3fold.c                                         |    1 
 mm/zbud.c                                           |    1 
 mm/zpool.c                                          |   13 
 mm/zsmalloc.c                                       |   22 
 mm/zswap.c                                          |   57 +
 samples/auxdisplay/cfag12864b-example.c             |    2 
 scripts/Makefile.ubsan                              |    2 
 scripts/checkpatch.pl                               |  152 ++-
 scripts/gdb/linux/lists.py                          |    5 
 145 files changed, 5046 insertions(+), 1682 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-02-25  9:12       ` incoming Andrey Ryabinin
@ 2021-02-25 11:07         ` Walter Wu
  0 siblings, 0 replies; 188+ messages in thread
From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw)
  To: Andrey Ryabinin
  Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov,
	Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
	mm-commits, Andrey Ryabinin, Alexander Potapenko

Hi Andrey,

On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote:
> On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > > <torvalds@linux-foundation.org> wrote:
> > > >
> > > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > > the KASAN patches. With this all applied, I get:
> > > >
> > > >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > and
> > > >
> > > >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > > larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > > cause issues.
> > >
> > > A quick bisect shoes that this was introduced by "[patch 101/173]
> > > kasan: remove redundant config option".
> > >
> > > I didn't check what part of that patch screws up, but it's definitely
> > > doing something bad.
> >
> > I'm not sure why that patch surfaced the bug, but it's worth pointing
> > out that the underlying problem is asan-stack in combination
> > with the structleak plugin. This will happen for every user of kunit.
> >
> 
> The patch didn't update KASAN_STACK dependency in kconfig:
>         config GCC_PLUGIN_STRUCTLEAK_BYREF
> ....
>                depends on !(KASAN && KASAN_STACK=1)
> 
> This 'depends on'  stopped working with the patch

Thanks for pointing out this problem. I will re-send that patch.


Walter

^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-02-25  8:53     ` incoming Arnd Bergmann
@ 2021-02-25  9:12       ` Andrey Ryabinin
  2021-02-25 11:07         ` incoming Walter Wu
  0 siblings, 1 reply; 188+ messages in thread
From: Andrey Ryabinin @ 2021-02-25  9:12 UTC (permalink / raw)
  To: Arnd Bergmann
  Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov,
	Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
	mm-commits, Andrey Ryabinin, Alexander Potapenko

On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
>
> On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > the KASAN patches. With this all applied, I get:
> > >
> > >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > and
> > >
> > >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > cause issues.
> >
> > A quick bisect shoes that this was introduced by "[patch 101/173]
> > kasan: remove redundant config option".
> >
> > I didn't check what part of that patch screws up, but it's definitely
> > doing something bad.
>
> I'm not sure why that patch surfaced the bug, but it's worth pointing
> out that the underlying problem is asan-stack in combination
> with the structleak plugin. This will happen for every user of kunit.
>

The patch didn't update KASAN_STACK dependency in kconfig:
        config GCC_PLUGIN_STRUCTLEAK_BYREF
....
               depends on !(KASAN && KASAN_STACK=1)

This 'depends on'  stopped working with the patch


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-02-24 21:37   ` incoming Linus Torvalds
@ 2021-02-25  8:53     ` Arnd Bergmann
  2021-02-25  9:12       ` incoming Andrey Ryabinin
  0 siblings, 1 reply; 188+ messages in thread
From: Arnd Bergmann @ 2021-02-25  8:53 UTC (permalink / raw)
  To: Linus Torvalds
  Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
	Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits,
	Andrey Ryabinin, Alexander Potapenko

On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I haven't bisected things yet, but I suspect it's something with
> > the KASAN patches. With this all applied, I get:
> >
> >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> >
> > and
> >
> >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > larger than 2048 bytes [-Wframe-larger-than=]
> >
> > which is obviously not really acceptable. A 11kB stack frame _will_
> > cause issues.
>
> A quick bisect shoes that this was introduced by "[patch 101/173]
> kasan: remove redundant config option".
>
> I didn't check what part of that patch screws up, but it's definitely
> doing something bad.

I'm not sure why that patch surfaced the bug, but it's worth pointing
out that the underlying problem is asan-stack in combination
with the structleak plugin. This will happen for every user of kunit.

I sent a series[1] out earlier this year to turn off the structleak
plugin as an alternative workaround, but need to follow up on
the remaining patches. Someone suggested adding a more
generic way to turn off the plugin for a file instead of open-coding
the CLFAGS_REMOVE_*.o Makefile bit, which would help.

I am also still hoping that someone can come up with a way
to make kunit work better with the structleak plugin, as there
shouldn't be a fundamental reason why it can't work, just that
it the code pattern triggers a particularly bad case in the compiler.

      Arnd

[1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-02-24 21:30 ` incoming Linus Torvalds
@ 2021-02-24 21:37   ` Linus Torvalds
  2021-02-25  8:53     ` incoming Arnd Bergmann
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw)
  To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
	Arnd Bergmann, Andrey Konovalov
  Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko

On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Hmm. I haven't bisected things yet, but I suspect it's something with
> the KASAN patches. With this all applied, I get:
>
>   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
>   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
>
> and
>
>   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
>   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> larger than 2048 bytes [-Wframe-larger-than=]
>
> which is obviously not really acceptable. A 11kB stack frame _will_
> cause issues.

A quick bisect shoes that this was introduced by "[patch 101/173]
kasan: remove redundant config option".

I didn't check what part of that patch screws up, but it's definitely
doing something bad.

I will drop that patch.

               Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-02-24 19:58 incoming Andrew Morton
@ 2021-02-24 21:30 ` Linus Torvalds
  2021-02-24 21:37   ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> A few small subsystems and some of MM.

Hmm. I haven't bisected things yet, but I suspect it's something with
the KASAN patches. With this all applied, I get:

  lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
  lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]

and

  lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
  lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
larger than 2048 bytes [-Wframe-larger-than=]

which is obviously not really acceptable. A 11kB stack frame _will_
cause issues.

              Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-02-24 19:58 Andrew Morton
  2021-02-24 21:30 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A few small subsystems and some of MM.


173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194.

Subsystems affected by this patch series:

  hexagon
  scripts
  ntfs
  ocfs2
  vfs
  mm/slab-generic
  mm/slab
  mm/slub
  mm/debug
  mm/pagecache
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/mremap
  mm/page-reporting
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/compaction
  mm/mempolicy
  mm/oom-kill
  mm/hugetlbfs
  mm/migration

Subsystem: hexagon

    Randy Dunlap <rdunlap@infradead.org>:
      hexagon: remove CONFIG_EXPERIMENTAL from defconfigs

Subsystem: scripts

    tangchunyou <tangchunyou@yulong.com>:
      scripts/spelling.txt: increase error-prone spell checking

    zuoqilin <zuoqilin@yulong.com>:
      scripts/spelling.txt: check for "exeeds"

    dingsenjie <dingsenjie@yulong.com>:
      scripts/spelling.txt: add "allocted" and "exeeds" typo

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Randy Dunlap <rdunlap@infradead.org>:
      ntfs: layout.h: delete duplicated words

    Rustam Kovhaev <rkovhaev@gmail.com>:
      ntfs: check for valid standard information attribute

Subsystem: ocfs2

    Yi Li <yili@winhong.com>:
      ocfs2: remove redundant conditional before iput

    guozh <guozh88@chinatelecom.cn>:
      ocfs2: clean up some definitions which are not used any more

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: fix a use after free on error

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      ocfs2: simplify the calculation of variables

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      fs: delete repeated words in comments

    Alexey Dobriyan <adobriyan@gmail.com>:
      ramfs: support O_TMPFILE

Subsystem: mm/slab-generic

    Jacob Wen <jian.w.wen@oracle.com>:
      mm, tracing: record slab name for kmem_cache_free()

    Nikolay Borisov <nborisov@suse.com>:
      mm/sl?b.c: remove ctor argument from kmem_cache_flags

Subsystem: mm/slab

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/slab: minor coding style tweaks

Subsystem: mm/slub

    Johannes Berg <johannes.berg@intel.com>:
      mm/slub: disable user tracing for kmemleak caches by default

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "mm, slab, slub: remove cpu and memory hotplug locks":
      mm, slub: stop freeing kmem_cache_node structures on node offline
      mm, slab, slub: stop taking memory hotplug lock
      mm, slab, slub: stop taking cpu hotplug lock
      mm, slub: splice cpu and page freelists in deactivate_slab()
      mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/slub: minor coding style tweaks

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug: improve memcg debugging

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/debug_vm_pgtable: Some minor updates", v3:
      mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect
      mm/debug_vm_pgtable/basic: iterate over entire protection_map[]

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_owner: use helper function zone_end_pfn() to get end_pfn

Subsystem: mm/pagecache

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/filemap: remove unused parameter and change to void type for replace_page_cache_page()

    Pavel Begunkov <asml.silence@gmail.com>:
      mm/filemap: don't revert iter on -EIOCBQUEUED

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Refactor generic_file_buffered_read", v5:
      mm/filemap: rename generic_file_buffered_read subfunctions
      mm/filemap: remove dynamically allocated array from filemap_read
      mm/filemap: convert filemap_get_pages to take a pagevec
      mm/filemap: use head pages in generic_file_buffered_read
      mm/filemap: pass a sleep state to put_and_wait_on_page_locked
      mm/filemap: support readpage splitting a page
      mm/filemap: inline __wait_on_page_locked_async into caller
      mm/filemap: don't call ->readpage if IOCB_WAITQ is set
      mm/filemap: change filemap_read_page calling conventions
      mm/filemap: change filemap_create_page calling conventions
      mm/filemap: convert filemap_update_page to return an errno
      mm/filemap: move the iocb checks into filemap_update_page
      mm/filemap: add filemap_range_uptodate
      mm/filemap: split filemap_readahead out of filemap_get_pages
      mm/filemap: restructure filemap_get_pages
      mm/filemap: don't relock the page after calling readpage

    Christoph Hellwig <hch@lst.de>:
      mm/filemap: rename generic_file_buffered_read to filemap_read
      mm/filemap: simplify generic_file_read_iter

    Yang Guo <guoyang2@huawei.com>:
      fs/buffer.c: add checking buffer head stat before clear

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: backing-dev: Remove duplicated macro definition

Subsystem: mm/swap

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      mm/swap_slots.c: remove redundant NULL check

    Stephen Zhang <stephenzhangzsd@gmail.com>:
      mm/swapfile.c: fix debugging information problem

    Georgi Djakov <georgi.djakov@linaro.org>:
      mm/page_io: use pr_alert_ratelimited for swap read/write errors

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      mm/swap_state: constify static struct attribute_group

    Yu Zhao <yuzhao@google.com>:
      mm/swap: don't SetPageWorkingset unconditionally during swapin

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: optimize per-lruvec stats counter memory usage
    Patch series "Convert all THP vmstat counters to pages", v6:
      mm: memcontrol: fix NR_ANON_THPS accounting in charge moving
      mm: memcontrol: convert NR_ANON_THPS account to pages
      mm: memcontrol: convert NR_FILE_THPS account to pages
      mm: memcontrol: convert NR_SHMEM_THPS account to pages
      mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages
      mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages
      mm: memcontrol: make the slab calculation consistent

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: revise the using condition of lock_page_lruvec function series
      mm/memcg: remove rcu locking for lock_page_lruvec function series

    Shakeel Butt <shakeelb@google.com>:
      mm: memcg: add swapcache stat for memcg v2

    Roman Gushchin <guro@fb.com>:
      mm: kmem: make __memcg_kmem_(un)charge static

    Feng Tang <feng.tang@intel.com>:
      mm: page_counter: re-layout structure to reduce false sharing

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      mm/memcontrol: remove redundant NULL check

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: replace the loop with a list_for_each_entry()

    Shakeel Butt <shakeelb@google.com>:
      mm/list_lru.c: remove kvfree_rcu_local()

    Johannes Weiner <hannes@cmpxchg.org>:
      fs: buffer: use raw page_memcg() on locked page

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix swap undercounting in cgroup2
      mm: memcontrol: fix get_active_memcg return value
      mm: memcontrol: fix slub memory accounting

Subsystem: mm/pagemap

    Adrian Huang <ahuang12@lenovo.com>:
      mm/mmap.c: remove unnecessary local variable

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory.c: fix potential pte_unmap_unlock pte error
      mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush()
      mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush()
      mm/memory.c: fix potential pte_unmap_unlock pte error

Subsystem: mm/mprotect

    Tianjia Zhang <tianjia.zhang@linux.alibaba.com>:
      mm/mprotect.c: optimize error detection in do_mprotect_pkey()

Subsystem: mm/mremap

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas()
      mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success

Subsystem: mm/page-reporting

    sh <sh_def@163.com>:
      mm/page_reporting: use list_entry_is_head() in page_reporting_cycle()

Subsystem: mm/vmalloc

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      vmalloc: remove redundant NULL check

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: HW_TAGS tests support and fixes", v4:
      kasan: prefix global functions with kasan_
      kasan: clarify HW_TAGS impact on TBI
      kasan: clean up comments in tests
      kasan: add macros to simplify checking test constraints
      kasan: add match-all tag tests
      kasan, arm64: allow using KUnit tests with HW_TAGS mode
      kasan: rename CONFIG_TEST_KASAN_MODULE
      kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL
      kasan: adapt kmalloc_uaf2 test to HW_TAGS mode
      kasan: fix memory corruption in kasan_bitops_tags test
      kasan: move _RET_IP_ to inline wrappers
      kasan: fix bug detection via ksize for HW_TAGS mode
      kasan: add proper page allocator tests
      kasan: add a test for kmem_cache_alloc/free_bulk
      kasan: don't run tests when KASAN is not enabled

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: mm/pagealloc

    Baoquan He <bhe@redhat.com>:
    Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5:
      mm: fix prototype warning from kernel test robot
      mm: rename memmap_init() and memmap_init_zone()
      mm: simplify parater of function memmap_init_zone()
      mm: simplify parameter of setup_usemap()
      mm: remove unneeded local variable in free_area_init_core

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: simplify free_highmem_page() and free_reserved_page()":
      video: fbdev: acornfb: remove free_unused_pages()
      mm: simplify free_highmem_page() and free_reserved_page()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/gfp: add kernel-doc for gfp_t

Subsystem: mm/memory-failure

    Aili Yao <yaoaili@kingsoft.com>:
      mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events

Subsystem: mm/hugetlb

    Bibo Mao <maobibo@loongson.cn>:
      mm/huge_memory.c: update tlb entry if pmd is changed
      MIPS: do not call flush_tlb_all when setting pmd entry

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix potential double free in hugetlb_register_node() error path

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb.c: fix unnecessary address expansion of pmd sharing

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call
      mm/hugetlb: use helper huge_page_order and pages_per_huge_page
      mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled

    Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>:
      mm/hugetlb: simplify the calculation of variables

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2:
      mm/hugetlb: grab head page refcount once for group of subpages
      mm/hugetlb: refactor subpage recording

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix some comment typos

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/hugetlb: remove redundant check in preparing and destroying gigantic page

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/hugetlb.c: fix typos in comments

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/huge_memory.c: remove unused return value of set_huge_zero_page()

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup
      mm/hugetlb: use helper function range_in_vma() in page_table_shareable()
      mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage()
      mm/hugetlb: use helper huge_page_size() to get hugepage size

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: fix update_and_free_page contig page struct assumption
      hugetlb: fix copy_huge_page_from_user contig page struct assumption

    Chen Wandun <chenwandun@huawei.com>:
      mm/hugetlb: suppress wrong warning info when alloc gigantic page

Subsystem: mm/vmscan

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmscan: __isolate_lru_page_prepare() cleanup

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes()

    Yu Zhao <yuzhao@google.com>:
    Patch series "mm: lru related cleanups", v2:
      mm/vmscan.c: use add_page_to_lru_list()
      include/linux/mm_inline.h: shuffle lru list addition and deletion functions
      mm: don't pass "enum lru_list" to lru list addition functions
      mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion()
      mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list()
      mm: add __clear_page_lru_flags() to replace page_off_lru()
      mm: VM_BUG_ON lru page flags
      include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller
      include/linux/mm_inline.h: fold __update_lru_size() into its sole caller
      mm/vmscan.c: make lruvec_lru_size() static

    Oscar Salvador <osalvador@suse.de>:
      mm: workingset: clarify eviction order and distance calculation

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "create hugetlb flags to consolidate state", v3:
      hugetlb: use page.private for hugetlb specific page flags
      hugetlb: convert page_huge_active() HPageMigratable flag
      hugetlb: convert PageHugeTemporary() to HPageTemporary flag
      hugetlb: convert PageHugeFreed to HPageFreed flag
      include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags
      hugetlb: fix uninitialized subpool pointer

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: restore zone_reclaim_mode ABI

Subsystem: mm/z3fold

    Miaohe Lin <linmiaohe@huawei.com>:
      z3fold: remove unused attribute for release_z3fold_page
      z3fold: simplify the zhdr initialization code in init_z3fold_page()

Subsystem: mm/compaction

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/compaction: remove rcu_read_lock during page compaction

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked

    Charan Teja Reddy <charante@codeaurora.org>:
      mm/compaction: correct deferral logic for proactive compaction

    Wonhyuk Yang <vvghjk1234@gmail.com>:
      mm/compaction: fix misbehaviors of fast_find_migrateblock()

    Vlastimil Babka <vbabka@suse.cz>:
      mm, compaction: make fast_isolate_freepages() stay within zone

Subsystem: mm/mempolicy

    Huang Ying <ying.huang@intel.com>:
      numa balancing: migrate on fault among multiple bound nodes

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk()

Subsystem: mm/oom-kill

    Tang Yizhou <tangyizhou@huawei.com>:
      mm, oom: fix a comment in dump_task()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: change hugetlb_reserve_pages() to type bool
      hugetlbfs: remove special hugetlbfs_set_page_dirty()

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr()
      hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs
      hugetlbfs: correct obsolete function name in hugetlbfs_read_iter()
      hugetlbfs: remove meaningless variable avoid_reserve
      hugetlbfs: make hugepage size conversion more readable
      hugetlbfs: correct some obsolete comments about inode i_mutex
      hugetlbfs: fix some comment typos
      hugetlbfs: remove unneeded return value of hugetlb_vmtruncate()

Subsystem: mm/migration

    Chengyang Fan <cy.fan@huawei.com>:
      mm/migrate: remove unneeded semicolons

 Documentation/admin-guide/cgroup-v2.rst         |    4 
 Documentation/admin-guide/kernel-parameters.txt |    8 
 Documentation/admin-guide/sysctl/vm.rst         |   10 
 Documentation/core-api/mm-api.rst               |    7 
 Documentation/dev-tools/kasan.rst               |   24 
 Documentation/vm/arch_pgtable_helpers.rst       |    8 
 arch/arm64/include/asm/memory.h                 |    1 
 arch/arm64/include/asm/mte-kasan.h              |   12 
 arch/arm64/kernel/mte.c                         |   12 
 arch/arm64/kernel/sleep.S                       |    2 
 arch/arm64/mm/fault.c                           |   20 
 arch/hexagon/configs/comet_defconfig            |    1 
 arch/ia64/include/asm/pgtable.h                 |    6 
 arch/ia64/mm/init.c                             |   18 
 arch/mips/mm/pgtable-32.c                       |    1 
 arch/mips/mm/pgtable-64.c                       |    1 
 arch/x86/kernel/acpi/wakeup_64.S                |    2 
 drivers/base/node.c                             |   33 
 drivers/video/fbdev/acornfb.c                   |   34 
 fs/block_dev.c                                  |    2 
 fs/btrfs/file.c                                 |    2 
 fs/buffer.c                                     |    7 
 fs/dcache.c                                     |    4 
 fs/direct-io.c                                  |    4 
 fs/exec.c                                       |    4 
 fs/fhandle.c                                    |    2 
 fs/fuse/dev.c                                   |    6 
 fs/hugetlbfs/inode.c                            |   72 --
 fs/ntfs/inode.c                                 |    6 
 fs/ntfs/layout.h                                |    4 
 fs/ocfs2/cluster/heartbeat.c                    |    8 
 fs/ocfs2/dlm/dlmast.c                           |   10 
 fs/ocfs2/dlm/dlmcommon.h                        |    4 
 fs/ocfs2/refcounttree.c                         |    2 
 fs/ocfs2/super.c                                |    2 
 fs/pipe.c                                       |    2 
 fs/proc/meminfo.c                               |   10 
 fs/proc/vmcore.c                                |    7 
 fs/ramfs/inode.c                                |   13 
 include/linux/fs.h                              |    4 
 include/linux/gfp.h                             |   14 
 include/linux/highmem-internal.h                |    5 
 include/linux/huge_mm.h                         |   15 
 include/linux/hugetlb.h                         |   98 ++
 include/linux/kasan-checks.h                    |    6 
 include/linux/kasan.h                           |   39 -
 include/linux/memcontrol.h                      |   43 -
 include/linux/migrate.h                         |    2 
 include/linux/mm.h                              |   28 
 include/linux/mm_inline.h                       |  123 +--
 include/linux/mmzone.h                          |   30 
 include/linux/page-flags.h                      |    6 
 include/linux/page_counter.h                    |    9 
 include/linux/pagemap.h                         |    5 
 include/linux/swap.h                            |    8 
 include/trace/events/kmem.h                     |   24 
 include/trace/events/pagemap.h                  |   11 
 include/uapi/linux/mempolicy.h                  |    4 
 init/Kconfig                                    |   14 
 lib/Kconfig.kasan                               |   14 
 lib/Makefile                                    |    2 
 lib/test_kasan.c                                |  446 ++++++++----
 lib/test_kasan_module.c                         |    5 
 mm/backing-dev.c                                |    6 
 mm/compaction.c                                 |   73 +-
 mm/debug.c                                      |   10 
 mm/debug_vm_pgtable.c                           |   86 ++
 mm/filemap.c                                    |  859 +++++++++++-------------
 mm/gup.c                                        |    5 
 mm/huge_memory.c                                |   28 
 mm/hugetlb.c                                    |  376 ++++------
 mm/hugetlb_cgroup.c                             |    6 
 mm/kasan/common.c                               |   60 -
 mm/kasan/generic.c                              |   40 -
 mm/kasan/hw_tags.c                              |   16 
 mm/kasan/kasan.h                                |   87 +-
 mm/kasan/quarantine.c                           |   22 
 mm/kasan/report.c                               |   15 
 mm/kasan/report_generic.c                       |   10 
 mm/kasan/report_hw_tags.c                       |    8 
 mm/kasan/report_sw_tags.c                       |    8 
 mm/kasan/shadow.c                               |   27 
 mm/kasan/sw_tags.c                              |   22 
 mm/khugepaged.c                                 |    6 
 mm/list_lru.c                                   |   12 
 mm/memcontrol.c                                 |  309 ++++----
 mm/memory-failure.c                             |   34 
 mm/memory.c                                     |   24 
 mm/memory_hotplug.c                             |   11 
 mm/mempolicy.c                                  |   18 
 mm/mempool.c                                    |    2 
 mm/migrate.c                                    |   10 
 mm/mlock.c                                      |    3 
 mm/mmap.c                                       |    4 
 mm/mprotect.c                                   |    7 
 mm/mremap.c                                     |    8 
 mm/oom_kill.c                                   |    5 
 mm/page_alloc.c                                 |   70 -
 mm/page_io.c                                    |   12 
 mm/page_owner.c                                 |    4 
 mm/page_reporting.c                             |    2 
 mm/pgtable-generic.c                            |    9 
 mm/rmap.c                                       |   35 
 mm/shmem.c                                      |    2 
 mm/slab.c                                       |   21 
 mm/slab.h                                       |   20 
 mm/slab_common.c                                |   40 -
 mm/slob.c                                       |    2 
 mm/slub.c                                       |  169 ++--
 mm/swap.c                                       |   54 -
 mm/swap_slots.c                                 |    3 
 mm/swap_state.c                                 |   31 
 mm/swapfile.c                                   |    8 
 mm/vmscan.c                                     |  100 +-
 mm/vmstat.c                                     |   14 
 mm/workingset.c                                 |    7 
 mm/z3fold.c                                     |   11 
 scripts/Makefile.kasan                          |   10 
 scripts/spelling.txt                            |   30 
 tools/objtool/check.c                           |    2 
 120 files changed, 2249 insertions(+), 1954 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-02-13  4:52 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-02-13  4:52 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749.

Subsystems affected by this patch series:

  mm/pagemap
  scripts
  MAINTAINERS
  h8300

Subsystem: mm/pagemap

    Mike Rapoport <rppt@linux.ibm.com>:
      m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU

Subsystem: scripts

    Rong Chen <rong.a.chen@intel.com>:
      scripts/recordmcount.pl: support big endian for ARCH sh

Subsystem: MAINTAINERS

    Andrey Konovalov <andreyknvl@google.com>:
      MAINTAINERS: update KASAN file list
      MAINTAINERS: update Andrey Konovalov's email address
      MAINTAINERS: add Andrey Konovalov to KASAN reviewers

Subsystem: h8300

    Randy Dunlap <rdunlap@infradead.org>:
      h8300: fix PREEMPTION build, TI_PRE_COUNT undefined

 MAINTAINERS                     |    8 +++++---
 arch/h8300/kernel/asm-offsets.c |    3 +++
 arch/m68k/include/asm/page.h    |    2 +-
 scripts/recordmcount.pl         |    6 +++++-
 4 files changed, 14 insertions(+), 5 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-02-09 21:41 incoming Andrew Morton
@ 2021-02-10 19:30 ` Linus Torvalds
  0 siblings, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

Hah. This series shows a small deficiency in your scripting wrt the diffstat:

On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
>  .mailmap                          |    1
...
>  mm/slub.c                         |   18 +++++++++-
>  17 files changed, 172 insertions(+), 49 deletions(-)

It actually has 18 files changed, but one of them is a pure rename (no
change to the content), and apparently your diffstat tool can't handle
that case.

It *should* have ended with

 ...
 mm/slub.c                                          | 18 +++++-
 .../selftests/vm/{run_vmtests => run_vmtests.sh}   |  0
 18 files changed, 172 insertions(+), 49 deletions(-)
 rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%)

if you'd done a proper "git diff -M --stat --summary" of the series.

[ Ok, by default git would actually have said

    18 files changed, 171 insertions(+), 48 deletions(-)

  but it looks like you use the patience diff option, which gives that
extra insertion/deletion line because it generates the diff a bit
differently ]

Not a big deal,, but it made me briefly wonder "why doesn't my
diffstat match yours".

           Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-02-09 21:41 Andrew Morton
  2021-02-10 19:30 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6.

Subsystems affected by this patch series:

  squashfs
  mm/kasan
  firmware
  mm/mremap
  mm/tmpfs
  mm/selftests
  MAINTAINERS
  mm/memcg
  mm/slub
  nilfs2

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
    Patch series "Squashfs: fix BIO migration regression and add sanity checks":
      squashfs: avoid out of bounds writes in decompressors
      squashfs: add more sanity checks in id lookup
      squashfs: add more sanity checks in inode lookup
      squashfs: add more sanity checks in xattr id lookup

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix stack traces dependency for HW_TAGS

Subsystem: firmware

    Fangrui Song <maskray@google.com>:
      firmware_loader: align .builtin_fw to 8

Subsystem: mm/mremap

    Arnd Bergmann <arnd@arndb.de>:
      mm/mremap: fix BUILD_BUG_ON() error in get_extent

Subsystem: mm/tmpfs

    Seth Forshee <seth.forshee@canonical.com>:
      tmpfs: disallow CONFIG_TMPFS_INODE64 on s390
      tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha

Subsystem: mm/selftests

    Rong Chen <rong.a.chen@intel.com>:
      selftests/vm: rename file run_vmtests to run_vmtests.sh

Subsystem: MAINTAINERS

    Andrey Ryabinin <ryabinin.a.a@gmail.com>:
      MAINTAINERS: update Andrey Ryabinin's email address

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      Revert "mm: memcontrol: avoid workload stalls when lowering memory.high"

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: better heuristic for number of cpus when calculating slab order

Subsystem: nilfs2

    Joachim Henke <joachim.henke@t-systems.com>:
      nilfs2: make splice write available again

 .mailmap                          |    1 
 Documentation/dev-tools/kasan.rst |    3 -
 MAINTAINERS                       |    2 -
 fs/Kconfig                        |    4 +-
 fs/nilfs2/file.c                  |    1 
 fs/squashfs/block.c               |    8 ++++
 fs/squashfs/export.c              |   41 +++++++++++++++++++----
 fs/squashfs/id.c                  |   40 ++++++++++++++++++-----
 fs/squashfs/squashfs_fs_sb.h      |    1 
 fs/squashfs/super.c               |    6 +--
 fs/squashfs/xattr.h               |   10 +++++
 fs/squashfs/xattr_id.c            |   66 ++++++++++++++++++++++++++++++++------
 include/asm-generic/vmlinux.lds.h |    2 -
 mm/kasan/hw_tags.c                |    8 +---
 mm/memcontrol.c                   |    5 +-
 mm/mremap.c                       |    5 +-
 mm/slub.c                         |   18 +++++++++-
 17 files changed, 172 insertions(+), 49 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-02-05  2:31 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-02-05  2:31 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/compaction
  mm/vmalloc
  gcov
  mm/shmem
  mm/memblock
  mailmap
  mm/pagecache
  mm/kasan
  ubsan
  mm/hugetlb
  MAINTAINERS

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page
      mm: hugetlb: fix a race between freeing and dissolving the page
      mm: hugetlb: fix a race between isolating and freeing page
      mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active
      mm: migrate: do not migrate HugeTLB page whose refcount is one

Subsystem: mm/compaction

    Rokudo Yan <wu-yan@tcl.com>:
      mm, compaction: move high_pfn to the for loop scope

Subsystem: mm/vmalloc

    Rick Edgecombe <rick.p.edgecombe@intel.com>:
      mm/vmalloc: separate put pages and flush VM flags

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov

Subsystem: mm/shmem

    Hugh Dickins <hughd@google.com>:
      mm: thp: fix MADV_REMOVE deadlock on shmem THP

Subsystem: mm/memblock

    Roman Gushchin <guro@fb.com>:
      memblock: do not start bottom-up allocations with kernel_end

Subsystem: mailmap

    Viresh Kumar <viresh.kumar@linaro.org>:
      mailmap: fix name/email for Viresh Kumar

    Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>:
      mailmap: add entries for Manivannan Sadhasivam

Subsystem: mm/pagecache

    Waiman Long <longman@redhat.com>:
      mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked()

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
    Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5:
      kasan: add explicit preconditions to kasan_report()
      kasan: make addr_has_metadata() return true for valid addresses

Subsystem: ubsan

    Nathan Chancellor <nathan@kernel.org>:
      ubsan: implement __ubsan_handle_alignment_assumption

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm: hugetlb: fix missing put_page in gather_surplus_pages()

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS/.mailmap: use my @kernel.org address

 .mailmap                |    5 ++++
 MAINTAINERS             |    2 -
 fs/hugetlbfs/inode.c    |    3 +-
 include/linux/hugetlb.h |    2 +
 include/linux/kasan.h   |    7 ++++++
 include/linux/vmalloc.h |    9 +-------
 init/Kconfig            |    1 
 init/main.c             |    8 ++++++-
 kernel/gcov/Kconfig     |    2 -
 lib/ubsan.c             |   31 ++++++++++++++++++++++++++++
 lib/ubsan.h             |    6 +++++
 mm/compaction.c         |    3 +-
 mm/filemap.c            |    4 +++
 mm/huge_memory.c        |   37 ++++++++++++++++++++-------------
 mm/hugetlb.c            |   53 ++++++++++++++++++++++++++++++++++++++++++------
 mm/kasan/kasan.h        |    2 -
 mm/memblock.c           |   49 +++++---------------------------------------
 mm/migrate.c            |    6 +++++
 18 files changed, 153 insertions(+), 77 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-01-24  5:00 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2021-01-24  5:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1.

Subsystems affected by this patch series:

  mm/pagealloc
  mm/memcg
  mm/kasan
  ubsan
  mm/memory-failure
  mm/highmem
  proc
  MAINTAINERS

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: fix initialization of struct page for holes in memory layout", v3:
      x86/setup: don't remove E820_TYPE_RAM for pfn 0
      mm: fix initialization of struct page for holes in memory layout

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: optimize objcg stock draining

    Shakeel Butt <shakeelb@google.com>:
      mm: memcg: fix memcg file_dirty numa stat
      mm: fix numa stats for thp migration

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: prevent starvation when writing memory.high

Subsystem: mm/kasan

    Lecopzer Chen <lecopzer@gmail.com>:
      kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow
      kasan: fix incorrect arguments passing in kasan_add_zero_shadow

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix HW_TAGS boot parameters
      kasan, mm: fix conflicts with init_on_alloc/free
      kasan, mm: fix resetting page_alloc tags for HW_TAGS

Subsystem: ubsan

    Arnd Bergmann <arnd@arndb.de>:
      ubsan: disable unsigned-overflow check for i386

Subsystem: mm/memory-failure

    Dan Williams <dan.j.williams@intel.com>:
      mm: fix page reference leak in soft_offline_page()

Subsystem: mm/highmem

    Thomas Gleixner <tglx@linutronix.de>:
    Patch series "mm/highmem: Fix fallout from generic kmap_local conversions":
      sparc/mm/highmem: flush cache and TLB
      mm/highmem: prepare for overriding set_pte_at()
      mips/mm/highmem: use set_pte() for kmap_local()
      powerpc/mm/highmem: use __set_pte_at() for kmap_local()

Subsystem: proc

    Xiaoming Ni <nixiaoming@huawei.com>:
      proc_sysctl: fix oops caused by incorrect command parameters

Subsystem: MAINTAINERS

    Nathan Chancellor <natechancellor@gmail.com>:
      MAINTAINERS: add a couple more files to the Clang/LLVM section

 Documentation/dev-tools/kasan.rst  |   27 ++---------
 MAINTAINERS                        |    2 
 arch/mips/include/asm/highmem.h    |    1 
 arch/powerpc/include/asm/highmem.h |    2 
 arch/sparc/include/asm/highmem.h   |    9 ++-
 arch/x86/kernel/setup.c            |   20 +++-----
 fs/proc/proc_sysctl.c              |    7 ++-
 lib/Kconfig.ubsan                  |    1 
 mm/highmem.c                       |    7 ++-
 mm/kasan/hw_tags.c                 |   77 +++++++++++++--------------------
 mm/kasan/init.c                    |   23 +++++----
 mm/memcontrol.c                    |   11 +---
 mm/memory-failure.c                |   20 ++++++--
 mm/migrate.c                       |   27 ++++++-----
 mm/page_alloc.c                    |   86 ++++++++++++++++++++++---------------
 mm/slub.c                          |    7 +--
 16 files changed, 173 insertions(+), 154 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2021-01-12 23:48 incoming Andrew Morton
@ 2021-01-15 23:32 ` Linus Torvalds
  0 siblings, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.

Whee. I had completely dropped the ball on this - I had built my usual
"akpm" branch with the patches, but then had completely forgotten
about it after doing my basic build tests.

I tend to leave it for a while to see if people send belated ACK/NAK's
for the patches, but that "for a while" is typically "overnight", not
several days.

So if you ever notice that I haven't merged your patch submission, and
you haven't seen me comment on them, feel free to ping me to remind
me.

Because it might just have gotten lost in the shuffle for some random
reason. Admittedly it's rare - I think this is the first time I just
randomly noticed three days later that I'd never done the actual merge
of the patch-series).

               Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2021-01-12 23:48 Andrew Morton
  2021-01-15 23:32 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.

Subsystems affected by this patch series:

  mm/slub
  mm/pagealloc
  mm/memcg
  mm/kasan
  mm/vmalloc
  mm/migration
  mm/hugetlb
  MAINTAINERS
  mm/memory-failure
  mm/process_vm_access

Subsystem: mm/slub

    Jann Horn <jannh@google.com>:
      mm, slub: consider rest of partial list if acquire_slab() fails

Subsystem: mm/pagealloc

    Hailong liu <liu.hailong6@zte.com.cn>:
      mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint

Subsystem: mm/memcg

    Hugh Dickins <hughd@google.com>:
      mm/memcontrol: fix warning in mem_cgroup_page_lruvec()

Subsystem: mm/kasan

    Hailong Liu <liu.hailong6@zte.com.cn>:
      arm/kasan: fix the array size of kasan_early_shadow_pte[]

Subsystem: mm/vmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmalloc.c: fix potential memory leak

Subsystem: mm/migration

    Jan Stancek <jstancek@redhat.com>:
      mm: migrate: initialize err in do_migrate_pages

Subsystem: mm/hugetlb

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix potential missing huge page size info

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: add Vlastimil as slab allocators maintainer

Subsystem: mm/memory-failure

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: fix printing of page flags

Subsystem: mm/process_vm_access

    Andrew Morton <akpm@linux-foundation.org>:
      mm/process_vm_access.c: include compat.h

 MAINTAINERS                |    1 +
 include/linux/kasan.h      |    6 +++++-
 include/linux/memcontrol.h |    2 +-
 mm/hugetlb.c               |    2 +-
 mm/kasan/init.c            |    3 ++-
 mm/memory-failure.c        |    2 +-
 mm/mempolicy.c             |    2 +-
 mm/page_alloc.c            |   31 ++++++++++++++++---------------
 mm/process_vm_access.c     |    1 +
 mm/slub.c                  |    2 +-
 mm/vmalloc.c               |    4 +++-
 11 files changed, 33 insertions(+), 23 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-12-29 23:13 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3.

Subsystems affected by this patch series:

  mm/selftests
  mm/hugetlb
  kbuild
  checkpatch
  mm/pagecache
  mm/mremap
  mm/kasan
  misc
  lib
  mm/slub

Subsystem: mm/selftests

    Harish <harish@linux.ibm.com>:
      selftests/vm: fix building protection keys test

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: fix deadlock in hugetlb_cow error path

Subsystem: kbuild

    Masahiro Yamada <masahiroy@kernel.org>:
      Revert "kbuild: avoid static_assert for genksyms"

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: prefer strscpy to strlcpy

Subsystem: mm/pagecache

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm: add prototype for __add_to_page_cache_locked()

    Baoquan He <bhe@redhat.com>:
      mm: memmap defer init doesn't work as expected

Subsystem: mm/mremap

    Kalesh Singh <kaleshsingh@google.com>:
      mm/mremap.c: fix extent calculation

    Nicholas Piggin <npiggin@gmail.com>:
      mm: generalise COW SMC TLB flushing race comment

Subsystem: mm/kasan

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: fix null pointer dereference in kasan_record_aux_stack

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      local64.h: make <asm/local64.h> mandatory

    Huang Shijie <sjhuang@iluvatar.ai>:
      sizes.h: add SZ_8G/SZ_16G/SZ_32G macros

    Josh Poimboeuf <jpoimboe@redhat.com>:
      kdev_t: always inline major/minor helper functions

Subsystem: lib

    Huang Shijie <sjhuang@iluvatar.ai>:
      lib/genalloc: fix the overflow when size is too big

    Ilya Leoshkevich <iii@linux.ibm.com>:
      lib/zlib: fix inflating zlib streams on s390

    Randy Dunlap <rdunlap@infradead.org>:
      zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c

Subsystem: mm/slub

    Roman Gushchin <guro@fb.com>:
      mm: slub: call account_slab_page() after slab page initialization

 arch/alpha/include/asm/local64.h    |    1 -
 arch/arc/include/asm/Kbuild         |    1 -
 arch/arm/include/asm/Kbuild         |    1 -
 arch/arm64/include/asm/Kbuild       |    1 -
 arch/csky/include/asm/Kbuild        |    1 -
 arch/h8300/include/asm/Kbuild       |    1 -
 arch/hexagon/include/asm/Kbuild     |    1 -
 arch/ia64/include/asm/local64.h     |    1 -
 arch/ia64/mm/init.c                 |    4 ++--
 arch/m68k/include/asm/Kbuild        |    1 -
 arch/microblaze/include/asm/Kbuild  |    1 -
 arch/mips/include/asm/Kbuild        |    1 -
 arch/nds32/include/asm/Kbuild       |    1 -
 arch/openrisc/include/asm/Kbuild    |    1 -
 arch/parisc/include/asm/Kbuild      |    1 -
 arch/powerpc/include/asm/Kbuild     |    1 -
 arch/riscv/include/asm/Kbuild       |    1 -
 arch/s390/include/asm/Kbuild        |    1 -
 arch/sh/include/asm/Kbuild          |    1 -
 arch/sparc/include/asm/Kbuild       |    1 -
 arch/x86/include/asm/local64.h      |    1 -
 arch/xtensa/include/asm/Kbuild      |    1 -
 include/asm-generic/Kbuild          |    1 +
 include/linux/build_bug.h           |    5 -----
 include/linux/kdev_t.h              |   22 +++++++++++-----------
 include/linux/mm.h                  |   12 ++++++++++--
 include/linux/sizes.h               |    3 +++
 lib/genalloc.c                      |   25 +++++++++++++------------
 lib/zlib_dfltcc/Makefile            |    2 +-
 lib/zlib_dfltcc/dfltcc.c            |    6 +++++-
 lib/zlib_dfltcc/dfltcc_deflate.c    |    3 +++
 lib/zlib_dfltcc/dfltcc_inflate.c    |    4 ++--
 lib/zlib_dfltcc/dfltcc_syms.c       |   17 -----------------
 mm/hugetlb.c                        |   22 +++++++++++++++++++++-
 mm/kasan/generic.c                  |    2 ++
 mm/memory.c                         |    8 +++++---
 mm/memory_hotplug.c                 |    2 +-
 mm/mremap.c                         |    4 +++-
 mm/page_alloc.c                     |    8 +++++---
 mm/slub.c                           |    5 ++---
 scripts/checkpatch.pl               |    6 ++++++
 tools/testing/selftests/vm/Makefile |   10 +++++-----
 42 files changed, 101 insertions(+), 91 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-12-22 19:58 incoming Andrew Morton
@ 2020-12-22 21:43 ` Linus Torvalds
  0 siblings, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.

I see that you enabled renaming in the patches. Lovely.

Can you also enable it in the diffstat?

>  74 files changed, 2869 insertions(+), 1553 deletions(-)

With -M in the diffstat, you should have seen

 72 files changed, 2775 insertions(+), 1460 deletions(-)

and if you add "--summary", you'll also see the rename part ofthe file
create/delete summary:

 rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%)

which is often nice to see in addition to the line stats..

           Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-12-22 19:58 Andrew Morton
  2020-12-22 21:43 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.

Subsystems affected by this patch series:

  mm/kasan

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: add hardware tag-based mode for arm64", v11:
      kasan: drop unnecessary GPL text from comment headers
      kasan: KASAN_VMALLOC depends on KASAN_GENERIC
      kasan: group vmalloc code
      kasan: shadow declarations only for software modes
      kasan: rename (un)poison_shadow to (un)poison_range
      kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
      kasan: only build init.c for software modes
      kasan: split out shadow.c from common.c
      kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
      kasan: rename report and tags files
      kasan: don't duplicate config dependencies
      kasan: hide invalid free check implementation
      kasan: decode stack frame only with KASAN_STACK_ENABLE
      kasan, arm64: only init shadow for software modes
      kasan, arm64: only use kasan_depth for software modes
      kasan, arm64: move initialization message
      kasan, arm64: rename kasan_init_tags and mark as __init
      kasan: rename addr_has_shadow to addr_has_metadata
      kasan: rename print_shadow_for_address to print_memory_metadata
      kasan: rename SHADOW layout macros to META
      kasan: separate metadata_fetch_row for each mode
      kasan: introduce CONFIG_KASAN_HW_TAGS

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      arm64: enable armv8.5-a asm-arch option
      arm64: mte: add in-kernel MTE helpers
      arm64: mte: reset the page tag in page->flags
      arm64: mte: add in-kernel tag fault handler
      arm64: kasan: allow enabling in-kernel MTE
      arm64: mte: convert gcr_user into an exclude mask
      arm64: mte: switch GCR_EL1 in kernel entry and exit
      kasan, mm: untag page address in free_reserved_area

    Andrey Konovalov <andreyknvl@google.com>:
      arm64: kasan: align allocations for HW_TAGS
      arm64: kasan: add arch layer for memory tagging helpers
      kasan: define KASAN_GRANULE_SIZE for HW_TAGS
      kasan, x86, s390: update undef CONFIG_KASAN
      kasan, arm64: expand CONFIG_KASAN checks
      kasan, arm64: implement HW_TAGS runtime
      kasan, arm64: print report from tag fault handler
      kasan, mm: reset tags when accessing metadata
      kasan, arm64: enable CONFIG_KASAN_HW_TAGS
      kasan: add documentation for hardware tag-based mode

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kselftest/arm64: check GCR_EL1 after context switch

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: boot parameters for hardware tag-based mode", v4:
      kasan: simplify quarantine_put call site
      kasan: rename get_alloc/free_info
      kasan: introduce set_alloc_info
      kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
      kasan: allow VMAP_STACK for HW_TAGS mode
      kasan: remove __kasan_unpoison_stack
      kasan: inline kasan_reset_tag for tag-based modes
      kasan: inline random_tag for HW_TAGS
      kasan: open-code kasan_unpoison_slab
      kasan: inline (un)poison_range and check_invalid_free
      kasan: add and integrate kasan boot parameters
      kasan, mm: check kasan_enabled in annotations
      kasan, mm: rename kasan_poison_kfree
      kasan: don't round_up too much
      kasan: simplify assign_tag and set_tag calls
      kasan: clarify comment in __kasan_kfree_large
      kasan: sanitize objects when metadata doesn't fit
      kasan, mm: allow cache merging with no metadata
      kasan: update documentation

 Documentation/dev-tools/kasan.rst                         |  274 ++-
 arch/Kconfig                                              |    8 
 arch/arm64/Kconfig                                        |    9 
 arch/arm64/Makefile                                       |    7 
 arch/arm64/include/asm/assembler.h                        |    2 
 arch/arm64/include/asm/cache.h                            |    3 
 arch/arm64/include/asm/esr.h                              |    1 
 arch/arm64/include/asm/kasan.h                            |   17 
 arch/arm64/include/asm/memory.h                           |   15 
 arch/arm64/include/asm/mte-def.h                          |   16 
 arch/arm64/include/asm/mte-kasan.h                        |   67 
 arch/arm64/include/asm/mte.h                              |   22 
 arch/arm64/include/asm/processor.h                        |    2 
 arch/arm64/include/asm/string.h                           |    5 
 arch/arm64/include/asm/uaccess.h                          |   23 
 arch/arm64/kernel/asm-offsets.c                           |    3 
 arch/arm64/kernel/cpufeature.c                            |    3 
 arch/arm64/kernel/entry.S                                 |   41 
 arch/arm64/kernel/head.S                                  |    2 
 arch/arm64/kernel/hibernate.c                             |    5 
 arch/arm64/kernel/image-vars.h                            |    2 
 arch/arm64/kernel/kaslr.c                                 |    3 
 arch/arm64/kernel/module.c                                |    6 
 arch/arm64/kernel/mte.c                                   |  124 +
 arch/arm64/kernel/setup.c                                 |    2 
 arch/arm64/kernel/sleep.S                                 |    2 
 arch/arm64/kernel/smp.c                                   |    2 
 arch/arm64/lib/mte.S                                      |   16 
 arch/arm64/mm/copypage.c                                  |    9 
 arch/arm64/mm/fault.c                                     |   59 
 arch/arm64/mm/kasan_init.c                                |   41 
 arch/arm64/mm/mteswap.c                                   |    9 
 arch/arm64/mm/proc.S                                      |   23 
 arch/arm64/mm/ptdump.c                                    |    6 
 arch/s390/boot/string.c                                   |    1 
 arch/x86/boot/compressed/misc.h                           |    1 
 arch/x86/kernel/acpi/wakeup_64.S                          |    2 
 include/linux/kasan-checks.h                              |    2 
 include/linux/kasan.h                                     |  423 ++++-
 include/linux/mm.h                                        |   24 
 include/linux/moduleloader.h                              |    3 
 include/linux/page-flags-layout.h                         |    2 
 include/linux/sched.h                                     |    2 
 include/linux/string.h                                    |    2 
 init/init_task.c                                          |    2 
 kernel/fork.c                                             |    4 
 lib/Kconfig.kasan                                         |   71 
 lib/test_kasan.c                                          |    2 
 lib/test_kasan_module.c                                   |    2 
 mm/kasan/Makefile                                         |   33 
 mm/kasan/common.c                                         | 1006 +++-----------
 mm/kasan/generic.c                                        |   72 -
 mm/kasan/generic_report.c                                 |   13 
 mm/kasan/hw_tags.c                                        |  276 +++
 mm/kasan/init.c                                           |   25 
 mm/kasan/kasan.h                                          |  195 ++
 mm/kasan/quarantine.c                                     |   35 
 mm/kasan/report.c                                         |  363 +----
 mm/kasan/report_generic.c                                 |  169 ++
 mm/kasan/report_hw_tags.c                                 |   44 
 mm/kasan/report_sw_tags.c                                 |   22 
 mm/kasan/shadow.c                                         |  528 +++++++
 mm/kasan/sw_tags.c                                        |   34 
 mm/kasan/tags.c                                           |    7 
 mm/kasan/tags_report.c                                    |    7 
 mm/mempool.c                                              |    4 
 mm/page_alloc.c                                           |    9 
 mm/page_poison.c                                          |    2 
 mm/ptdump.c                                               |   13 
 mm/slab_common.c                                          |    5 
 mm/slub.c                                                 |   29 
 scripts/Makefile.lib                                      |    2 
 tools/testing/selftests/arm64/mte/Makefile                |    2 
 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c |  155 ++
 74 files changed, 2869 insertions(+), 1553 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-12-18 22:00 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87.

Subsystems affected by this patch series:

  mm/memcg
  epoll
  mm/kasan
  mm/cleanups
  epoll

Subsystem: mm/memcg

    Alex Shi <alex.shi@linux.alibaba.com>:
    Patch series "bail out early for memcg disable":
      mm/memcg: bail early from swap accounting if memcg disabled
      mm/memcg: warning on !memcg after readahead page charged

    Wei Yang <richard.weiyang@gmail.com>:
      mm/memcg: remove unused definitions

    Shakeel Butt <shakeelb@google.com>:
      mm, kvm: account kvm_vcpu_mmap to kmemcg

    Hui Su <sh_def@163.com>:
      mm/memcontrol:rewrite mem_cgroup_page_lruvec()

Subsystem: epoll

    Soheil Hassas Yeganeh <soheil@google.com>:
    Patch series "simplify ep_poll":
      epoll: check for events when removing a timed out thread from the wait queue
      epoll: simplify signal handling
      epoll: pull fatal signal checks into ep_send_events()
      epoll: move eavail next to the list_empty_careful check
      epoll: simplify and optimize busy loop logic
      epoll: pull all code between fetch_events and send_event into the loop
      epoll: replace gotos with a proper loop
      epoll: eliminate unnecessary lock for zero timeout

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: add hardware tag-based mode for arm64", v11:
      kasan: drop unnecessary GPL text from comment headers
      kasan: KASAN_VMALLOC depends on KASAN_GENERIC
      kasan: group vmalloc code
      kasan: shadow declarations only for software modes
      kasan: rename (un)poison_shadow to (un)poison_range
      kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
      kasan: only build init.c for software modes
      kasan: split out shadow.c from common.c
      kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
      kasan: rename report and tags files
      kasan: don't duplicate config dependencies
      kasan: hide invalid free check implementation
      kasan: decode stack frame only with KASAN_STACK_ENABLE
      kasan, arm64: only init shadow for software modes
      kasan, arm64: only use kasan_depth for software modes
      kasan, arm64: move initialization message
      kasan, arm64: rename kasan_init_tags and mark as __init
      kasan: rename addr_has_shadow to addr_has_metadata
      kasan: rename print_shadow_for_address to print_memory_metadata
      kasan: rename SHADOW layout macros to META
      kasan: separate metadata_fetch_row for each mode
      kasan: introduce CONFIG_KASAN_HW_TAGS

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      arm64: enable armv8.5-a asm-arch option
      arm64: mte: add in-kernel MTE helpers
      arm64: mte: reset the page tag in page->flags
      arm64: mte: add in-kernel tag fault handler
      arm64: kasan: allow enabling in-kernel MTE
      arm64: mte: convert gcr_user into an exclude mask
      arm64: mte: switch GCR_EL1 in kernel entry and exit
      kasan, mm: untag page address in free_reserved_area

    Andrey Konovalov <andreyknvl@google.com>:
      arm64: kasan: align allocations for HW_TAGS
      arm64: kasan: add arch layer for memory tagging helpers
      kasan: define KASAN_GRANULE_SIZE for HW_TAGS
      kasan, x86, s390: update undef CONFIG_KASAN
      kasan, arm64: expand CONFIG_KASAN checks
      kasan, arm64: implement HW_TAGS runtime
      kasan, arm64: print report from tag fault handler
      kasan, mm: reset tags when accessing metadata
      kasan, arm64: enable CONFIG_KASAN_HW_TAGS
      kasan: add documentation for hardware tag-based mode

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kselftest/arm64: check GCR_EL1 after context switch

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: boot parameters for hardware tag-based mode", v4:
      kasan: simplify quarantine_put call site
      kasan: rename get_alloc/free_info
      kasan: introduce set_alloc_info
      kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
      kasan: allow VMAP_STACK for HW_TAGS mode
      kasan: remove __kasan_unpoison_stack
      kasan: inline kasan_reset_tag for tag-based modes
      kasan: inline random_tag for HW_TAGS
      kasan: open-code kasan_unpoison_slab
      kasan: inline (un)poison_range and check_invalid_free
      kasan: add and integrate kasan boot parameters
      kasan, mm: check kasan_enabled in annotations
      kasan, mm: rename kasan_poison_kfree
      kasan: don't round_up too much
      kasan: simplify assign_tag and set_tag calls
      kasan: clarify comment in __kasan_kfree_large
      kasan: sanitize objects when metadata doesn't fit
      kasan, mm: allow cache merging with no metadata
      kasan: update documentation

Subsystem: mm/cleanups

    Colin Ian King <colin.king@canonical.com>:
      mm/Kconfig: fix spelling mistake "whats" -> "what's"

Subsystem: epoll

    Willem de Bruijn <willemb@google.com>:
    Patch series "add epoll_pwait2 syscall", v4:
      epoll: convert internal api to timespec64
      epoll: add syscall epoll_pwait2
      epoll: wire up syscall epoll_pwait2
      selftests/filesystems: expand epoll with epoll_pwait2

 Documentation/dev-tools/kasan.rst                             |  274 +-
 arch/Kconfig                                                  |    8 
 arch/alpha/kernel/syscalls/syscall.tbl                        |    1 
 arch/arm/tools/syscall.tbl                                    |    1 
 arch/arm64/Kconfig                                            |    9 
 arch/arm64/Makefile                                           |    7 
 arch/arm64/include/asm/assembler.h                            |    2 
 arch/arm64/include/asm/cache.h                                |    3 
 arch/arm64/include/asm/esr.h                                  |    1 
 arch/arm64/include/asm/kasan.h                                |   17 
 arch/arm64/include/asm/memory.h                               |   15 
 arch/arm64/include/asm/mte-def.h                              |   16 
 arch/arm64/include/asm/mte-kasan.h                            |   67 
 arch/arm64/include/asm/mte.h                                  |   22 
 arch/arm64/include/asm/processor.h                            |    2 
 arch/arm64/include/asm/string.h                               |    5 
 arch/arm64/include/asm/uaccess.h                              |   23 
 arch/arm64/include/asm/unistd.h                               |    2 
 arch/arm64/include/asm/unistd32.h                             |    2 
 arch/arm64/kernel/asm-offsets.c                               |    3 
 arch/arm64/kernel/cpufeature.c                                |    3 
 arch/arm64/kernel/entry.S                                     |   41 
 arch/arm64/kernel/head.S                                      |    2 
 arch/arm64/kernel/hibernate.c                                 |    5 
 arch/arm64/kernel/image-vars.h                                |    2 
 arch/arm64/kernel/kaslr.c                                     |    3 
 arch/arm64/kernel/module.c                                    |    6 
 arch/arm64/kernel/mte.c                                       |  124 +
 arch/arm64/kernel/setup.c                                     |    2 
 arch/arm64/kernel/sleep.S                                     |    2 
 arch/arm64/kernel/smp.c                                       |    2 
 arch/arm64/lib/mte.S                                          |   16 
 arch/arm64/mm/copypage.c                                      |    9 
 arch/arm64/mm/fault.c                                         |   59 
 arch/arm64/mm/kasan_init.c                                    |   41 
 arch/arm64/mm/mteswap.c                                       |    9 
 arch/arm64/mm/proc.S                                          |   23 
 arch/arm64/mm/ptdump.c                                        |    6 
 arch/ia64/kernel/syscalls/syscall.tbl                         |    1 
 arch/m68k/kernel/syscalls/syscall.tbl                         |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl                   |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl                     |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl                     |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl                     |    1 
 arch/parisc/kernel/syscalls/syscall.tbl                       |    1 
 arch/powerpc/kernel/syscalls/syscall.tbl                      |    1 
 arch/s390/boot/string.c                                       |    1 
 arch/s390/kernel/syscalls/syscall.tbl                         |    1 
 arch/sh/kernel/syscalls/syscall.tbl                           |    1 
 arch/sparc/kernel/syscalls/syscall.tbl                        |    1 
 arch/x86/boot/compressed/misc.h                               |    1 
 arch/x86/entry/syscalls/syscall_32.tbl                        |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                        |    1 
 arch/x86/kernel/acpi/wakeup_64.S                              |    2 
 arch/x86/kvm/x86.c                                            |    2 
 arch/xtensa/kernel/syscalls/syscall.tbl                       |    1 
 fs/eventpoll.c                                                |  359 ++-
 include/linux/compat.h                                        |    6 
 include/linux/kasan-checks.h                                  |    2 
 include/linux/kasan.h                                         |  423 ++--
 include/linux/memcontrol.h                                    |  137 -
 include/linux/mm.h                                            |   24 
 include/linux/mmdebug.h                                       |   13 
 include/linux/moduleloader.h                                  |    3 
 include/linux/page-flags-layout.h                             |    2 
 include/linux/sched.h                                         |    2 
 include/linux/string.h                                        |    2 
 include/linux/syscalls.h                                      |    5 
 include/uapi/asm-generic/unistd.h                             |    4 
 init/init_task.c                                              |    2 
 kernel/fork.c                                                 |    4 
 kernel/sys_ni.c                                               |    2 
 lib/Kconfig.kasan                                             |   71 
 lib/test_kasan.c                                              |    2 
 lib/test_kasan_module.c                                       |    2 
 mm/Kconfig                                                    |    2 
 mm/kasan/Makefile                                             |   33 
 mm/kasan/common.c                                             | 1006 ++--------
 mm/kasan/generic.c                                            |   72 
 mm/kasan/generic_report.c                                     |   13 
 mm/kasan/hw_tags.c                                            |  294 ++
 mm/kasan/init.c                                               |   25 
 mm/kasan/kasan.h                                              |  204 +-
 mm/kasan/quarantine.c                                         |   35 
 mm/kasan/report.c                                             |  363 +--
 mm/kasan/report_generic.c                                     |  169 +
 mm/kasan/report_hw_tags.c                                     |   44 
 mm/kasan/report_sw_tags.c                                     |   22 
 mm/kasan/shadow.c                                             |  541 +++++
 mm/kasan/sw_tags.c                                            |   34 
 mm/kasan/tags.c                                               |    7 
 mm/kasan/tags_report.c                                        |    7 
 mm/memcontrol.c                                               |   53 
 mm/mempool.c                                                  |    4 
 mm/page_alloc.c                                               |    9 
 mm/page_poison.c                                              |    2 
 mm/ptdump.c                                                   |   13 
 mm/slab_common.c                                              |    5 
 mm/slub.c                                                     |   29 
 scripts/Makefile.lib                                          |    2 
 tools/testing/selftests/arm64/mte/Makefile                    |    2 
 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c     |  155 +
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   72 
 virt/kvm/coalesced_mmio.c                                     |    2 
 virt/kvm/kvm_main.c                                           |    2 
 105 files changed, 3268 insertions(+), 1873 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-12-16  4:41 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-12-16  4:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- lots of little subsystems

- a few post-linux-next MM material.  Most of this awaits more merging
  of other trees.


95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4.

Subsystems affected by this patch series:

  mm/swap
  mm/memory-hotplug
  alpha
  procfs
  misc
  core-kernel
  bitmap
  lib
  lz4
  bitops
  checkpatch
  nilfs
  kdump
  rapidio
  gcov
  bfs
  relay
  resource
  ubsan
  reboot
  fault-injection
  lzo
  apparmor
  mm/pagemap
  mm/cleanups
  mm/gup

Subsystem: mm/swap

    Zhaoyang Huang <huangzhaoyang@gmail.com>:
      mm: fix a race on nr_swap_pages

Subsystem: mm/memory-hotplug

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm/memory_hotplug: quieting offline operation

Subsystem: alpha

    Thomas Gleixner <tglx@linutronix.de>:
      alpha: replace bogus in_interrupt()

Subsystem: procfs

    Randy Dunlap <rdunlap@infradead.org>:
      procfs: delete duplicated words + other fixes

    Anand K Mistry <amistry@google.com>:
      proc: provide details on indirect branch speculation

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: fix lookup in /proc/net subdirectories after setns(2)

    Hui Su <sh_def@163.com>:
      fs/proc: make pde_get() return nothing

Subsystem: misc

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      asm-generic: force inlining of get_order() to work around gcc10 poor decision

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out mathematical helpers

Subsystem: core-kernel

    Hui Su <sh_def@163.com>:
      kernel/acct.c: use #elif instead of #end and #elif

Subsystem: bitmap

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean

    "Ma, Jianpeng" <jianpeng.ma@intel.com>:
      bitmap: remove unused function declaration

Subsystem: lib

    Geert Uytterhoeven <geert@linux-m68k.org>:
      lib/test_free_pages.c: add basic progress indicators

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
    Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member":
      lib/stackdepot.c: replace one-element array with flexible-array member
      lib/stackdepot.c: use flex_array_size() helper in memcpy()
      lib/stackdepot.c: use array_size() helper in jhash2()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      lib/list_kunit: follow new file name convention for KUnit tests
      lib/linear_ranges_kunit: follow new file name convention for KUnit tests
      lib/bits_kunit: follow new file name convention for KUnit tests
      lib/cmdline: fix get_option() for strings starting with hyphen
      lib/cmdline: allow NULL to be an output for get_option()
      lib/cmdline_kunit: add a new test suite for cmdline API

    Jakub Jelinek <jakub@redhat.com>:
      ilog2: improve ilog2 for constant arguments

    Nick Desaulniers <ndesaulniers@google.com>:
      lib/string: remove unnecessary #undefs

    Daniel Axtens <dja@axtens.net>:
    Patch series "Fortify strscpy()", v7:
      lib: string.h: detect intra-object overflow in fortified string functions
      lkdtm: tests for FORTIFY_SOURCE

    Francis Laniel <laniel_francis@privacyrequired.com>:
      string.h: add FORTIFY coverage for strscpy()
      drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy
      drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: cleanup kstrto*() usage

Subsystem: lz4

    Gao Xiang <hsiangkao@redhat.com>:
      lib/lz4: explicitly support in-place decompression

Subsystem: bitops

    Syed Nayyar Waris <syednwaris@gmail.com>:
    Patch series "Introduce the for_each_set_clump macro", v12:
      bitops: introduce the for_each_set_clump macro
      lib/test_bitmap.c: add for_each_set_clump test cases
      gpio: thunderx: utilize for_each_set_clump macro
      gpio: xilinx: utilize generic bitmap_get_value and _set_value

Subsystem: checkpatch

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add new exception to repeated word check

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: fix false positives in REPEATED_WORD warning

    Łukasz Stelmach <l.stelmach@samsung.com>:
      checkpatch: ignore generated CamelCase defines and enum values

    Joe Perches <joe@perches.com>:
      checkpatch: prefer static const declarations
      checkpatch: allow --fix removal of unnecessary break statements

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: extend attributes check to handle more patterns

    Tom Rix <trix@redhat.com>:
      checkpatch: add a fixer for missing newline at eof

    Joe Perches <joe@perches.com>:
      checkpatch: update __attribute__((section("name"))) quote removal

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add fix option for GERRIT_CHANGE_ID

    Joe Perches <joe@perches.com>:
      checkpatch: add __alias and __weak to suggested __attribute__ conversions

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: improve email parsing
      checkpatch: fix spelling errors and remove repeated word

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: fix unescaped left brace

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS
      checkpatch: add fix option for LOGICAL_CONTINUATIONS
      checkpatch: add fix and improve warning msg for non-standard signature

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi]
      checkpatch: add warning for lines starting with a '#' in commit log
      checkpatch: fix TYPO_SPELLING check for words with apostrophe

    Joe Perches <joe@perches.com>:
      checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning

Subsystem: nilfs

    Alex Shi <alex.shi@linux.alibaba.com>:
      fs/nilfs2: remove some unused macros to tame gcc

Subsystem: kdump

    Alexander Egorenkov <egorenar@linux.ibm.com>:
      kdump: append uts_namespace.name offset to VMCOREINFO

Subsystem: rapidio

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      rapidio: remove unused rio_get_asm() and rio_get_device()

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: remove support for GCC < 4.9

    Alex Shi <alex.shi@linux.alibaba.com>:
      gcov: fix kernel-doc markup issue

Subsystem: bfs

    Randy Dunlap <rdunlap@infradead.org>:
      bfs: don't use WARNING: string when it's just info.

Subsystem: relay

    Jani Nikula <jani.nikula@intel.com>:
    Patch series "relay: cleanup and const callbacks", v2:
      relay: remove unused buf_mapped and buf_unmapped callbacks
      relay: require non-NULL callbacks in relay_open()
      relay: make create_buf_file and remove_buf_file callbacks mandatory
      relay: allow the use of const callback structs
      drm/i915: make relay callbacks const
      ath10k: make relay callbacks const
      ath11k: make relay callbacks const
      ath9k: make relay callbacks const
      blktrace: make relay callbacks const

Subsystem: resource

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      kernel/resource.c: fix kernel-doc markups

Subsystem: ubsan

    Kees Cook <keescook@chromium.org>:
    Patch series "Clean up UBSAN Makefile", v2:
      ubsan: remove redundant -Wno-maybe-uninitialized
      ubsan: move cc-option tests into Kconfig
      ubsan: disable object-size sanitizer under GCC
      ubsan: disable UBSAN_TRAP for all*config
      ubsan: enable for all*config builds
      ubsan: remove UBSAN_MISC in favor of individual options
      ubsan: expand tests and reporting

    Dmitry Vyukov <dvyukov@google.com>:
      kcov: don't instrument with UBSAN

    Zou Wei <zou_wei@huawei.com>:
      lib/ubsan.c: mark type_check_kinds with static keyword

Subsystem: reboot

    Matteo Croce <mcroce@microsoft.com>:
      reboot: refactor and comment the cpu selection code
      reboot: allow to specify reboot mode via sysfs
      reboot: remove cf9_safe from allowed types and rename cf9_force
    Patch series "reboot: sysfs improvements":
      reboot: allow to override reboot type if quirks are found
      reboot: hide from sysfs not applicable settings

Subsystem: fault-injection

    Barnabás Pőcze <pobrn@protonmail.com>:
      fault-injection: handle EI_ETYPE_TRUE

Subsystem: lzo

    Jason Yan <yanaijie@huawei.com>:
      lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static

Subsystem: apparmor

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      apparmor: remove duplicate macro list_entry_is_head()

Subsystem: mm/pagemap

    Christoph Hellwig <hch@lst.de>:
    Patch series "simplify follow_pte a bit":
      mm: unexport follow_pte_pmd
      mm: simplify follow_pte{,pmd}

Subsystem: mm/cleanups

    Haitao Shi <shihaitao1@huawei.com>:
      mm: fix some spelling mistakes in comments

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mmap locking API: don't check locking if the mm isn't live yet
      mm/gup: assert that the mmap lock is held in __get_user_pages()

 Documentation/ABI/testing/sysfs-kernel-reboot    |   32 
 Documentation/admin-guide/kdump/vmcoreinfo.rst   |    6 
 Documentation/dev-tools/ubsan.rst                |    1 
 Documentation/filesystems/proc.rst               |    2 
 MAINTAINERS                                      |    5 
 arch/alpha/kernel/process.c                      |    2 
 arch/powerpc/kernel/vmlinux.lds.S                |    4 
 arch/s390/pci/pci_mmio.c                         |    4 
 drivers/gpio/gpio-thunderx.c                     |   11 
 drivers/gpio/gpio-xilinx.c                       |   61 -
 drivers/gpu/drm/i915/gt/uc/intel_guc_log.c       |    2 
 drivers/misc/lkdtm/Makefile                      |    1 
 drivers/misc/lkdtm/bugs.c                        |   50 +
 drivers/misc/lkdtm/core.c                        |    3 
 drivers/misc/lkdtm/fortify.c                     |   82 ++
 drivers/misc/lkdtm/lkdtm.h                       |   19 
 drivers/net/wireless/ath/ath10k/spectral.c       |    2 
 drivers/net/wireless/ath/ath11k/spectral.c       |    2 
 drivers/net/wireless/ath/ath9k/common-spectral.c |    2 
 drivers/rapidio/rio.c                            |   81 --
 fs/bfs/inode.c                                   |    2 
 fs/dax.c                                         |    9 
 fs/exec.c                                        |    8 
 fs/nfs/callback_proc.c                           |    5 
 fs/nilfs2/segment.c                              |    5 
 fs/proc/array.c                                  |   28 
 fs/proc/base.c                                   |    2 
 fs/proc/generic.c                                |   24 
 fs/proc/internal.h                               |   10 
 fs/proc/proc_net.c                               |   20 
 include/asm-generic/bitops/find.h                |   19 
 include/asm-generic/getorder.h                   |    2 
 include/linux/bitmap.h                           |   67 +-
 include/linux/bitops.h                           |   24 
 include/linux/dcache.h                           |    1 
 include/linux/iommu-helper.h                     |    4 
 include/linux/kernel.h                           |  173 -----
 include/linux/log2.h                             |    3 
 include/linux/math.h                             |  177 +++++
 include/linux/mm.h                               |    6 
 include/linux/mm_types.h                         |   10 
 include/linux/mmap_lock.h                        |   16 
 include/linux/proc_fs.h                          |    8 
 include/linux/rcu_node_tree.h                    |    2 
 include/linux/relay.h                            |   29 
 include/linux/rio_drv.h                          |    3 
 include/linux/string.h                           |   75 +-
 include/linux/units.h                            |    2 
 kernel/Makefile                                  |    3 
 kernel/acct.c                                    |    7 
 kernel/crash_core.c                              |    1 
 kernel/fail_function.c                           |    6 
 kernel/gcov/gcc_4_7.c                            |   10 
 kernel/reboot.c                                  |  308 ++++++++-
 kernel/relay.c                                   |  111 ---
 kernel/resource.c                                |   24 
 kernel/trace/blktrace.c                          |    2 
 lib/Kconfig.debug                                |   11 
 lib/Kconfig.ubsan                                |  154 +++-
 lib/Makefile                                     |    7 
 lib/bits_kunit.c                                 |   75 ++
 lib/cmdline.c                                    |   20 
 lib/cmdline_kunit.c                              |  100 +++
 lib/errname.c                                    |    1 
 lib/error-inject.c                               |    2 
 lib/errseq.c                                     |    1 
 lib/find_bit.c                                   |   17 
 lib/linear_ranges_kunit.c                        |  228 +++++++
 lib/list-test.c                                  |  748 -----------------------
 lib/list_kunit.c                                 |  748 +++++++++++++++++++++++
 lib/lz4/lz4_decompress.c                         |    6 
 lib/lz4/lz4defs.h                                |    1 
 lib/lzo/lzo1x_compress.c                         |    2 
 lib/math/div64.c                                 |    4 
 lib/math/int_pow.c                               |    2 
 lib/math/int_sqrt.c                              |    3 
 lib/math/reciprocal_div.c                        |    9 
 lib/stackdepot.c                                 |   11 
 lib/string.c                                     |    4 
 lib/test_bitmap.c                                |  143 ++++
 lib/test_bits.c                                  |   75 --
 lib/test_firmware.c                              |    9 
 lib/test_free_pages.c                            |    5 
 lib/test_kmod.c                                  |   26 
 lib/test_linear_ranges.c                         |  228 -------
 lib/test_lockup.c                                |   16 
 lib/test_ubsan.c                                 |   74 ++
 lib/ubsan.c                                      |    2 
 mm/filemap.c                                     |    2 
 mm/gup.c                                         |    2 
 mm/huge_memory.c                                 |    2 
 mm/khugepaged.c                                  |    2 
 mm/memblock.c                                    |    2 
 mm/memory.c                                      |   36 -
 mm/memory_hotplug.c                              |    2 
 mm/migrate.c                                     |    2 
 mm/page_ext.c                                    |    2 
 mm/swapfile.c                                    |   11 
 scripts/Makefile.ubsan                           |   49 -
 scripts/checkpatch.pl                            |  495 +++++++++++----
 security/apparmor/apparmorfs.c                   |    3 
 tools/testing/selftests/lkdtm/tests.txt          |    1 
 102 files changed, 3022 insertions(+), 1899 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-12-15 22:49   ` incoming Linus Torvalds
@ 2020-12-15 22:55     ` Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Linux-MM, mm-commits

On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > I will try to apply it on top of my merge of your previous series instead.
> 
> Yes, then it applies cleanly. So apparently we just have different
> concepts of what really constitutes a "base" for applying your series.
> 

oop, sorry, yes, the "based on" thing was wrong because I had two
series in flight simultaneously.  I've never tried that before..


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-12-15 22:48 ` incoming Linus Torvalds
@ 2020-12-15 22:49   ` Linus Torvalds
  2020-12-15 22:55     ` incoming Andrew Morton
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> I will try to apply it on top of my merge of your previous series instead.

Yes, then it applies cleanly. So apparently we just have different
concepts of what really constitutes a "base" for applying your series.

              Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-12-15 20:32 incoming Andrew Morton
  2020-12-15 21:00 ` incoming Linus Torvalds
@ 2020-12-15 22:48 ` Linus Torvalds
  2020-12-15 22:49   ` incoming Linus Torvalds
  1 sibling, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

With your re-send, I get all patches, but they don't actually apply cleanly.

Is that base correct?

I get

  error: patch failed: mm/huge_memory.c:2750
  error: mm/huge_memory.c: patch does not apply
  Patch failed at 0004 mm/thp: narrow lru locking

for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's
definitely true: the patch fragment has

@@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page
                                __dec_lruvec_page_state(head, NR_FILE_THPS);
                }

-               __split_huge_page(page, list, end, flags);
+               __split_huge_page(page, list, end);
                ret = 0;
        } else {
                if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) {

but that __dec_lruvec_page_state() conversion was done by your
previous commit series.

So I have the feeling that what you actually mean by "base" isn't
actually really the base for that series at all..

I will try to apply it on top of my merge of your previous series instead.

              Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-12-15 20:32 incoming Andrew Morton
@ 2020-12-15 21:00 ` Linus Torvalds
  2020-12-15 22:48 ` incoming Linus Torvalds
  1 sibling, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw)
  To: Andrew Morton; +Cc: Linux-MM, mm-commits

On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

I'm not seeing patch 10/19 at all.

And patch 19/19 is corrupted and has an attachment with a '^P'
character in it. I could fix it up, but with the missing patch in the
middle I'm not going to even try. 'b4' is also very unhappy about that
patch 19/19.

I don't know what went wrong, but I'll ignore this send - please
re-send the series at your leisure, ok?

            Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-12-15 20:32 Andrew Morton
  2020-12-15 21:00 ` incoming Linus Torvalds
  2020-12-15 22:48 ` incoming Linus Torvalds
  0 siblings, 2 replies; 188+ messages in thread
From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


- more MM work: a memcg scalability improvememt

19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

Subsystems affected by this patch series:


    Alex Shi <alex.shi@linux.alibaba.com>:
    Patch series "per memcg lru lock", v21:
      mm/thp: move lru_add_page_tail() to huge_memory.c
      mm/thp: use head for head page in lru_add_page_tail()
      mm/thp: simplify lru_add_page_tail()
      mm/thp: narrow lru locking
      mm/vmscan: remove unnecessary lruvec adding
      mm/rmap: stop store reordering issue on page->mapping

    Hugh Dickins <hughd@google.com>:
      mm: page_idle_get_page() does not need lru_lock

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: add debug checking in lock_page_memcg
      mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn
      mm/lru: move lock into lru_note_cost
      mm/vmscan: remove lruvec reget in move_pages_to_lru
      mm/mlock: remove lru_lock on TestClearPageMlocked
      mm/mlock: remove __munlock_isolate_lru_page()
      mm/lru: introduce TestClearPageLRU()
      mm/compaction: do page isolation first in compaction
      mm/swap.c: serialize memcg changes in pagevec_lru_move_fn
      mm/lru: replace pgdat lru_lock with lruvec lock

    Alexander Duyck <alexander.h.duyck@linux.intel.com>:
      mm/lru: introduce relock_page_lruvec()

    Hugh Dickins <hughd@google.com>:
      mm/lru: revise the comments of lru_lock

 Documentation/admin-guide/cgroup-v1/memcg_test.rst |   15 -
 Documentation/admin-guide/cgroup-v1/memory.rst     |   23 -
 Documentation/trace/events-kmem.rst                |    2 
 Documentation/vm/unevictable-lru.rst               |   22 -
 include/linux/memcontrol.h                         |  110 +++++++
 include/linux/mm_types.h                           |    2 
 include/linux/mmzone.h                             |    6 
 include/linux/page-flags.h                         |    1 
 include/linux/swap.h                               |    4 
 mm/compaction.c                                    |   98 ++++---
 mm/filemap.c                                       |    4 
 mm/huge_memory.c                                   |  109 ++++---
 mm/memcontrol.c                                    |   84 +++++-
 mm/mlock.c                                         |   93 ++----
 mm/mmzone.c                                        |    1 
 mm/page_alloc.c                                    |    1 
 mm/page_idle.c                                     |    4 
 mm/rmap.c                                          |   12 
 mm/swap.c                                          |  292 ++++++++-------------
 mm/vmscan.c                                        |  239 ++++++++---------
 mm/workingset.c                                    |    2 
 21 files changed, 644 insertions(+), 480 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-12-15  3:30   ` incoming Linus Torvalds
@ 2020-12-15 14:04     ` Konstantin Ryabitsev
  0 siblings, 0 replies; 188+ messages in thread
From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote:
> > All the patches except for _one_ get a nice little green check-mark
> > next to them when I use 'git am' on this series.
> >
> > The one that did not was [patch 192/200].
> >
> > I have no idea why
> 
> Hmm. It looks like that patch is the only one in the series with the
> ">From" marker in the commit message, from the silly "clarify that
> this isn't the first line in a new message in mbox format".
> 
> And "b4 am" has turned the single ">" into two, making the stupid
> marker worse, and actually corrupting the end result.

It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted 
.mbox files, while Python's mailbox.mbox consumes mboxo only. The main 
distinction between the two is precisely that mboxrd will convert 
">From " into ">>From " in an attempt to avoid corruption during
escape/unescape (it didn't end up fixing the problem 100% and mostly 
introduced incompatibilities like this one).

I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the 
end of the week.

Thanks for the report.

-K


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-12-15  3:25 ` incoming Linus Torvalds
@ 2020-12-15  3:30   ` Linus Torvalds
  2020-12-15 14:04     ` incoming Konstantin Ryabitsev
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2020-12-15  3:30 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> All the patches except for _one_ get a nice little green check-mark
> next to them when I use 'git am' on this series.
>
> The one that did not was [patch 192/200].
>
> I have no idea why

Hmm. It looks like that patch is the only one in the series with the
">From" marker in the commit message, from the silly "clarify that
this isn't the first line in a new message in mbox format".

And "b4 am" has turned the single ">" into two, making the stupid
marker worse, and actually corrupting the end result.

Coincidence? Or cause?

            Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-12-15  3:02 incoming Andrew Morton
@ 2020-12-15  3:25 ` Linus Torvalds
  2020-12-15  3:30   ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2020-12-15  3:25 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM

On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.

I haven't actually processed the patches yet, but I have a question
for Konstantin wrt b4.

All the patches except for _one_ get a nice little green check-mark
next to them when I use 'git am' on this series.

The one that did not was [patch 192/200].

I have no idea why - and it doesn't matter a lot to me, it just stood
out as being different. I'm assuming Andrew has started doing patch
attestation, and that patch failed. But if so, maybe Konstantin wants
to know what went wrong.

Konstantin?

            Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-12-15  3:02 Andrew Morton
  2020-12-15  3:25 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2020-12-15  3:02 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- a few random little subsystems

- almost all of the MM patches which are staged ahead of linux-next
  material.  I'll trickle to post-linux-next work in as the dependents
  get merged up.


200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.

Subsystems affected by this patch series:

  kthread
  kbuild
  ide
  ntfs
  ocfs2
  arch
  mm/slab-generic
  mm/slab
  mm/slub
  mm/dax
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/hmm
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/compaction
  mm/oom-kill
  mm/migration
  mm/cma
  mm/page-poison
  mm/userfaultfd
  mm/zswap
  mm/zsmalloc
  mm/uaccess
  mm/zram
  mm/cleanups

Subsystem: kthread

    Rob Clark <robdclark@chromium.org>:
      kthread: add kthread_work tracepoints

    Petr Mladek <pmladek@suse.com>:
      kthread_worker: document CPU hotplug handling

Subsystem: kbuild

    Petr Vorel <petr.vorel@gmail.com>:
      uapi: move constants from <linux/kernel.h> to <linux/const.h>

Subsystem: ide

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      ide/falcon: remove in_interrupt() usage
      ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()

Subsystem: ntfs

    Alex Shi <alex.shi@linux.alibaba.com>:
      fs/ntfs: remove unused varibles
      fs/ntfs: remove unused variable attr_len

Subsystem: ocfs2

    Tom Rix <trix@redhat.com>:
      fs/ocfs2/cluster/tcp.c: remove unneeded break

    Mauricio Faria de Oliveira <mfo@canonical.com>:
      ocfs2: ratelimit the 'max lookup times reached' notice

Subsystem: arch

    Colin Ian King <colin.king@canonical.com>:
      arch/Kconfig: fix spelling mistakes

Subsystem: mm/slab-generic

    Hui Su <sh_def@163.com>:
      mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
    Patch series "slab: provide and use krealloc_array()", v3:
      mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
      mm: slab: provide krealloc_array()
      ALSA: pcm: use krealloc_array()
      vhost: vringh: use krealloc_array()
      pinctrl: use krealloc_array()
      edac: ghes: use krealloc_array()
      drm: atomic: use krealloc_array()
      hwtracing: intel: use krealloc_array()
      dma-buf: use krealloc_array()

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slab, slub: clear the slab_cache field when freeing page

Subsystem: mm/slab

    Alexander Popov <alex.popov@linux.com>:
      mm/slab: rerform init_on_free earlier

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: use kmem_cache_debug_flags() in deactivate_slab()

    Bharata B Rao <bharata@linux.ibm.com>:
      mm/slub: let number of online CPUs determine the slub page order

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
      device-dax/kmem: use struct_size()

Subsystem: mm/debug

    Zhenhua Huang <zhenhuah@codeaurora.org>:
      mm: fix page_owner initializing issue for arm32

    Liam Mark <lmark@codeaurora.org>:
      mm/page_owner: record timestamp and pid

Subsystem: mm/pagecache

    Kent Overstreet <kent.overstreet@gmail.com>:
    Patch series "generic_file_buffered_read() improvements", v2:
      mm/filemap/c: break generic_file_buffered_read up into multiple functions
      mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/truncate: add parameter explanation for invalidate_mapping_pagevec

    Hailong Liu <carver4lio@163.com>:
      mm/filemap.c: remove else after a return

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3:
      mm/gup_benchmark: rename to mm/gup_test
      selftests/vm: use a common gup_test.h
      selftests/vm: rename run_vmtests --> run_vmtests.sh
      selftests/vm: minor cleanup: Makefile and gup_test.c
      selftests/vm: only some gup_test items are really benchmarks
      selftests/vm: gup_test: introduce the dump_pages() sub-test
      selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
      selftests/vm: hmm-tests: remove the libhugetlbfs dependency
      selftests/vm: 2x speedup for run_vmtests.sh

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/gup_test.c: mark gup_test_init as __init function
      mm/gup_test: GUP_TEST depends on DEBUG_FS

    Jason Gunthorpe <jgg@nvidia.com>:
    Patch series "Add a seqcount between gup_fast and copy_page_range()", v4:
      mm/gup: reorganize internal_get_user_pages_fast()
      mm/gup: prevent gup_fast from racing with COW during fork
      mm/gup: remove the vma allocation from gup_longterm_locked()
      mm/gup: combine put_compound_head() and unpin_user_page()

Subsystem: mm/swap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: handle zone device pages in release_pages()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
      mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
      mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
      mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE

    Jeff Layton <jlayton@kernel.org>:
      mm: remove pagevec_lookup_range_nr_tag()

Subsystem: mm/shmem

    Hui Su <sh_def@163.com>:
      mm/shmem.c: make shmem_mapping() inline

    Randy Dunlap <rdunlap@infradead.org>:
      tmpfs: fix Documentation nits

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: add file_thp, shmem_thp to memory.stat

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: remove unused mod_memcg_obj_state()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix return of child memcg objcg for root memcg
      mm: memcg/slab: fix use after free in obj_cgroup_charge

    Shakeel Butt <shakeelb@google.com>:
      mm/rmap: always do TTU_IGNORE_ACCESS

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: update page struct member in comments

    Roman Gushchin <guro@fb.com>:
      mm: memcg: fix obsolete code comments
    Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1:
      mm: memcg: deprecate the non-hierarchical mode
      docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
      cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy

    Hui Su <sh_def@163.com>:
      mm/page_counter: use page_counter_read in page_counter_set_max

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      mm: memcg: remove obsolete memcg_has_children()

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state

    Kaixu Xia <kaixuxia@tencent.com>:
      mm: memcontrol: sssign boolean values to a bool variable

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: remove incorrect comment

    Shakeel Butt <shakeelb@google.com>:
    Patch series "memcg: add pagetable comsumption to memory.stat", v2:
      mm: move lruvec stats update functions to vmstat.h
      mm: memcontrol: account pagetables per node

Subsystem: mm/pagemap

    Dan Williams <dan.j.williams@intel.com>:
      xen/unpopulated-alloc: consolidate pgmap manipulation

    Kalesh Singh <kaleshsingh@google.com>:
    Patch series "Speed up mremap on large regions", v4:
      kselftests: vm: add mremap tests
      mm: speedup mremap on 1GB or larger regions
      arm64: mremap speedup - enable HAVE_MOVE_PUD
      x86: mremap speedup - Enable HAVE_MOVE_PUD

    John Hubbard <jhubbard@nvidia.com>:
      mm: cleanup: remove unused tsk arg from __access_remote_vm

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/mapping_dirty_helpers: enhance the kernel-doc markups
      mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte

    Axel Rasmussen <axelrasmussen@google.com>:
      mm: mmap_lock: add tracepoints around lock acquisition

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      sparc: fix handling of page table constructor failure
      mm: move free_unref_page to mm/internal.h

Subsystem: mm/mremap

    Dmitry Safonov <dima@arista.com>:
    Patch series "mremap: move_vma() fixes":
      mm/mremap: account memory on do_munmap() failure
      mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
      mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
      vm_ops: rename .split() callback to .may_split()
      mremap: check if it's possible to split original vma
      mm: forbid splitting special mappings

Subsystem: mm/hmm

    Daniel Vetter <daniel.vetter@ffwll.ch>:
      mm: track mmu notifiers in fs_reclaim_acquire/release
      mm: extract might_alloc() debug check
      locking/selftests: add testcases for fs_reclaim

Subsystem: mm/vmalloc

    Andrew Morton <akpm@linux-foundation.org>:
      mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: use free_vm_area() if an allocation fails
      mm/vmalloc: rework the drain logic

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/vmalloc.c: remove unnecessary return statement

    Waiman Long <longman@redhat.com>:
      mm/vmalloc: Fix unlock order in s_stop()

Subsystem: mm/documentation

    Alex Shi <alex.shi@linux.alibaba.com>:
      docs/vm: remove unused 3 items explanation for /proc/vmstat

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      mm/vmalloc.c: fix kasan shadow poisoning size

    Walter Wu <walter-zh.wu@mediatek.com>:
    Patch series "kasan: add workqueue stack for generic KASAN", v5:
      workqueue: kasan: record workqueue stack
      kasan: print workqueue stack
      lib/test_kasan.c: add workqueue test case
      kasan: update documentation for generic kasan

    Marco Elver <elver@google.com>:
      lkdtm: disable KASAN for rodata.o

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "arch, mm: deprecate DISCONTIGMEM", v2:
      alpha: switch from DISCONTIGMEM to SPARSEMEM
      ia64: remove custom __early_pfn_to_nid()
      ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
      ia64: discontig: paging_init(): remove local max_pfn calculation
      ia64: split virtual map initialization out of paging_init()
      ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
      ia64: make SPARSEMEM default and disable DISCONTIGMEM
      arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
      arm, arm64: move free_unused_memmap() to generic mm
      arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
      m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
      m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
      m68k: deprecate DISCONTIGMEM
    Patch series "arch, mm: improve robustness of direct map manipulation", v7:
      mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
      PM: hibernate: make direct map manipulations more explicit
      arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
      arch, mm: make kernel_page_present() always available

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "disable pcplists during memory offline", v3:
      mm, page_alloc: clean up pageset high and batch update
      mm, page_alloc: calculate pageset high and batch once per zone
      mm, page_alloc: remove setup_pageset()
      mm, page_alloc: simplify pageset_update()
      mm, page_alloc: cache pageset high and batch in struct zone
      mm, page_alloc: move draining pcplists to page isolation users
      mm, page_alloc: disable pcplists during memory offline

    Miaohe Lin <linmiaohe@huawei.com>:
      include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/page-flags: fix comment
      mm/page_alloc: add __free_pages() documentation

    Zou Wei <zou_wei@huawei.com>:
      mm/page_alloc: mark some symbols with static keyword

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1

    Lin Feng <linf@wangsu.com>:
      init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set

    Lorenzo Stoakes <lstoakes@gmail.com>:
      mm: page_alloc: refactor setup_per_zone_lowmem_reserve()

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_alloc: speed up the iteration of max_order

Subsystem: mm/memory-failure

    Oscar Salvador <osalvador@suse.de>:
    Patch series "HWpoison: further fixes and cleanups", v5:
      mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
      mm,hwpoison: take free pages off the buddy freelists
      mm,hwpoison: drop unneeded pcplist draining
    Patch series "HWPoison: Refactor get page interface", v2:
      mm,hwpoison: refactor get_any_page
      mm,hwpoison: disable pcplists before grabbing a refcount
      mm,hwpoison: remove drain_all_pages from shake_page
      mm,memory_failure: always pin the page in madvise_inject_error
      mm,hwpoison: return -EBUSY when migration fails

Subsystem: mm/hugetlb

    Hui Su <sh_def@163.com>:
      mm/hugetlb.c: just use put_page_testzero() instead of page_count()

    Ralph Campbell <rcampbell@nvidia.com>:
      include/linux/huge_mm.h: remove extern keyword

    Alex Shi <alex.shi@linux.alibaba.com>:
      khugepaged: add parameter explanations for kernel-doc markup

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()

    Oscar Salvador <osalvador@suse.de>:
      mm,hugetlb: remove unneeded initialization

    Dan Carpenter <dan.carpenter@oracle.com>:
      hugetlb: fix an error code in hugetlb_reserve_pages()

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: don't wake kswapd prematurely when watermark boosting is disabled

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      mm/vmscan: drop unneeded assignment in kswapd()

    "logic.yu" <hymmsx.yu@gmail.com>:
      mm/vmscan.c: remove the filename in the top of file comment

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_isolation: do not isolate the max order page

Subsystem: mm/z3fold

    Vitaly Wool <vitaly.wool@konsulko.com>:
    Patch series "z3fold: stability / rt fixes":
      z3fold: simplify freeing slots
      z3fold: stricter locking and more careful reclaim
      z3fold: remove preempt disabled sections for RT

Subsystem: mm/compaction

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()

    Hui Su <sh_def@163.com>:
      mm/compaction: move compaction_suitable's comment to right place
      mm/compaction: make defer_compaction and compaction_deferred static

Subsystem: mm/oom-kill

    Hui Su <sh_def@163.com>:
      mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()

Subsystem: mm/migration

    Long Li <lonuxli.64@gmail.com>:
      mm/migrate.c: fix comment spelling

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate.c: optimize migrate_vma_pages() mmu notifier

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: support THPs in zero_user_segments

    Yang Shi <shy828301@gmail.com>:
    Patch series "mm: misc migrate cleanup and improvement", v3:
      mm: truncate_complete_page() does not exist any more
      mm: migrate: simplify the logic for handling permanent failure
      mm: migrate: skip shared exec THP for NUMA balancing
      mm: migrate: clean up migrate_prep{_local}
      mm: migrate: return -ENOSYS if THP migration is unsupported

    Stephen Zhang <starzhangzsd@gmail.com>:
      mm: migrate: remove unused parameter in migrate_vma_insert_page()

Subsystem: mm/cma

    Lecopzer Chen <lecopzer.chen@mediatek.com>:
      mm/cma.c: remove redundant cma_mutex lock

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: cma: improve pr_debug log in cma_release()

Subsystem: mm/page-poison

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "cleanup page poisoning", v3:
      mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
      mm, page_poison: use static key more efficiently
      kernel/power: allow hibernation with page_poison sanity checking
      mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
      mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO

Subsystem: mm/userfaultfd

    Lokesh Gidra <lokeshgidra@google.com>:
    Patch series "Control over userfaultfd kernel-fault handling", v6:
      userfaultfd: add UFFD_USER_MODE_ONLY
      userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: selftests: make __{s,u}64 format specifiers portable

    Peter Xu <peterx@redhat.com>:
    Patch series "userfaultfd: selftests: Small fixes":
      userfaultfd/selftests: always dump something in modes
      userfaultfd/selftests: fix retval check for userfaultfd_open()
      userfaultfd/selftests: hint the test runner on required privilege

Subsystem: mm/zswap

    Joe Perches <joe@perches.com>:
      mm/zswap: make struct kernel_param_ops definitions const

    YueHaibing <yuehaibing@huawei.com>:
      mm/zswap: fix passing zero to 'PTR_ERR' warning

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/zswap: move to use crypto_acomp API for hardware acceleration

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: rework the list_add code in insert_zspage()

Subsystem: mm/uaccess

    Colin Ian King <colin.king@canonical.com>:
      mm/process_vm_access: remove redundant initialization of iov_r

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      zram: support page writeback
      zram: add stat to gather incompressible pages since zram set up

    Rui Salvaterra <rsalvaterra@gmail.com>:
      zram: break the strict dependency from lzo

Subsystem: mm/cleanups

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      mm: fix kernel-doc markups

    Joe Perches <joe@perches.com>:
    Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2:
      mm: use sysfs_emit for struct kobject * uses
      mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
      mm:backing-dev: use sysfs_emit in macro defining functions
      mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
      mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      mm: fix fall-through warnings for Clang

    Alexey Dobriyan <adobriyan@gmail.com>:
      mm: cleanup kstrto*() usage

 /mmap_lock.h                                         |  107 ++
 a/Documentation/admin-guide/blockdev/zram.rst        |    6 
 a/Documentation/admin-guide/cgroup-v1/memcg_test.rst |    8 
 a/Documentation/admin-guide/cgroup-v1/memory.rst     |   42 
 a/Documentation/admin-guide/cgroup-v2.rst            |   11 
 a/Documentation/admin-guide/mm/transhuge.rst         |   15 
 a/Documentation/admin-guide/sysctl/vm.rst            |   15 
 a/Documentation/core-api/memory-allocation.rst       |    4 
 a/Documentation/core-api/pin_user_pages.rst          |    8 
 a/Documentation/dev-tools/kasan.rst                  |    5 
 a/Documentation/filesystems/tmpfs.rst                |    8 
 a/Documentation/vm/memory-model.rst                  |    3 
 a/Documentation/vm/page_owner.rst                    |   12 
 a/arch/Kconfig                                       |   21 
 a/arch/alpha/Kconfig                                 |    8 
 a/arch/alpha/include/asm/mmzone.h                    |   14 
 a/arch/alpha/include/asm/page.h                      |    7 
 a/arch/alpha/include/asm/pgtable.h                   |   12 
 a/arch/alpha/include/asm/sparsemem.h                 |   18 
 a/arch/alpha/kernel/setup.c                          |    1 
 a/arch/arc/Kconfig                                   |    3 
 a/arch/arc/include/asm/page.h                        |   20 
 a/arch/arc/mm/init.c                                 |   29 
 a/arch/arm/Kconfig                                   |   12 
 a/arch/arm/kernel/vdso.c                             |    9 
 a/arch/arm/mach-bcm/Kconfig                          |    1 
 a/arch/arm/mach-davinci/Kconfig                      |    1 
 a/arch/arm/mach-exynos/Kconfig                       |    1 
 a/arch/arm/mach-highbank/Kconfig                     |    1 
 a/arch/arm/mach-omap2/Kconfig                        |    1 
 a/arch/arm/mach-s5pv210/Kconfig                      |    1 
 a/arch/arm/mach-tango/Kconfig                        |    1 
 a/arch/arm/mm/init.c                                 |   78 -
 a/arch/arm64/Kconfig                                 |    9 
 a/arch/arm64/include/asm/cacheflush.h                |    1 
 a/arch/arm64/include/asm/pgtable.h                   |    1 
 a/arch/arm64/kernel/vdso.c                           |   41 
 a/arch/arm64/mm/init.c                               |   68 -
 a/arch/arm64/mm/pageattr.c                           |   12 
 a/arch/ia64/Kconfig                                  |   11 
 a/arch/ia64/include/asm/meminit.h                    |    2 
 a/arch/ia64/mm/contig.c                              |   88 --
 a/arch/ia64/mm/discontig.c                           |   44 -
 a/arch/ia64/mm/init.c                                |   14 
 a/arch/ia64/mm/numa.c                                |   30 
 a/arch/m68k/Kconfig.cpu                              |   31 
 a/arch/m68k/include/asm/page.h                       |    2 
 a/arch/m68k/include/asm/page_mm.h                    |    7 
 a/arch/m68k/include/asm/virtconvert.h                |    7 
 a/arch/m68k/mm/init.c                                |   10 
 a/arch/mips/vdso/genvdso.c                           |    4 
 a/arch/nds32/mm/mm-nds32.c                           |    6 
 a/arch/powerpc/Kconfig                               |    5 
 a/arch/riscv/Kconfig                                 |    4 
 a/arch/riscv/include/asm/pgtable.h                   |    2 
 a/arch/riscv/include/asm/set_memory.h                |    1 
 a/arch/riscv/mm/pageattr.c                           |   31 
 a/arch/s390/Kconfig                                  |    4 
 a/arch/s390/configs/debug_defconfig                  |    2 
 a/arch/s390/configs/defconfig                        |    2 
 a/arch/s390/kernel/vdso.c                            |   11 
 a/arch/sparc/Kconfig                                 |    4 
 a/arch/sparc/mm/init_64.c                            |    2 
 a/arch/x86/Kconfig                                   |    5 
 a/arch/x86/entry/vdso/vma.c                          |   17 
 a/arch/x86/include/asm/set_memory.h                  |    1 
 a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c          |    2 
 a/arch/x86/kernel/tboot.c                            |    1 
 a/arch/x86/mm/pat/set_memory.c                       |    6 
 a/drivers/base/node.c                                |    2 
 a/drivers/block/zram/Kconfig                         |   42 
 a/drivers/block/zram/zcomp.c                         |    2 
 a/drivers/block/zram/zram_drv.c                      |   29 
 a/drivers/block/zram/zram_drv.h                      |    1 
 a/drivers/dax/device.c                               |    4 
 a/drivers/dax/kmem.c                                 |    2 
 a/drivers/dma-buf/sync_file.c                        |    3 
 a/drivers/edac/ghes_edac.c                           |    4 
 a/drivers/firmware/efi/efi.c                         |    1 
 a/drivers/gpu/drm/drm_atomic.c                       |    3 
 a/drivers/hwtracing/intel_th/msu.c                   |    2 
 a/drivers/ide/falconide.c                            |    2 
 a/drivers/ide/ide-probe.c                            |    3 
 a/drivers/misc/lkdtm/Makefile                        |    1 
 a/drivers/pinctrl/pinctrl-utils.c                    |    2 
 a/drivers/vhost/vringh.c                             |    3 
 a/drivers/virtio/virtio_balloon.c                    |    6 
 a/drivers/xen/unpopulated-alloc.c                    |   14 
 a/fs/aio.c                                           |    5 
 a/fs/ntfs/file.c                                     |    5 
 a/fs/ntfs/inode.c                                    |    2 
 a/fs/ntfs/logfile.c                                  |    3 
 a/fs/ocfs2/cluster/tcp.c                             |    1 
 a/fs/ocfs2/namei.c                                   |    4 
 a/fs/proc/kcore.c                                    |    2 
 a/fs/proc/meminfo.c                                  |    2 
 a/fs/userfaultfd.c                                   |   20 
 a/include/linux/cgroup-defs.h                        |   15 
 a/include/linux/compaction.h                         |   12 
 a/include/linux/fs.h                                 |    2 
 a/include/linux/gfp.h                                |    2 
 a/include/linux/highmem.h                            |   19 
 a/include/linux/huge_mm.h                            |   93 --
 a/include/linux/memcontrol.h                         |  148 ---
 a/include/linux/migrate.h                            |    4 
 a/include/linux/mm.h                                 |  118 +-
 a/include/linux/mm_types.h                           |    8 
 a/include/linux/mmap_lock.h                          |   94 ++
 a/include/linux/mmzone.h                             |   50 -
 a/include/linux/page-flags.h                         |    6 
 a/include/linux/page_ext.h                           |    8 
 a/include/linux/pagevec.h                            |    3 
 a/include/linux/poison.h                             |    4 
 a/include/linux/rmap.h                               |    1 
 a/include/linux/sched/mm.h                           |   16 
 a/include/linux/set_memory.h                         |    5 
 a/include/linux/shmem_fs.h                           |    6 
 a/include/linux/slab.h                               |   18 
 a/include/linux/vmalloc.h                            |    8 
 a/include/linux/vmstat.h                             |  104 ++
 a/include/trace/events/sched.h                       |   84 +
 a/include/uapi/linux/const.h                         |    5 
 a/include/uapi/linux/ethtool.h                       |    2 
 a/include/uapi/linux/kernel.h                        |    9 
 a/include/uapi/linux/lightnvm.h                      |    2 
 a/include/uapi/linux/mroute6.h                       |    2 
 a/include/uapi/linux/netfilter/x_tables.h            |    2 
 a/include/uapi/linux/netlink.h                       |    2 
 a/include/uapi/linux/sysctl.h                        |    2 
 a/include/uapi/linux/userfaultfd.h                   |    9 
 a/init/main.c                                        |    6 
 a/ipc/shm.c                                          |    8 
 a/kernel/cgroup/cgroup.c                             |   12 
 a/kernel/fork.c                                      |    3 
 a/kernel/kthread.c                                   |   29 
 a/kernel/power/hibernate.c                           |    2 
 a/kernel/power/power.h                               |    2 
 a/kernel/power/snapshot.c                            |   52 +
 a/kernel/ptrace.c                                    |    2 
 a/kernel/workqueue.c                                 |    3 
 a/lib/locking-selftest.c                             |   47 +
 a/lib/test_kasan_module.c                            |   29 
 a/mm/Kconfig                                         |   25 
 a/mm/Kconfig.debug                                   |   28 
 a/mm/Makefile                                        |    4 
 a/mm/backing-dev.c                                   |    8 
 a/mm/cma.c                                           |    6 
 a/mm/compaction.c                                    |   29 
 a/mm/filemap.c                                       |  823 ++++++++++---------
 a/mm/gup.c                                           |  329 ++-----
 a/mm/gup_benchmark.c                                 |  210 ----
 a/mm/gup_test.c                                      |  299 ++++++
 a/mm/gup_test.h                                      |   40 
 a/mm/highmem.c                                       |   52 +
 a/mm/huge_memory.c                                   |   86 +
 a/mm/hugetlb.c                                       |   28 
 a/mm/init-mm.c                                       |    1 
 a/mm/internal.h                                      |    5 
 a/mm/kasan/generic.c                                 |    3 
 a/mm/kasan/report.c                                  |    4 
 a/mm/khugepaged.c                                    |   58 -
 a/mm/ksm.c                                           |   50 -
 a/mm/madvise.c                                       |   14 
 a/mm/mapping_dirty_helpers.c                         |    6 
 a/mm/memblock.c                                      |   80 +
 a/mm/memcontrol.c                                    |  170 +--
 a/mm/memory-failure.c                                |  322 +++----
 a/mm/memory.c                                        |   24 
 a/mm/memory_hotplug.c                                |   44 -
 a/mm/mempolicy.c                                     |    8 
 a/mm/migrate.c                                       |  183 ++--
 a/mm/mm_init.c                                       |    1 
 a/mm/mmap.c                                          |   22 
 a/mm/mmap_lock.c                                     |  230 +++++
 a/mm/mmu_notifier.c                                  |    7 
 a/mm/mmzone.c                                        |   14 
 a/mm/mremap.c                                        |  282 ++++--
 a/mm/nommu.c                                         |    8 
 a/mm/oom_kill.c                                      |   14 
 a/mm/page_alloc.c                                    |  517 ++++++-----
 a/mm/page_counter.c                                  |    4 
 a/mm/page_ext.c                                      |   10 
 a/mm/page_isolation.c                                |   18 
 a/mm/page_owner.c                                    |   17 
 a/mm/page_poison.c                                   |   56 -
 a/mm/page_vma_mapped.c                               |    9 
 a/mm/process_vm_access.c                             |    2 
 a/mm/rmap.c                                          |    9 
 a/mm/shmem.c                                         |   39 
 a/mm/slab.c                                          |   10 
 a/mm/slab.h                                          |    9 
 a/mm/slab_common.c                                   |   10 
 a/mm/slob.c                                          |    6 
 a/mm/slub.c                                          |  156 +--
 a/mm/swap.c                                          |   12 
 a/mm/swap_state.c                                    |    7 
 a/mm/swapfile.c                                      |   14 
 a/mm/truncate.c                                      |   18 
 a/mm/vmalloc.c                                       |  105 +-
 a/mm/vmscan.c                                        |   21 
 a/mm/vmstat.c                                        |    6 
 a/mm/workingset.c                                    |    8 
 a/mm/z3fold.c                                        |  215 ++--
 a/mm/zsmalloc.c                                      |   11 
 a/mm/zswap.c                                         |  193 +++-
 a/sound/core/pcm_lib.c                               |    4 
 a/tools/include/linux/poison.h                       |    6 
 a/tools/testing/selftests/vm/.gitignore              |    4 
 a/tools/testing/selftests/vm/Makefile                |   41 
 a/tools/testing/selftests/vm/check_config.sh         |   31 
 a/tools/testing/selftests/vm/config                  |    2 
 a/tools/testing/selftests/vm/gup_benchmark.c         |  143 ---
 a/tools/testing/selftests/vm/gup_test.c              |  258 +++++
 a/tools/testing/selftests/vm/hmm-tests.c             |   10 
 a/tools/testing/selftests/vm/mremap_test.c           |  344 +++++++
 a/tools/testing/selftests/vm/run_vmtests             |   51 -
 a/tools/testing/selftests/vm/userfaultfd.c           |   94 --
 217 files changed, 4817 insertions(+), 3369 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-12-11 21:35 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c.

Subsystems affected by this patch series:

  mm/pagecache
  proc
  selftests
  kbuild
  mm/kasan
  mm/hugetlb

Subsystem: mm/pagecache

    Andrew Morton <akpm@linux-foundation.org>:
      revert "mm/filemap: add static for function __add_to_page_cache_locked"

Subsystem: proc

    Miles Chen <miles.chen@mediatek.com>:
      proc: use untagged_addr() for pagemap_read addresses

Subsystem: selftests

    Arnd Bergmann <arnd@arndb.de>:
      selftest/fpu: avoid clang warning

Subsystem: kbuild

    Arnd Bergmann <arnd@arndb.de>:
      kbuild: avoid static_assert for genksyms
      initramfs: fix clang build failure
      elfcore: fix building with clang

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      kasan: fix object remaining in offline per-cpu quarantine

Subsystem: mm/hugetlb

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/hugetlb: clear compound_nr before freeing gigantic pages

 fs/proc/task_mmu.c        |    8 ++++++--
 include/linux/build_bug.h |    5 +++++
 include/linux/elfcore.h   |   22 ++++++++++++++++++++++
 init/initramfs.c          |    2 +-
 kernel/Makefile           |    1 -
 kernel/elfcore.c          |   26 --------------------------
 lib/Makefile              |    3 ++-
 mm/filemap.c              |    2 +-
 mm/hugetlb.c              |    1 +
 mm/kasan/quarantine.c     |   39 +++++++++++++++++++++++++++++++++++++++
 10 files changed, 77 insertions(+), 32 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-12-06  6:14 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-12-06  6:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59.

Subsystems affected by this patch series:

  lib
  coredump
  mm/memcg
  mm/zsmalloc
  mm/swap
  mailmap
  mm/selftests
  mm/pagecache
  mm/hugetlb
  mm/pagemap

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      zlib: export S390 symbols for zlib modules

Subsystem: coredump

    Menglong Dong <dong.menglong@zte.com.cn>:
      coredump: fix core_pattern parse error

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: fix obj_cgroup_charge() return value handling

    Yang Shi <shy828301@gmail.com>:
      mm: list_lru: set shrinker map bit when child nr_items is not zero

Subsystem: mm/zsmalloc

    Minchan Kim <minchan@kernel.org>:
      mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING

Subsystem: mm/swap

    Qian Cai <qcai@redhat.com>:
      mm/swapfile: do not sleep with a spin lock held

Subsystem: mailmap

    Uwe Kleine-König <u.kleine-koenig@pengutronix.de>:
      mailmap: add two more addresses of Uwe Kleine-König

Subsystem: mm/selftests

    Xingxing Su <suxingxing@loongson.cn>:
      tools/testing/selftests/vm: fix build error

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: selftests: fix SIGSEGV if huge mmap fails

Subsystem: mm/pagecache

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/filemap: add static for function __add_to_page_cache_locked

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb_cgroup: fix offline of hugetlb cgroup with reservations

Subsystem: mm/pagemap

    Liu Zixian <liuzixian4@huawei.com>:
      mm/mmap.c: fix mmap return value when vma is merged after call_mmap()

 .mailmap                                 |    2 +
 arch/arm/configs/omap2plus_defconfig     |    1 
 fs/coredump.c                            |    3 +
 include/linux/zsmalloc.h                 |    1 
 lib/zlib_dfltcc/dfltcc_inflate.c         |    3 +
 mm/Kconfig                               |   13 -------
 mm/filemap.c                             |    2 -
 mm/hugetlb_cgroup.c                      |    8 +---
 mm/list_lru.c                            |   10 ++---
 mm/mmap.c                                |   26 ++++++--------
 mm/slab.h                                |   40 +++++++++++++---------
 mm/swapfile.c                            |    4 +-
 mm/zsmalloc.c                            |   54 -------------------------------
 tools/testing/selftests/vm/Makefile      |    4 ++
 tools/testing/selftests/vm/userfaultfd.c |   25 +++++++++-----
 15 files changed, 75 insertions(+), 121 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-11-22  6:16 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-11-22  6:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95.

Subsystems affected by this patch series:

  mm/madvise
  kbuild
  mm/pagemap
  mm/readahead
  mm/memcg
  mm/userfaultfd
  vfs-akpm
  mm/madvise

Subsystem: mm/madvise

    Eric Dumazet <edumazet@google.com>:
      mm/madvise: fix memory leak from process_madvise

Subsystem: kbuild

    Nick Desaulniers <ndesaulniers@google.com>:
      compiler-clang: remove version check for BPF Tracing

Subsystem: mm/pagemap

    Dan Williams <dan.j.williams@intel.com>:
      mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports

Subsystem: mm/readahead

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix readahead_page_batch for retry entries

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix root memcg vmstats

Subsystem: mm/userfaultfd

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault()

Subsystem: vfs-akpm

    Yicong Yang <yangyicong@hisilicon.com>:
      libfs: fix error cast of negative value in simple_attr_write()

Subsystem: mm/madvise

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix madvise WILLNEED performance problem

 arch/ia64/include/asm/sparsemem.h    |    6 ++++++
 arch/powerpc/include/asm/mmzone.h    |    5 +++++
 arch/powerpc/include/asm/sparsemem.h |    5 ++---
 arch/powerpc/mm/mem.c                |    1 +
 arch/x86/include/asm/sparsemem.h     |   10 ++++++++++
 arch/x86/mm/numa.c                   |    2 ++
 drivers/dax/Kconfig                  |    1 -
 fs/libfs.c                           |    6 ++++--
 include/linux/compiler-clang.h       |    2 ++
 include/linux/memory_hotplug.h       |   14 --------------
 include/linux/numa.h                 |   30 +++++++++++++++++++++++++++++-
 include/linux/pagemap.h              |    2 ++
 mm/huge_memory.c                     |    9 ++++-----
 mm/madvise.c                         |    4 +---
 mm/memcontrol.c                      |    9 +++++++--
 mm/memory_hotplug.c                  |   18 ------------------
 16 files changed, 75 insertions(+), 49 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-11-14  6:51 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-11-14  6:51 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81.

Subsystems affected by this patch series:

  mm/migration
  mm/vmscan
  mailmap
  mm/slub
  mm/gup
  kbuild
  reboot
  kernel/watchdog
  mm/memcg
  mm/hugetlbfs
  panic
  ocfs2

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm/compaction: count pages and stop correctly during page isolation
      mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate

Subsystem: mm/vmscan

    Nicholas Piggin <npiggin@gmail.com>:
      mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit

Subsystem: mailmap

    Dmitry Baryshkov <dbaryshkov@gmail.com>:
      mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov

Subsystem: mm/slub

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm/slub: fix panic in slab_alloc_node()

Subsystem: mm/gup

    Jason Gunthorpe <jgg@nvidia.com>:
      mm/gup: use unpin_user_pages() in __gup_longterm_locked()

Subsystem: kbuild

    Arvind Sankar <nivedita@alum.mit.edu>:
      compiler.h: fix barrier_data() on clang

Subsystem: reboot

    Matteo Croce <mcroce@microsoft.com>:
    Patch series "fix parsing of reboot= cmdline", v3:
      Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint"
      reboot: fix overflow parsing reboot cpu number

Subsystem: kernel/watchdog

    Santosh Sivaraj <santosh@fossix.org>:
      kernel/watchdog: fix watchdog_allowed_mask not used warning

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix missing wakeup polling thread

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: fix anon huge page migration race

Subsystem: panic

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      panic: don't dump stack twice on warn

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: initialize ip_next_orphan

 .mailmap                       |    5 +-
 fs/ocfs2/super.c               |    1 
 include/asm-generic/barrier.h  |    1 
 include/linux/compiler-clang.h |    6 --
 include/linux/compiler-gcc.h   |   19 --------
 include/linux/compiler.h       |   18 +++++++-
 include/linux/memcontrol.h     |   11 ++++-
 kernel/panic.c                 |    3 -
 kernel/reboot.c                |   28 ++++++------
 kernel/watchdog.c              |    4 -
 mm/compaction.c                |   12 +++--
 mm/gup.c                       |   14 ++++--
 mm/hugetlb.c                   |   90 ++---------------------------------------
 mm/memory-failure.c            |   36 +++++++---------
 mm/migrate.c                   |   46 +++++++++++---------
 mm/rmap.c                      |    5 --
 mm/slub.c                      |    2 
 mm/vmscan.c                    |    5 +-
 18 files changed, 119 insertions(+), 187 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-11-02  1:06 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-11-02  1:06 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891.

Subsystems affected by this patch series:

  mm/memremap
  mm/memcg
  mm/slab-generic
  mm/kasan
  mm/mempolicy
  signals
  lib
  mm/pagecache
  kthread
  mm/oom-kill
  mm/pagemap
  epoll
  core-kernel

Subsystem: mm/memremap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/mremap_pages: fix static key devmap_managed_key updates

Subsystem: mm/memcg

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb_cgroup: fix reservation accounting

    zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
      mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg: link page counters to root if use_hierarchy is false

Subsystem: mm/slab-generic

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: adopt KUNIT tests to SW_TAGS mode

Subsystem: mm/mempolicy

    Shijie Luo <luoshijie1@huawei.com>:
      mm: mempolicy: fix potential pte_unmap_unlock pte error

Subsystem: signals

    Oleg Nesterov <oleg@redhat.com>:
      ptrace: fix task_join_group_stop() for the case when current is traced

Subsystem: lib

    Vasily Gorbik <gor@linux.ibm.com>:
      lib/crc32test: remove extra local_irq_disable/enable

Subsystem: mm/pagecache

    Jason Yan <yanaijie@huawei.com>:
      mm/truncate.c: make __invalidate_mapping_pages() static

Subsystem: kthread

    Zqiang <qiang.zhang@windriver.com>:
      kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled

Subsystem: mm/oom-kill

    Charles Haithcock <chaithco@redhat.com>:
      mm, oom: keep oom_adj under or at upper limit when printing

Subsystem: mm/pagemap

    Jason Gunthorpe <jgg@nvidia.com>:
      mm: always have io_remap_pfn_range() set pgprot_decrypted()

Subsystem: epoll

    Soheil Hassas Yeganeh <soheil@google.com>:
      epoll: check ep_events_available() upon timeout
      epoll: add a selftest for epoll timeout race

Subsystem: core-kernel

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      kernel/hung_task.c: make type annotations consistent

 fs/eventpoll.c                                                |   16 +
 fs/proc/base.c                                                |    2 
 include/linux/mm.h                                            |    9 
 include/linux/pgtable.h                                       |    4 
 kernel/hung_task.c                                            |    3 
 kernel/kthread.c                                              |    3 
 kernel/signal.c                                               |   19 -
 lib/crc32test.c                                               |    4 
 lib/test_kasan.c                                              |  149 +++++++---
 mm/hugetlb.c                                                  |   20 -
 mm/memcontrol.c                                               |   25 +
 mm/mempolicy.c                                                |    6 
 mm/memremap.c                                                 |   39 +-
 mm/truncate.c                                                 |    2 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   95 ++++++
 15 files changed, 290 insertions(+), 106 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-10-17 23:13 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53.

Subsystems affected by this patch series:

  ia64
  mm/memcg
  mm/migration
  mm/pagemap
  mm/gup
  mm/madvise
  mm/vmalloc
  misc

Subsystem: ia64

    Krzysztof Kozlowski <krzk@kernel.org>:
      ia64: fix build error with !COREDUMP

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm, memcg: rework remote charging API to support nesting
    Patch series "mm: kmem: kernel memory accounting in an interrupt context":
      mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current()
      mm: kmem: remove redundant checks from get_obj_cgroup_from_current()
      mm: kmem: prepare remote memcg charging infra for interrupt contexts
      mm: kmem: enable kernel memcg accounting from interrupt contexts

Subsystem: mm/migration

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/memory-failure: remove a wrapper for alloc_migration_target()
      mm/memory_hotplug: remove a wrapper for alloc_migration_target()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/migrate: avoid possible unnecessary process right check in kernel_move_pages()

Subsystem: mm/pagemap

    "Liam R. Howlett" <Liam.Howlett@Oracle.com>:
      mm/mmap: add inline vma_next() for readability of mmap code
      mm/mmap: add inline munmap_vma_range() for code readability

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mm/gup_benchmark: take the mmap lock around GUP
      binfmt_elf: take the mmap lock around find_extend_vma()
      mm/gup: assert that the mmap lock is held in __get_user_pages()

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2:
      mm/gup_benchmark: rename to mm/gup_test
      selftests/vm: use a common gup_test.h
      selftests/vm: rename run_vmtests --> run_vmtests.sh
      selftests/vm: minor cleanup: Makefile and gup_test.c
      selftests/vm: only some gup_test items are really benchmarks
      selftests/vm: gup_test: introduce the dump_pages() sub-test
      selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
      selftests/vm: hmm-tests: remove the libhugetlbfs dependency
      selftests/vm: 10x speedup for hmm-tests

Subsystem: mm/madvise

    Minchan Kim <minchan@kernel.org>:
    Patch series "introduce memory hinting API for external process", v9:
      mm/madvise: pass mm to do_madvise
      pid: move pidfd_get_pid() to pid.c
      mm/madvise: introduce process_madvise() syscall: an external memory hinting API

Subsystem: mm/vmalloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "remove alloc_vm_area", v4:
      mm: update the documentation for vfree

    Christoph Hellwig <hch@lst.de>:
      mm: add a VM_MAP_PUT_PAGES flag for vmap
      mm: add a vmap_pfn function
      mm: allow a NULL fn callback in apply_to_page_range
      zsmalloc: switch from alloc_vm_area to get_vm_area
      drm/i915: use vmap in shmem_pin_map
      drm/i915: stop using kmap in i915_gem_object_map
      drm/i915: use vmap in i915_gem_object_map
      xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv
      x86/xen: open code alloc_vm_area in arch_gnttab_valloc
      mm: remove alloc_vm_area
    Patch series "two small vmalloc cleanups":
      mm: cleanup the gfp_mask handling in __vmalloc_area_node
      mm: remove the filename in the top of file comment in vmalloc.c

Subsystem: misc

    Tian Tao <tiantao6@hisilicon.com>:
      mm: remove duplicate include statement in mmu.c

 Documentation/core-api/pin_user_pages.rst   |    8 
 arch/alpha/kernel/syscalls/syscall.tbl      |    1 
 arch/arm/mm/mmu.c                           |    1 
 arch/arm/tools/syscall.tbl                  |    1 
 arch/arm64/include/asm/unistd.h             |    2 
 arch/arm64/include/asm/unistd32.h           |    2 
 arch/ia64/kernel/Makefile                   |    2 
 arch/ia64/kernel/syscalls/syscall.tbl       |    1 
 arch/m68k/kernel/syscalls/syscall.tbl       |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl   |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl   |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl   |    1 
 arch/parisc/kernel/syscalls/syscall.tbl     |    1 
 arch/powerpc/kernel/syscalls/syscall.tbl    |    1 
 arch/s390/configs/debug_defconfig           |    2 
 arch/s390/configs/defconfig                 |    2 
 arch/s390/kernel/syscalls/syscall.tbl       |    1 
 arch/sh/kernel/syscalls/syscall.tbl         |    1 
 arch/sparc/kernel/syscalls/syscall.tbl      |    1 
 arch/x86/entry/syscalls/syscall_32.tbl      |    1 
 arch/x86/entry/syscalls/syscall_64.tbl      |    1 
 arch/x86/xen/grant-table.c                  |   27 +-
 arch/xtensa/kernel/syscalls/syscall.tbl     |    1 
 drivers/gpu/drm/i915/Kconfig                |    1 
 drivers/gpu/drm/i915/gem/i915_gem_pages.c   |  136 ++++------
 drivers/gpu/drm/i915/gt/shmem_utils.c       |   78 +-----
 drivers/xen/xenbus/xenbus_client.c          |   30 +-
 fs/binfmt_elf.c                             |    3 
 fs/buffer.c                                 |    6 
 fs/io_uring.c                               |    2 
 fs/notify/fanotify/fanotify.c               |    5 
 fs/notify/inotify/inotify_fsnotify.c        |    5 
 include/linux/memcontrol.h                  |   12 
 include/linux/mm.h                          |    2 
 include/linux/pid.h                         |    1 
 include/linux/sched/mm.h                    |   43 +--
 include/linux/syscalls.h                    |    2 
 include/linux/vmalloc.h                     |    7 
 include/uapi/asm-generic/unistd.h           |    4 
 kernel/exit.c                               |   19 -
 kernel/pid.c                                |   19 +
 kernel/sys_ni.c                             |    1 
 mm/Kconfig                                  |   24 +
 mm/Makefile                                 |    2 
 mm/gup.c                                    |    2 
 mm/gup_benchmark.c                          |  225 ------------------
 mm/gup_test.c                               |  295 +++++++++++++++++++++--
 mm/gup_test.h                               |   40 ++-
 mm/madvise.c                                |  125 ++++++++--
 mm/memcontrol.c                             |   83 ++++--
 mm/memory-failure.c                         |   18 -
 mm/memory.c                                 |   16 -
 mm/memory_hotplug.c                         |   46 +--
 mm/migrate.c                                |   71 +++--
 mm/mmap.c                                   |   74 ++++-
 mm/nommu.c                                  |    7 
 mm/percpu.c                                 |    3 
 mm/slab.h                                   |    3 
 mm/vmalloc.c                                |  147 +++++------
 mm/zsmalloc.c                               |   10 
 tools/testing/selftests/vm/.gitignore       |    3 
 tools/testing/selftests/vm/Makefile         |   40 ++-
 tools/testing/selftests/vm/check_config.sh  |   31 ++
 tools/testing/selftests/vm/config           |    2 
 tools/testing/selftests/vm/gup_benchmark.c  |  143 -----------
 tools/testing/selftests/vm/gup_test.c       |  260 ++++++++++++++++++--
 tools/testing/selftests/vm/hmm-tests.c      |   12 
 tools/testing/selftests/vm/run_vmtests      |  334 --------------------------
 tools/testing/selftests/vm/run_vmtests.sh   |  350 +++++++++++++++++++++++++++-
 70 files changed, 1580 insertions(+), 1224 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-10-16  2:40 incoming Andrew Morton
@ 2020-10-16  3:03 ` Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-10-16  3:03 UTC (permalink / raw)
  To: Linus Torvalds, mm-commits, linux-mm

And... I forgot to set in-reply-to :(

Shall resend, omitting linux-mm.


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-10-16  2:40 Andrew Morton
  2020-10-16  3:03 ` incoming Andrew Morton
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2020-10-16  2:40 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- most of the rest of mm/

- various other subsystems

156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d.

Subsystems affected by this patch series:

  mm/dax
  mm/debug
  mm/thp
  mm/readahead
  mm/page-poison
  mm/util
  mm/memory-hotplug
  mm/zram
  mm/cleanups
  misc
  core-kernel
  get_maintainer
  MAINTAINERS
  lib
  bitops
  checkpatch
  binfmt
  ramfs
  autofs
  nilfs
  rapidio
  panic
  relay
  kgdb
  ubsan
  romfs
  fault-injection

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
      device-dax/kmem: fix resource release

Subsystem: mm/debug

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mm/debug_vm_pgtable fixes", v4:
      powerpc/mm: add DEBUG_VM WARN for pmd_clear
      powerpc/mm: move setting pte specific flags to pfn_pte
      mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value
      mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support.
      mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING
      mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at
      mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry
      mm/debug_vm_pgtable/locks: move non page table modifying test together
      mm/debug_vm_pgtable/locks: take correct page table lock
      mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP
      mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries
      mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64
      mm/debug_vm_pgtable: avoid none pte in pte_clear_test
      mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped.

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Fix read-only THP for non-tmpfs filesystems":
      XArray: add xa_get_order
      XArray: add xas_split
      mm/filemap: fix storing to a THP shadow entry
    Patch series "Remove assumptions of THP size":
      mm/filemap: fix page cache removal for arbitrary sized THPs
      mm/memory: remove page fault assumption of compound page size
      mm/page_owner: change split_page_owner to take a count

    "Kirill A. Shutemov" <kirill@shutemov.name>:
      mm/huge_memory: fix total_mapcount assumption of page size
      mm/huge_memory: fix split assumption of page size

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size
      mm/huge_memory: fix can_split_huge_page assumption of THP size
      mm/rmap: fix assumptions of THP size
      mm/truncate: fix truncation for pages of arbitrary size
      mm/page-writeback: support tail pages in wait_for_stable_page
      mm/vmscan: allow arbitrary sized pages to be paged out
      fs: add a filesystem flag for THPs
      fs: do not update nr_thps for mappings which support THPs

    Huang Ying <ying.huang@intel.com>:
      mm: fix a race during THP splitting

Subsystem: mm/readahead

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Readahead patches for 5.9/5.10":
      mm/readahead: add DEFINE_READAHEAD
      mm/readahead: make page_cache_ra_unbounded take a readahead_control
      mm/readahead: make do_page_cache_ra take a readahead_control

    David Howells <dhowells@redhat.com>:
      mm/readahead: make ondemand_readahead take a readahead_control
      mm/readahead: pass readahead_control to force_page_cache_ra

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/readahead: add page_cache_sync_ra and page_cache_async_ra

    David Howells <dhowells@redhat.com>:
      mm/filemap: fold ra_submit into do_sync_mmap_readahead
      mm/readahead: pass a file_ra_state into force_page_cache_ra

Subsystem: mm/page-poison

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
    Patch series "HWPOISON: soft offline rework", v7:
      mm,hwpoison: cleanup unused PageHuge() check
      mm, hwpoison: remove recalculating hpage
      mm,hwpoison-inject: don't pin for hwpoison_filter

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: unexport get_hwpoison_page and make it static
      mm,hwpoison: refactor madvise_inject_error
      mm,hwpoison: kill put_hwpoison_page
      mm,hwpoison: unify THP handling for hard and soft offline
      mm,hwpoison: rework soft offline for free pages
      mm,hwpoison: rework soft offline for in-use pages
      mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page
      mm,hwpoison: return 0 if the page is already poisoned in soft-offline

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: introduce MF_MSG_UNSPLIT_THP
      mm,hwpoison: double-check page count in __get_any_page()

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: try to narrow window race for free pages

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/page_poison.c: replace bool variable with static key

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmstat.c: use helper macro abs()

Subsystem: mm/util

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
      mm/util.c: update the kerneldoc for kstrdup_const()

    Jann Horn <jannh@google.com>:
      mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2:
      mm/memory_hotplug: inline __offline_pages() into offline_pages()
      mm/memory_hotplug: enforce section granularity when onlining/offlining
      mm/memory_hotplug: simplify page offlining
      mm/page_alloc: simplify __offline_isolated_pages()
      mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages()
      mm/page_isolation: simplify return value of start_isolate_page_range()
      mm/memory_hotplug: simplify page onlining
      mm/page_alloc: drop stale pageblock comment in memmap_init_zone*()
      mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone()
      mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory
    Patch series "selective merging of system ram resources", v4:
      kernel/resource: make release_mem_region_adjustable() never fail
      kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED
      mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG
      mm/memory_hotplug: prepare passing flags to add_memory() and friends
      mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources
      virtio-mem: try to merge system ram resources
      xen/balloon: try to merge system ram resources
      hv_balloon: try to merge system ram resources
      kernel/resource: make iomem_resource implicit in release_mem_region_adjustable()

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm: don't panic when links can't be created in sysfs

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2:
      mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag
      mm/page_alloc: place pages to tail in __putback_isolated_page()
      mm/page_alloc: move pages to tail in move_to_free_list()
      mm/page_alloc: place pages to tail in __free_pages_core()
      mm/memory_hotplug: update comment regarding zone shuffling

Subsystem: mm/zram

    Douglas Anderson <dianders@chromium.org>:
      zram: failing to decompress is WARN_ON worthy

Subsystem: mm/cleanups

    YueHaibing <yuehaibing@huawei.com>:
      mm/slab.h: remove duplicate include

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/page_reporting.c: drop stale list head check in page_reporting_cycle

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem.c: clean up endif comments

    Yu Zhao <yuzhao@google.com>:
      mm: use self-explanatory macros rather than "2"

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: fix some broken comments

    Chen Tao <chentao3@hotmail.com>:
      mm: fix some comments formatting

    Xiaofei Tan <tanxiaofei@huawei.com>:
      mm/workingset.c: fix some doc warnings

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: use helper function put_write_access()

    Mike Rapoport <rppt@linux.ibm.com>:
      include/linux/mmzone.h: remove unused early_pfn_valid()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: rename page_order() to buddy_order()

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      fs: configfs: delete repeated words in comments

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out min()/max() et al. helpers

Subsystem: core-kernel

    Liao Pingfang <liao.pingfang@zte.com.cn>:
      kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map()

    Randy Dunlap <rdunlap@infradead.org>:
      kernel/: fix repeated words in comments
      kernel: acct.c: fix some kernel-doc nits

Subsystem: get_maintainer

    Joe Perches <joe@perches.com>:
      get_maintainer: add test for file in VCS

Subsystem: MAINTAINERS

    Joe Perches <joe@perches.com>:
      get_maintainer: exclude MAINTAINERS file(s) from --git-fallback

    Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>:
      MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: bitmap: delete duplicated words
      lib: libcrc32c: delete duplicated words
      lib: decompress_bunzip2: delete duplicated words
      lib: dynamic_queue_limits: delete duplicated words + fix typo
      lib: earlycpio: delete duplicated words
      lib: radix-tree: delete duplicated words
      lib: syscall: delete duplicated words
      lib: test_sysctl: delete duplicated words
      lib/mpi/mpi-bit.c: fix spello of "functions"

    Stephen Boyd <swboyd@chromium.org>:
      lib/idr.c: document calling context for IDA APIs mustn't use locks
      lib/idr.c: document that ida_simple_{get,remove}() are deprecated

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      lib/scatterlist.c: avoid a double memset

    Miaohe Lin <linmiaohe@huawei.com>:
      lib/percpu_counter.c: use helper macro abs()

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/list.h: add a macro to test if entry is pointing to the head

    Dan Carpenter <dan.carpenter@oracle.com>:
      lib/test_hmm.c: fix an error code in dmirror_allocate_chunk()

    Tobias Jordan <kernel@cdqe.de>:
      lib/crc32.c: fix trivial typo in preprocessor condition

Subsystem: bitops

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      bitops: simplify get_count_order_long()
      bitops: use the same mechanism for get_count_order[_long]

Subsystem: checkpatch

    Jerome Forissier <jerome@forissier.org>:
      checkpatch: add --kconfig-prefix

    Joe Perches <joe@perches.com>:
      checkpatch: move repeated word test
      checkpatch: add test for comma use that should be semicolon

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add phy_ops

    Nicolas Boichat <drinkcat@chromium.org>:
      checkpatch: warn if trace_printk and friends are called

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add pinctrl_ops and pinmux_ops

    Joe Perches <joe@perches.com>:
      checkpatch: warn on self-assignments
      checkpatch: allow not using -f with files that are in git

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: extend author Signed-off-by check for split From: header

    Joe Perches <joe@perches.com>:
      checkpatch: emit a warning on embedded filenames

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: fix multi-statement macro checks for while blocks.

    Łukasz Stelmach <l.stelmach@samsung.com>:
      checkpatch: fix false positive on empty block comment lines

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add new warnings to author signoff checks.

Subsystem: binfmt

    Chris Kennelly <ckennelly@google.com>:
    Patch series "Selecting Load Addresses According to p_align", v3:
      fs/binfmt_elf: use PT_LOAD p_align values for suitable start address
      tools/testing/selftests: add self-test for verifying load alignment

    Jann Horn <jannh@google.com>:
    Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5:
      binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU
      coredump: let dump_emit() bail out on short writes
      coredump: refactor page range dumping into common helper
      coredump: rework elf/elf_fdpic vma_dump_size() into common helper
      binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot
      mm/gup: take mmap_lock in get_dump_page()
      mm: remove the now-unnecessary mmget_still_valid() hack

Subsystem: ramfs

    Matthew Wilcox (Oracle) <willy@infradead.org>:
      ramfs: fix nommu mmap with gaps in the page cache

Subsystem: autofs

    Matthew Wilcox <willy@infradead.org>:
      autofs: harden ioctl table

Subsystem: nilfs

    Wang Hai <wanghai38@huawei.com>:
      nilfs2: fix some kernel-doc warnings for nilfs2

Subsystem: rapidio

    Souptick Joarder <jrdr.linux@gmail.com>:
      rapidio: fix error handling path

    Jing Xiangfeng <jingxiangfeng@huawei.com>:
      rapidio: fix the missed put_device() for rio_mport_add_riodev

Subsystem: panic

    Alexey Kardashevskiy <aik@ozlabs.ru>:
      panic: dump registers on panic_on_warn

Subsystem: relay

    Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
      kernel/relay.c: drop unneeded initialization

Subsystem: kgdb

    Ritesh Harjani <riteshh@linux.ibm.com>:
      scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command
      scripts/gdb/tasks: add headers and improve spacing format

Subsystem: ubsan

    Elena Petrova <lenaptr@google.com>:
      sched.h: drop in_ubsan field when UBSAN is in trap mode

    George Popescu <georgepope@android.com>:
      ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang

Subsystem: romfs

    Libing Zhou <libing.zhou@nokia-sbell.com>:
      ROMFS: support inode blocks calculation

Subsystem: fault-injection

    Albert van der Linde <alinde@google.com>:
    Patch series "add fault injection to user memory access", v3:
      lib, include/linux: add usercopy failure capability
      lib, uaccess: add failure injection to usercopy functions

 .mailmap                                          |    1 
 Documentation/admin-guide/kernel-parameters.txt   |    1 
 Documentation/core-api/xarray.rst                 |   14 
 Documentation/fault-injection/fault-injection.rst |    7 
 MAINTAINERS                                       |    6 
 arch/ia64/mm/init.c                               |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h      |   29 +
 arch/powerpc/include/asm/nohash/pgtable.h         |    5 
 arch/powerpc/mm/pgtable.c                         |    5 
 arch/powerpc/platforms/powernv/memtrace.c         |    2 
 arch/powerpc/platforms/pseries/hotplug-memory.c   |    2 
 drivers/acpi/acpi_memhotplug.c                    |    3 
 drivers/base/memory.c                             |    3 
 drivers/base/node.c                               |   33 +-
 drivers/block/zram/zram_drv.c                     |    2 
 drivers/dax/kmem.c                                |   50 ++-
 drivers/hv/hv_balloon.c                           |    4 
 drivers/infiniband/core/uverbs_main.c             |    3 
 drivers/rapidio/devices/rio_mport_cdev.c          |   18 -
 drivers/s390/char/sclp_cmd.c                      |    2 
 drivers/vfio/pci/vfio_pci.c                       |   38 +-
 drivers/virtio/virtio_mem.c                       |    5 
 drivers/xen/balloon.c                             |    4 
 fs/autofs/dev-ioctl.c                             |    8 
 fs/binfmt_elf.c                                   |  267 +++-------------
 fs/binfmt_elf_fdpic.c                             |  176 ++--------
 fs/configfs/dir.c                                 |    2 
 fs/configfs/file.c                                |    2 
 fs/coredump.c                                     |  238 +++++++++++++-
 fs/ext4/verity.c                                  |    4 
 fs/f2fs/verity.c                                  |    4 
 fs/inode.c                                        |    2 
 fs/nilfs2/bmap.c                                  |    2 
 fs/nilfs2/cpfile.c                                |    6 
 fs/nilfs2/page.c                                  |    1 
 fs/nilfs2/sufile.c                                |    4 
 fs/proc/task_mmu.c                                |   18 -
 fs/ramfs/file-nommu.c                             |    2 
 fs/romfs/super.c                                  |    1 
 fs/userfaultfd.c                                  |   28 -
 include/linux/bitops.h                            |   13 
 include/linux/blkdev.h                            |    1 
 include/linux/bvec.h                              |    6 
 include/linux/coredump.h                          |   13 
 include/linux/fault-inject-usercopy.h             |   22 +
 include/linux/fs.h                                |   28 -
 include/linux/idr.h                               |   13 
 include/linux/ioport.h                            |   15 
 include/linux/jiffies.h                           |    3 
 include/linux/kernel.h                            |  150 ---------
 include/linux/list.h                              |   29 +
 include/linux/memory_hotplug.h                    |   42 +-
 include/linux/minmax.h                            |  153 +++++++++
 include/linux/mm.h                                |    5 
 include/linux/mmzone.h                            |   17 -
 include/linux/node.h                              |   16 
 include/linux/nodemask.h                          |    2 
 include/linux/page-flags.h                        |    6 
 include/linux/page_owner.h                        |    6 
 include/linux/pagemap.h                           |  111 ++++++
 include/linux/sched.h                             |    2 
 include/linux/sched/mm.h                          |   25 -
 include/linux/uaccess.h                           |   12 
 include/linux/vmstat.h                            |    2 
 include/linux/xarray.h                            |   22 +
 include/ras/ras_event.h                           |    3 
 kernel/acct.c                                     |   10 
 kernel/cgroup/cpuset.c                            |    2 
 kernel/dma/direct.c                               |    2 
 kernel/fork.c                                     |    4 
 kernel/futex.c                                    |    2 
 kernel/irq/timings.c                              |    2 
 kernel/jump_label.c                               |    2 
 kernel/kcsan/encoding.h                           |    2 
 kernel/kexec_core.c                               |    2 
 kernel/kexec_file.c                               |    2 
 kernel/kthread.c                                  |    2 
 kernel/livepatch/state.c                          |    2 
 kernel/panic.c                                    |   12 
 kernel/pid_namespace.c                            |    2 
 kernel/power/snapshot.c                           |    2 
 kernel/range.c                                    |    3 
 kernel/relay.c                                    |    2 
 kernel/resource.c                                 |  114 +++++--
 kernel/smp.c                                      |    2 
 kernel/sys.c                                      |    2 
 kernel/user_namespace.c                           |    2 
 lib/Kconfig.debug                                 |    7 
 lib/Kconfig.ubsan                                 |   14 
 lib/Makefile                                      |    1 
 lib/bitmap.c                                      |    2 
 lib/crc32.c                                       |    2 
 lib/decompress_bunzip2.c                          |    2 
 lib/dynamic_queue_limits.c                        |    4 
 lib/earlycpio.c                                   |    2 
 lib/fault-inject-usercopy.c                       |   39 ++
 lib/find_bit.c                                    |    1 
 lib/hexdump.c                                     |    1 
 lib/idr.c                                         |    9 
 lib/iov_iter.c                                    |    5 
 lib/libcrc32c.c                                   |    2 
 lib/math/rational.c                               |    2 
 lib/math/reciprocal_div.c                         |    1 
 lib/mpi/mpi-bit.c                                 |    2 
 lib/percpu_counter.c                              |    2 
 lib/radix-tree.c                                  |    2 
 lib/scatterlist.c                                 |    2 
 lib/strncpy_from_user.c                           |    3 
 lib/syscall.c                                     |    2 
 lib/test_hmm.c                                    |    2 
 lib/test_sysctl.c                                 |    2 
 lib/test_xarray.c                                 |   65 ++++
 lib/usercopy.c                                    |    5 
 lib/xarray.c                                      |  208 ++++++++++++
 mm/Kconfig                                        |    2 
 mm/compaction.c                                   |    6 
 mm/debug_vm_pgtable.c                             |  267 ++++++++--------
 mm/filemap.c                                      |   58 ++-
 mm/gup.c                                          |   73 ++--
 mm/highmem.c                                      |    4 
 mm/huge_memory.c                                  |   47 +-
 mm/hwpoison-inject.c                              |   18 -
 mm/internal.h                                     |   47 +-
 mm/khugepaged.c                                   |    2 
 mm/madvise.c                                      |   52 ---
 mm/memory-failure.c                               |  357 ++++++++++------------
 mm/memory.c                                       |    7 
 mm/memory_hotplug.c                               |  223 +++++--------
 mm/memremap.c                                     |    3 
 mm/migrate.c                                      |   11 
 mm/mmap.c                                         |    7 
 mm/mmu_notifier.c                                 |    2 
 mm/page-writeback.c                               |    1 
 mm/page_alloc.c                                   |  289 +++++++++++------
 mm/page_isolation.c                               |   16 
 mm/page_owner.c                                   |   10 
 mm/page_poison.c                                  |   20 -
 mm/page_reporting.c                               |    4 
 mm/readahead.c                                    |  174 ++++------
 mm/rmap.c                                         |   10 
 mm/shmem.c                                        |    2 
 mm/shuffle.c                                      |    2 
 mm/slab.c                                         |    2 
 mm/slab.h                                         |    1 
 mm/slub.c                                         |    2 
 mm/sparse.c                                       |    2 
 mm/swap_state.c                                   |    2 
 mm/truncate.c                                     |    6 
 mm/util.c                                         |    3 
 mm/vmscan.c                                       |    5 
 mm/vmstat.c                                       |    8 
 mm/workingset.c                                   |    2 
 scripts/Makefile.ubsan                            |   10 
 scripts/checkpatch.pl                             |  238 ++++++++++----
 scripts/const_structs.checkpatch                  |    3 
 scripts/gdb/linux/proc.py                         |   15 
 scripts/gdb/linux/tasks.py                        |    9 
 scripts/get_maintainer.pl                         |    9 
 tools/testing/selftests/exec/.gitignore           |    1 
 tools/testing/selftests/exec/Makefile             |    9 
 tools/testing/selftests/exec/load_address.c       |   68 ++++
 161 files changed, 2532 insertions(+), 1864 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-10-13 23:46 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-10-13 23:46 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c.

Subsystems affected by this patch series:

  kbuild
  scripts
  ntfs
  ocfs2
  vfs
  mm/slab
  mm/slub
  mm/kmemleak
  mm/dax
  mm/debug
  mm/pagecache
  mm/fadvise
  mm/gup
  mm/swap
  mm/memremap
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mincore
  mm/hmm
  mm/dma
  mm/memory-failure
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/pagealloc
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/zbud
  mm/compaction
  mm/mempolicy
  mm/mempool
  mm/memblock
  mm/oom-kill
  mm/migration

Subsystem: kbuild

    Nick Desaulniers <ndesaulniers@google.com>:
    Patch series "set clang minimum version to 10.0.1", v3:
      compiler-clang: add build check for clang 10.0.1
      Revert "kbuild: disable clang's default use of -fmerge-all-constants"
      Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support"
      Revert "arm64: vdso: Fix compilation with clang older than 8"
      Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer"

    Marco Elver <elver@google.com>:
      kasan: remove mentions of unsupported Clang versions

    Nick Desaulniers <ndesaulniers@google.com>:
      compiler-gcc: improve version error
      compiler.h: avoid escaped section names
      export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      kbuild: doc: describe proper script invocation

Subsystem: scripts

    Wang Qing <wangqing@vivo.com>:
      scripts/spelling.txt: increase error-prone spell checking

    Naoki Hayama <naoki.hayama@lineo.co.jp>:
      scripts/spelling.txt: add "arbitrary" typo

    Borislav Petkov <bp@suse.de>:
      scripts/decodecode: add the capability to supply the program counter

Subsystem: ntfs

    Rustam Kovhaev <rkovhaev@gmail.com>:
      ntfs: add check for mft record size in superblock

Subsystem: ocfs2

    Randy Dunlap <rdunlap@infradead.org>:
      ocfs2: delete repeated words in comments

    Gang He <ghe@suse.com>:
      ocfs2: fix potential soft lockup during fstrim

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr

    Luo Jiaxing <luojiaxing@huawei.com>:
      fs_parse: mark fs_param_bad_value() as static

Subsystem: mm/slab

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/slab.c: clean code by removing redundant if condition

    tangjianqiang <wyqt1985@gmail.com>:
      include/linux/slab.h: fix a typo error in comment

Subsystem: mm/slub

    Abel Wu <wuyun.wu@huawei.com>:
      mm/slub.c: branch optimization in free slowpath
      mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc
      mm/slub: make add_full() condition more explicit

Subsystem: mm/kmemleak

    Davidlohr Bueso <dave@stgolabs.net>:
      mm/kmemleak: rely on rcu for task stack scanning

    Hui Su <sh_def@163.com>:
      mm,kmemleak-test.c: move kmemleak-test.c to samples dir

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
    Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5:
      x86/numa: cleanup configuration dependent command-line options
      x86/numa: add 'nohmat' option
      efi/fake_mem: arrange for a resource entry per efi_fake_mem instance
      ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device
      resource: report parent to walk_iomem_res_desc() callback
      mm/memory_hotplug: introduce default phys_to_target_node() implementation
      ACPI: HMAT: attach a device for each soft-reserved range
      device-dax: drop the dax_region.pfn_flags attribute
      device-dax: move instance creation parameters to 'struct dev_dax_data'
      device-dax: make pgmap optional for instance creation
      device-dax/kmem: introduce dax_kmem_range()
      device-dax/kmem: move resource name tracking to drvdata
      device-dax/kmem: replace release_resource() with release_mem_region()
      device-dax: add an allocation interface for device-dax instances
      device-dax: introduce 'struct dev_dax' typed-driver operations
      device-dax: introduce 'seed' devices
      drivers/base: make device_find_child_by_name() compatible with sysfs inputs
      device-dax: add resize support
      mm/memremap_pages: convert to 'struct range'
      mm/memremap_pages: support multiple ranges per invocation
      device-dax: add dis-contiguous resource support
      device-dax: introduce 'mapping' devices

    Joao Martins <joao.m.martins@oracle.com>:
      device-dax: make align a per-device property

    Dan Williams <dan.j.williams@intel.com>:
      device-dax: add an 'align' attribute

    Joao Martins <joao.m.martins@oracle.com>:
      dax/hmem: introduce dax_hmem.region_idle parameter
      device-dax: add a range mapping allocation attribute

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug.c: do not dereference i_ino blindly

    John Hubbard <jhubbard@nvidia.com>:
      mm, dump_page: rename head_mapcount() --> head_compound_mapcount()

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Return head pages from find_*_entry", v2:
      mm: factor find_get_incore_page out of mincore_page
      mm: use find_get_incore_page in memcontrol
      mm: optimise madvise WILLNEED
      proc: optimise smaps for shmem entries
      i915: use find_lock_page instead of find_lock_entry
      mm: convert find_get_entry to return the head page
      mm/shmem: return head page from find_lock_entry
      mm: add find_lock_head
      mm/filemap: fix filemap_map_pages for THP

Subsystem: mm/fadvise

    Yafang Shao <laoar.shao@gmail.com>:
      mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED

Subsystem: mm/gup

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/gup_benchmark: update the documentation in Kconfig
      mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag
      mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: protect unpin_user_pages() against npages==-ERRNO

Subsystem: mm/swap

    Gao Xiang <hsiangkao@redhat.com>:
      swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity

    Yu Zhao <yuzhao@google.com>:
      mm: remove activate_page() from unuse_pte()
      mm: remove superfluous __ClearPageActive()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/swap.c: fix confusing comment in release_pages()
      mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache()
      mm/page_io.c: remove useless out label in __swap_writepage()
      mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable()
      mm/swapfile.c: remove unnecessary goto out in _swap_info_get()
      mm/swapfile.c: fix potential memory leak in sys_swapon

Subsystem: mm/memremap

    Ira Weiny <ira.weiny@intel.com>:
      mm/memremap.c: convert devmap static branch to {inc,dec}

Subsystem: mm/memcg

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      mm: memcontrol: use flex_array_size() helper in memcpy()
      mm: memcontrol: use the preferred form for passing the size of a structure type

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: memcontrol: correct the comment of mem_cgroup_iter()

    Waiman Long <longman@redhat.com>:
    Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2:
      mm/memcg: clean up obsolete enum charge_type
      mm/memcg: simplify mem_cgroup_get_max()
      mm/memcg: unify swap and memsw page counters

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: add the missing numa_stat interface for cgroup v2

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge()
      mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom()

    Bharata B Rao <bharata@linux.ibm.com>:
      mm: memcg/slab: uncharge during kmem_cache_free_bulk()

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/memcg: fix device private memcg accounting

Subsystem: mm/selftests

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: fix some minor aggravating factors in the Makefile":
      selftests/vm: fix false build success on the second and later attempts
      selftests/vm: fix incorrect gcc invocation in some cases

Subsystem: mm/pagemap

    Matthew Wilcox <willy@infradead.org>:
      mm: account PMD tables like PTE tables

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/memory.c: fix typo in __do_fault() comment
      mm/memory.c: replace vmf->vma with variable vma

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: rename __vma_unlink_common() to __vma_unlink()
      mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase()

    Chinwen Chang <chinwen.chang@mediatek.com>:
    Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4:
      mmap locking API: add mmap_lock_is_contended()
      mm: smaps*: extend smap_gather_stats to support specified beginning
      mm: proc: smaps_rollup: do not stall write attempts on mmap_lock

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Fix PageDoubleMap":
      mm: move PageDoubleMap bit
      mm: simplify PageDoubleMap with PF_SECOND policy

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: leave adjust_next as virtual address instead of page frame number

    Randy Dunlap <rdunlap@infradead.org>:
      mm/memory.c: fix spello of "function"

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: not necessary to check mapping separately
      mm/mmap: check on file instead of the rb_root_cached of its address_space

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: use helper function mapping_allow_writable()
      mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct()

    Liao Pingfang <liao.pingfang@zte.com.cn>:
      mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct()

    Peter Xu <peterx@redhat.com>:
      mm: remove src/dst mm parameter in copy_page_range()

Subsystem: mm/mincore

    yuleixzhang <yulei.kernel@gmail.com>:
      include/linux/huge_mm.h: remove mincore_huge_pmd declaration

Subsystem: mm/hmm

    Ralph Campbell <rcampbell@nvidia.com>:
      tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro
      lib/test_hmm.c: remove unused dmirror_zero_page

Subsystem: mm/dma

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      mm/dmapool.c: replace open-coded list_for_each_entry_safe()
      mm/dmapool.c: replace hard coded function name with __func__

Subsystem: mm/memory-failure

    Xianting Tian <tian.xianting@h3c.com>:
      mm/memory-failure: do pgoff calculation before for_each_process()

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memory-failure.c: remove unused macro `writeback'

Subsystem: mm/vmalloc

    Hui Su <sh_def@163.com>:
      mm/vmalloc.c: update the comment in __vmalloc_area_node()
      mm/vmalloc.c: fix the comment of find_vm_area

Subsystem: mm/documentation

    Alexander Gordeev <agordeev@linux.ibm.com>:
      docs/vm: fix 'mm_count' vs 'mm_users' counter confusion

Subsystem: mm/kasan

    Patricia Alfonso <trishalfonso@google.com>:
    Patch series "KASAN-KUnit Integration", v14:
      kasan/kunit: add KUnit Struct to Current Task
      KUnit: KASAN Integration
      KASAN: port KASAN Tests to KUnit
      KASAN: Testing Documentation

    David Gow <davidgow@google.com>:
      mm: kasan: do not panic if both panic_on_warn and kasan_multishot set

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
    Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5:
      mm/page_alloc: tweak comments in has_unmovable_pages()
      mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate()
      mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate()
      mm/page_isolation: cleanup set_migratetype_isolate()
      virtio-mem: don't special-case ZONE_MOVABLE
      mm: document semantics of ZONE_MOVABLE

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm, isolation: avoid checking unmovable pages across pageblock boundary

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/page_alloc.c: clean code by removing unnecessary initialization
      mm/page_alloc.c: micro-optimization remove unnecessary branch
      mm/page_alloc.c: fix early params garbage value accesses
      mm/page_alloc.c: clean code by merging two functions

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/page_alloc.c: __perform_reclaim should return 'unsigned long'

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mmzone: clean code by removing unused macro parameter

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: move call to compound_head() in release_pages()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/page_alloc.c: fix freeing non-compound pages

    Michal Hocko <mhocko@suse.com>:
      include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts

Subsystem: mm/hugetlb

    Baoquan He <bhe@redhat.com>:
    Patch series "mm/hugetlb: Small cleanup and improvement", v2:
      mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool
      mm/hugetlb.c: remove the unnecessary non_swap_entry()
      doc/vm: fix typo in the hugetlb admin documentation

    Wei Yang <richard.weiyang@linux.alibaba.com>:
    Patch series "mm/hugetlb: code refine and simplification", v4:
      mm/hugetlb: not necessary to coalesce regions recursively
      mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache()
      mm/hugetlb: use list_splice to merge two list at once
      mm/hugetlb: count file_region to be added when regions_needed != NULL
      mm/hugetlb: a page from buddy is not on any list
      mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page
      mm/hugetlb: take the free hpage during the iteration directly

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share

Subsystem: mm/vmscan

    Chunxin Zang <zangchunxin@bytedance.com>:
      mm/vmscan: fix infinite loop in drop_slab_node

    Hui Su <sh_def@163.com>:
      mm/vmscan: fix comments for isolate_lru_page()

Subsystem: mm/z3fold

    Hui Su <sh_def@163.com>:
      mm/z3fold.c: use xx_zalloc instead xx_alloc and memset

Subsystem: mm/zbud

    Xiang Chen <chenxiang66@hisilicon.com>:
      mm/zbud: remove redundant initialization

Subsystem: mm/compaction

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/compaction.c: micro-optimization remove unnecessary branch
      include/linux/compaction.h: clean code by removing unused enum value

    John Hubbard <jhubbard@nvidia.com>:
      selftests/vm: 8x compaction_test speedup

Subsystem: mm/mempolicy

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mempolicy: remove or narrow the lock on current
      mm: remove unused alloc_page_vma_node()

Subsystem: mm/mempool

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempool: add 'else' to split mutually exclusive case

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "memblock: seasonal cleaning^w cleanup", v3:
      KVM: PPC: Book3S HV: simplify kvm_cma_reserve()
      dma-contiguous: simplify cma_early_percent_memory()
      arm, xtensa: simplify initialization of high memory pages
      arm64: numa: simplify dummy_numa_init()
      h8300, nds32, openrisc: simplify detection of memory extents
      riscv: drop unneeded node initialization
      mircoblaze: drop unneeded NUMA and sparsemem initializations
      memblock: make for_each_memblock_type() iterator private
      memblock: make memblock_debug and related functionality private
      memblock: reduce number of parameters in for_each_mem_range()
      arch, mm: replace for_each_memblock() with for_each_mem_pfn_range()
      arch, drivers: replace for_each_membock() with for_each_mem_range()
      x86/setup: simplify initrd relocation and reservation
      x86/setup: simplify reserve_crashkernel()
      memblock: remove unused memblock_mem_size()
      memblock: implement for_each_reserved_mem_region() using __next_mem_region()
      memblock: use separate iterators for memory and reserved regions

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary

Subsystem: mm/migration

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate: remove cpages-- in migrate_vma_finalize()
      mm/migrate: remove obsolete comment about device public

 .clang-format                                |    7 
 Documentation/admin-guide/cgroup-v2.rst      |   69 +
 Documentation/admin-guide/mm/hugetlbpage.rst |    2 
 Documentation/dev-tools/kasan.rst            |   74 +
 Documentation/dev-tools/kmemleak.rst         |    2 
 Documentation/kbuild/makefiles.rst           |   20 
 Documentation/vm/active_mm.rst               |    2 
 Documentation/x86/x86_64/boot-options.rst    |    4 
 MAINTAINERS                                  |    2 
 Makefile                                     |    9 
 arch/arm/Kconfig                             |    2 
 arch/arm/include/asm/tlb.h                   |    1 
 arch/arm/kernel/setup.c                      |   18 
 arch/arm/mm/init.c                           |   59 -
 arch/arm/mm/mmu.c                            |   39 
 arch/arm/mm/pmsa-v7.c                        |   23 
 arch/arm/mm/pmsa-v8.c                        |   17 
 arch/arm/xen/mm.c                            |    7 
 arch/arm64/Kconfig                           |    2 
 arch/arm64/kernel/machine_kexec_file.c       |    6 
 arch/arm64/kernel/setup.c                    |    4 
 arch/arm64/kernel/vdso/Makefile              |    7 
 arch/arm64/mm/init.c                         |   11 
 arch/arm64/mm/kasan_init.c                   |   10 
 arch/arm64/mm/mmu.c                          |   11 
 arch/arm64/mm/numa.c                         |   15 
 arch/c6x/kernel/setup.c                      |    9 
 arch/h8300/kernel/setup.c                    |    8 
 arch/microblaze/mm/init.c                    |   23 
 arch/mips/cavium-octeon/dma-octeon.c         |   14 
 arch/mips/kernel/setup.c                     |   31 
 arch/mips/netlogic/xlp/setup.c               |    2 
 arch/nds32/kernel/setup.c                    |    8 
 arch/openrisc/kernel/setup.c                 |    9 
 arch/openrisc/mm/init.c                      |    8 
 arch/powerpc/kernel/fadump.c                 |   61 -
 arch/powerpc/kexec/file_load_64.c            |   16 
 arch/powerpc/kvm/book3s_hv_builtin.c         |   12 
 arch/powerpc/kvm/book3s_hv_uvmem.c           |   14 
 arch/powerpc/mm/book3s64/hash_utils.c        |   16 
 arch/powerpc/mm/book3s64/radix_pgtable.c     |   10 
 arch/powerpc/mm/kasan/kasan_init_32.c        |    8 
 arch/powerpc/mm/mem.c                        |   31 
 arch/powerpc/mm/numa.c                       |    7 
 arch/powerpc/mm/pgtable_32.c                 |    8 
 arch/riscv/mm/init.c                         |   36 
 arch/riscv/mm/kasan_init.c                   |   10 
 arch/s390/kernel/setup.c                     |   27 
 arch/s390/mm/page-states.c                   |    6 
 arch/s390/mm/vmem.c                          |    7 
 arch/sh/mm/init.c                            |    9 
 arch/sparc/mm/init_64.c                      |   12 
 arch/x86/include/asm/numa.h                  |    8 
 arch/x86/kernel/e820.c                       |   16 
 arch/x86/kernel/setup.c                      |   56 -
 arch/x86/mm/numa.c                           |   13 
 arch/x86/mm/numa_emulation.c                 |    3 
 arch/x86/xen/enlighten_pv.c                  |    2 
 arch/xtensa/mm/init.c                        |   55 -
 drivers/acpi/numa/hmat.c                     |   76 -
 drivers/acpi/numa/srat.c                     |    9 
 drivers/base/core.c                          |    2 
 drivers/bus/mvebu-mbus.c                     |   12 
 drivers/dax/Kconfig                          |    6 
 drivers/dax/Makefile                         |    3 
 drivers/dax/bus.c                            | 1237 +++++++++++++++++++++++----
 drivers/dax/bus.h                            |   34 
 drivers/dax/dax-private.h                    |   74 +
 drivers/dax/device.c                         |  164 +--
 drivers/dax/hmem.c                           |   56 -
 drivers/dax/hmem/Makefile                    |    8 
 drivers/dax/hmem/device.c                    |  100 ++
 drivers/dax/hmem/hmem.c                      |   93 +-
 drivers/dax/kmem.c                           |  236 ++---
 drivers/dax/pmem/compat.c                    |    2 
 drivers/dax/pmem/core.c                      |   36 
 drivers/firmware/efi/x86_fake_mem.c          |   12 
 drivers/gpu/drm/i915/gem/i915_gem_shmem.c    |    4 
 drivers/gpu/drm/nouveau/nouveau_dmem.c       |   15 
 drivers/irqchip/irq-gic-v3-its.c             |    2 
 drivers/nvdimm/badrange.c                    |   26 
 drivers/nvdimm/claim.c                       |   13 
 drivers/nvdimm/nd.h                          |    3 
 drivers/nvdimm/pfn_devs.c                    |   13 
 drivers/nvdimm/pmem.c                        |   27 
 drivers/nvdimm/region.c                      |   21 
 drivers/pci/p2pdma.c                         |   12 
 drivers/virtio/virtio_mem.c                  |   47 -
 drivers/xen/unpopulated-alloc.c              |   45 
 fs/fs_parser.c                               |    2 
 fs/ntfs/inode.c                              |    6 
 fs/ocfs2/alloc.c                             |    6 
 fs/ocfs2/localalloc.c                        |    2 
 fs/proc/base.c                               |    3 
 fs/proc/task_mmu.c                           |  104 +-
 fs/xattr.c                                   |   22 
 include/acpi/acpi_numa.h                     |   14 
 include/kunit/test.h                         |    5 
 include/linux/acpi.h                         |    2 
 include/linux/compaction.h                   |    3 
 include/linux/compiler-clang.h               |    8 
 include/linux/compiler-gcc.h                 |    2 
 include/linux/compiler.h                     |    2 
 include/linux/dax.h                          |    8 
 include/linux/export.h                       |    2 
 include/linux/fs.h                           |    4 
 include/linux/gfp.h                          |    6 
 include/linux/huge_mm.h                      |    3 
 include/linux/kasan.h                        |    6 
 include/linux/memblock.h                     |   90 +
 include/linux/memcontrol.h                   |   13 
 include/linux/memory_hotplug.h               |   23 
 include/linux/memremap.h                     |   15 
 include/linux/mm.h                           |   36 
 include/linux/mmap_lock.h                    |    5 
 include/linux/mmzone.h                       |   37 
 include/linux/numa.h                         |   11 
 include/linux/oom.h                          |    1 
 include/linux/page-flags.h                   |   42 
 include/linux/pagemap.h                      |   43 
 include/linux/range.h                        |    6 
 include/linux/sched.h                        |    4 
 include/linux/sched/coredump.h               |    1 
 include/linux/slab.h                         |    2 
 include/linux/swap.h                         |   10 
 include/linux/swap_slots.h                   |    2 
 kernel/dma/contiguous.c                      |   11 
 kernel/fork.c                                |   25 
 kernel/resource.c                            |   11 
 lib/Kconfig.debug                            |    9 
 lib/Kconfig.kasan                            |   31 
 lib/Makefile                                 |    5 
 lib/kunit/test.c                             |   13 
 lib/test_free_pages.c                        |   42 
 lib/test_hmm.c                               |   65 -
 lib/test_kasan.c                             |  732 ++++++---------
 lib/test_kasan_module.c                      |  111 ++
 mm/Kconfig                                   |    4 
 mm/Makefile                                  |    1 
 mm/compaction.c                              |    5 
 mm/debug.c                                   |   18 
 mm/dmapool.c                                 |   46 -
 mm/fadvise.c                                 |    9 
 mm/filemap.c                                 |   78 -
 mm/gup.c                                     |   44 
 mm/gup_benchmark.c                           |   23 
 mm/huge_memory.c                             |    4 
 mm/hugetlb.c                                 |  100 +-
 mm/internal.h                                |    3 
 mm/kasan/report.c                            |   34 
 mm/kmemleak-test.c                           |   99 --
 mm/kmemleak.c                                |    8 
 mm/madvise.c                                 |   21 
 mm/memblock.c                                |  102 --
 mm/memcontrol.c                              |  262 +++--
 mm/memory-failure.c                          |    5 
 mm/memory.c                                  |  147 +--
 mm/memory_hotplug.c                          |   10 
 mm/mempolicy.c                               |    8 
 mm/mempool.c                                 |   18 
 mm/memremap.c                                |  344 ++++---
 mm/migrate.c                                 |    3 
 mm/mincore.c                                 |   28 
 mm/mmap.c                                    |   45 
 mm/oom_kill.c                                |    2 
 mm/page_alloc.c                              |   82 -
 mm/page_counter.c                            |    2 
 mm/page_io.c                                 |   14 
 mm/page_isolation.c                          |   41 
 mm/shmem.c                                   |   19 
 mm/slab.c                                    |    4 
 mm/slab.h                                    |   50 -
 mm/slub.c                                    |   33 
 mm/sparse.c                                  |   10 
 mm/swap.c                                    |   14 
 mm/swap_slots.c                              |    3 
 mm/swap_state.c                              |   38 
 mm/swapfile.c                                |   12 
 mm/truncate.c                                |   58 -
 mm/vmalloc.c                                 |    6 
 mm/vmscan.c                                  |    5 
 mm/z3fold.c                                  |    3 
 mm/zbud.c                                    |    1 
 samples/Makefile                             |    1 
 samples/kmemleak/Makefile                    |    3 
 samples/kmemleak/kmemleak-test.c             |   99 ++
 scripts/decodecode                           |   29 
 scripts/spelling.txt                         |    4 
 tools/testing/nvdimm/dax-dev.c               |   28 
 tools/testing/nvdimm/test/iomap.c            |    2 
 tools/testing/selftests/vm/Makefile          |   17 
 tools/testing/selftests/vm/compaction_test.c |   11 
 tools/testing/selftests/vm/gup_benchmark.c   |   14 
 tools/testing/selftests/vm/hmm-tests.c       |    4 
 194 files changed, 4273 insertions(+), 2777 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-10-11  6:15 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-10-11  6:15 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d.

Subsystems affected by this patch series:

  MAINTAINERS
  mm/pagemap
  mm/swap
  mm/hugetlb

Subsystem: MAINTAINERS

    Kees Cook <keescook@chromium.org>:
      MAINTAINERS: change hardening mailing list

    Antoine Tenart <atenart@kernel.org>:
      MAINTAINERS: Antoine Tenart's email address

Subsystem: mm/pagemap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: mmap: Fix general protection fault in unlink_file_vma()

Subsystem: mm/swap

    Minchan Kim <minchan@kernel.org>:
      mm: validate inode in mapping_set_error()

Subsystem: mm/hugetlb

    Vijay Balakrishna <vijayb@linux.microsoft.com>:
      mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged

 .mailmap                   |    4 +++-
 MAINTAINERS                |    8 ++++----
 include/linux/khugepaged.h |    5 +++++
 include/linux/pagemap.h    |    3 ++-
 mm/khugepaged.c            |   13 +++++++++++--
 mm/mmap.c                  |    6 +++++-
 mm/page_alloc.c            |    3 +++
 7 files changed, 33 insertions(+), 9 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-10-03  5:20 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-10-03  5:20 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e.

Subsystems affected by this patch series:

  mm/slub
  mm/cma
  scripts

Subsystem: mm/slub

    Eric Farman <farman@linux.ibm.com>:
      mm, slub: restore initial kmem_cache flags

Subsystem: mm/cma

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs

Subsystem: scripts

    Eric Biggers <ebiggers@google.com>:
      scripts/spelling.txt: fix malformed entry

 mm/page_alloc.c      |   19 ++++++++++++++++---
 mm/slub.c            |    6 +-----
 scripts/spelling.txt |    2 +-
 3 files changed, 18 insertions(+), 9 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-09-26  4:17 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-09-26  4:17 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6.

Subsystems affected by this patch series:

  mm/thp
  mm/memcg
  mm/gup
  mm/migration
  lib
  x86
  mm/memory-hotplug

Subsystem: mm/thp

    Gao Xiang <hsiangkao@redhat.com>:
      mm, THP, swap: fix allocating cluster for swapfile by mistake

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix missing suffix of workingset_restore

Subsystem: mm/gup

    Vasily Gorbik <gor@linux.ibm.com>:
      mm/gup: fix gup_fast with dynamic page table folding

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm/migrate: correct thp migration stats

Subsystem: lib

    Nick Desaulniers <ndesaulniers@google.com>:
      lib/string.c: implement stpcpy

    Jason Yan <yanaijie@huawei.com>:
      lib/memregion.c: include memregion.h

Subsystem: x86

    Mikulas Patocka <mpatocka@redhat.com>:
      arch/x86/lib/usercopy_64.c: fix  __copy_user_flushcache() cache writeback

Subsystem: mm/memory-hotplug

    Laurent Dufour <ldufour@linux.ibm.com>:
    Patch series "mm: fix memory to node bad links in sysfs", v3:
      mm: replace memmap_context by meminit_context
      mm: don't rely on system state to detect hot-plug operations

 Documentation/admin-guide/cgroup-v2.rst |   25 ++++++---
 arch/ia64/mm/init.c                     |    6 +-
 arch/s390/include/asm/pgtable.h         |   42 +++++++++++----
 arch/x86/lib/usercopy_64.c              |    2 
 drivers/base/node.c                     |   85 ++++++++++++++++++++------------
 include/linux/mm.h                      |    2 
 include/linux/mmzone.h                  |   11 +++-
 include/linux/node.h                    |   11 ++--
 include/linux/pgtable.h                 |   10 +++
 lib/memregion.c                         |    1 
 lib/string.c                            |   24 +++++++++
 mm/gup.c                                |   18 +++---
 mm/memcontrol.c                         |    4 -
 mm/memory_hotplug.c                     |    5 +
 mm/migrate.c                            |    7 +-
 mm/page_alloc.c                         |   10 +--
 mm/swapfile.c                           |    2 
 17 files changed, 181 insertions(+), 84 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-09-19  4:19 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-09-19  4:19 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b.

Subsystems affected by this patch series:

  mailmap
  mm/hotfixes
  mm/thp
  mm/memory-hotplug
  misc
  kcsan

Subsystem: mailmap

    Kees Cook <keescook@chromium.org>:
      mailmap: add older email addresses for Kees Cook

Subsystem: mm/hotfixes

    Hugh Dickins <hughd@google.com>:
    Patch series "mm: fixes to past from future testing":
      ksm: reinstate memcg charge on copied pages
      mm: migration of hugetlbfs page skip memcg
      shmem: shmem_writepage() split unlikely i915 THP
      mm: fix check_move_unevictable_pages() on THP
      mlock: fix unevictable_pgs event counts on THP

    Byron Stanoszek <gandalf@winds.org>:
      tmpfs: restore functionality of nr_inodes=0

    Muchun Song <songmuchun@bytedance.com>:
      kprobes: fix kill kprobe which has been marked as gone

Subsystem: mm/thp

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/thp: fix __split_huge_pmd_locked() for migration PMD

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      selftests/vm: fix display of page size in map_hugetlb

Subsystem: mm/memory-hotplug

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      mm/memory_hotplug: drain per-cpu pages again during memory offline

Subsystem: misc

    Tobias Klauser <tklauser@distanz.ch>:
      ftrace: let ftrace_enable_sysctl take a kernel pointer buffer
      stackleak: let stack_erasing_sysctl take a kernel pointer buffer
      fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype

Subsystem: kcsan

    Changbin Du <changbin.du@gmail.com>:
      kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments'

 .mailmap                                 |    4 ++
 fs/fs-writeback.c                        |    2 -
 include/linux/ftrace.h                   |    3 --
 include/linux/stackleak.h                |    2 -
 kernel/kprobes.c                         |    9 +++++-
 kernel/stackleak.c                       |    2 -
 kernel/trace/ftrace.c                    |    3 --
 lib/Kconfig.debug                        |    4 --
 mm/huge_memory.c                         |   42 ++++++++++++++++---------------
 mm/ksm.c                                 |    4 ++
 mm/memory_hotplug.c                      |   14 ++++++++++
 mm/migrate.c                             |    3 +-
 mm/mlock.c                               |   24 +++++++++++------
 mm/page_isolation.c                      |    8 +++++
 mm/shmem.c                               |   20 +++++++++++---
 mm/swap.c                                |    6 ++--
 mm/vmscan.c                              |   10 +++++--
 tools/testing/selftests/vm/map_hugetlb.c |    2 -
 18 files changed, 111 insertions(+), 51 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-09-04 23:34 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-09-04 23:34 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6.

Subsystems affected by this patch series:

  mm/memcg
  mm/slub
  MAINTAINERS
  mm/pagemap
  ipc
  fork
  checkpatch
  mm/madvise
  mm/migration
  mm/hugetlb
  lib

Subsystem: mm/memcg

    Michal Hocko <mhocko@suse.com>:
      memcg: fix use-after-free in uncharge_batch

    Xunlei Pang <xlpang@linux.alibaba.com>:
      mm: memcg: fix memcg reclaim soft lockup

Subsystem: mm/slub

    Eugeniu Rosca <erosca@de.adit-jv.com>:
      mm: slub: fix conversion of freelist_corrupted()

Subsystem: MAINTAINERS

    Robert Richter <rric@kernel.org>:
      MAINTAINERS: update Cavium/Marvell entries

    Nick Desaulniers <ndesaulniers@google.com>:
      MAINTAINERS: add LLVM maintainers

    Randy Dunlap <rdunlap@infradead.org>:
      MAINTAINERS: IA64: mark Status as Odd Fixes only

Subsystem: mm/pagemap

    Joerg Roedel <jroedel@suse.de>:
      mm: track page table modifications in __apply_to_page_range()

Subsystem: ipc

    Tobias Klauser <tklauser@distanz.ch>:
      ipc: adjust proc_ipc_sem_dointvec definition to match prototype

Subsystem: fork

    Tobias Klauser <tklauser@distanz.ch>:
      fork: adjust sysctl_max_threads definition to match prototype

Subsystem: checkpatch

    Mrinal Pandey <mrinalmni@gmail.com>:
      checkpatch: fix the usage of capture group ( ... )

Subsystem: mm/madvise

    Yang Shi <shy828301@gmail.com>:
      mm: madvise: fix vma user-after-free

Subsystem: mm/migration

    Alistair Popple <alistair@popple.id.au>:
      mm/migrate: fixup setting UFFD_WP flag
      mm/rmap: fixup copying of soft dirty and uffd ptes

    Ralph Campbell <rcampbell@nvidia.com>:
    Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()":
      mm/migrate: remove unnecessary is_zone_device_page() check
      mm/migrate: preserve soft dirty in remove_migration_pte()

Subsystem: mm/hugetlb

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb: try preferred node first when alloc gigantic page from cma

    Muchun Song <songmuchun@bytedance.com>:
      mm/hugetlb: fix a race between hugetlb sysctl handlers

    David Howells <dhowells@redhat.com>:
      mm/khugepaged.c: fix khugepaged's request size in collapse_file

Subsystem: lib

    Jason Gunthorpe <jgg@nvidia.com>:
      include/linux/log2.h: add missing () around n in roundup_pow_of_two()

 MAINTAINERS           |   32 ++++++++++++++++----------------
 include/linux/log2.h  |    2 +-
 ipc/ipc_sysctl.c      |    2 +-
 kernel/fork.c         |    2 +-
 mm/hugetlb.c          |   49 +++++++++++++++++++++++++++++++++++++------------
 mm/khugepaged.c       |    2 +-
 mm/madvise.c          |    2 +-
 mm/memcontrol.c       |    6 ++++++
 mm/memory.c           |   37 ++++++++++++++++++++++++-------------
 mm/migrate.c          |   31 +++++++++++++++++++------------
 mm/rmap.c             |    9 +++++++--
 mm/slub.c             |   12 ++++++------
 mm/vmscan.c           |    8 ++++++++
 scripts/checkpatch.pl |    4 ++--
 14 files changed, 130 insertions(+), 68 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-08-21  0:41 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-08-21  0:41 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da.

Subsystems affected by this patch series:

  misc
  mm/hugetlb
  mm/vmalloc
  mm/misc
  romfs
  relay
  uprobes
  squashfs
  mm/cma
  mm/pagealloc

Subsystem: misc

    Nick Desaulniers <ndesaulniers@google.com>:
      mailmap: add Andi Kleen

Subsystem: mm/hugetlb

    Xu Wang <vulab@iscas.ac.cn>:
      hugetlb_cgroup: convert comma to semicolon

    Hugh Dickins <hughd@google.com>:
      khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter()

Subsystem: mm/vmalloc

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/vunmap: add cond_resched() in vunmap_pmd_range

Subsystem: mm/misc

    Leon Romanovsky <leonro@nvidia.com>:
      mm/rodata_test.c: fix missing function declaration

Subsystem: romfs

    Jann Horn <jannh@google.com>:
      romfs: fix uninitialized memory leak in romfs_dev_read()

Subsystem: relay

    Wei Yongjun <weiyongjun1@huawei.com>:
      kernel/relay.c: fix memleak on destroy relay channel

Subsystem: uprobes

    Hugh Dickins <hughd@google.com>:
      uprobes: __replace_page() avoid BUG in munlock_vma_page()

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: avoid bio_alloc() failure with 1Mbyte blocks

Subsystem: mm/cma

    Doug Berger <opendmb@gmail.com>:
      mm: include CMA pages in lowmem_reserve at boot

Subsystem: mm/pagealloc

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, page_alloc: fix core hung in free_pcppages_bulk()

 .mailmap                |    1 +
 fs/romfs/storage.c      |    4 +---
 fs/squashfs/block.c     |    6 +++++-
 kernel/events/uprobes.c |    2 +-
 kernel/relay.c          |    1 +
 mm/hugetlb_cgroup.c     |    4 ++--
 mm/khugepaged.c         |    2 +-
 mm/page_alloc.c         |    7 ++++++-
 mm/rodata_test.c        |    1 +
 mm/vmalloc.c            |    2 ++
 10 files changed, 21 insertions(+), 9 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-08-15  0:29 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-08-15  0:29 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66.

Subsystems affected by this patch series:

  mm/hotfixes
  lz4
  exec
  mailmap
  mm/thp
  autofs
  mm/madvise
  sysctl
  mm/kmemleak
  mm/misc
  lib

Subsystem: mm/hotfixes

    Mike Rapoport <rppt@linux.ibm.com>:
      asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one()

    Baoquan He <bhe@redhat.com>:
      Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone"

Subsystem: lz4

    Nick Terrell <terrelln@fb.com>:
      lz4: fix kernel decompression speed

Subsystem: exec

    Kees Cook <keescook@chromium.org>:
    Patch series "Fix S_ISDIR execve() errno":
      exec: restore EACCES of S_ISDIR execve()
      selftests/exec: add file type errno tests

Subsystem: mailmap

    Greg Kurz <groug@kaod.org>:
      mailmap: add entry for Greg Kurz

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "THP prep patches":
      mm: store compound_nr as well as compound_order
      mm: move page-flags include to top of file
      mm: add thp_order
      mm: add thp_size
      mm: replace hpage_nr_pages with thp_nr_pages
      mm: add thp_head
      mm: introduce offset_in_thp

Subsystem: autofs

    Randy Dunlap <rdunlap@infradead.org>:
      fs: autofs: delete repeated words in comments

Subsystem: mm/madvise

    Minchan Kim <minchan@kernel.org>:
    Patch series "introduce memory hinting API for external process", v8:
      mm/madvise: pass task and mm to do_madvise
      pid: move pidfd_get_pid() to pid.c
      mm/madvise: introduce process_madvise() syscall: an external memory hinting API
      mm/madvise: check fatal signal pending of target process

Subsystem: sysctl

    Xiaoming Ni <nixiaoming@huawei.com>:
      all arch: remove system call sys_sysctl

Subsystem: mm/kmemleak

    Qian Cai <cai@lca.pw>:
      mm/kmemleak: silence KCSAN splats in checksum

Subsystem: mm/misc

    Qian Cai <cai@lca.pw>:
      mm/frontswap: mark various intentional data races
      mm/page_io: mark various intentional data races
      mm/swap_state: mark various intentional data races

    Kirill A. Shutemov <kirill@shutemov.name>:
      mm/filemap.c: fix a data race in filemap_fault()

    Qian Cai <cai@lca.pw>:
      mm/swapfile: fix and annotate various data races
      mm/page_counter: fix various data races at memsw
      mm/memcontrol: fix a data race in scan count
      mm/list_lru: fix a data race in list_lru_count_one
      mm/mempool: fix a data race in mempool_free()
      mm/rmap: annotate a data race at tlb_flush_batched
      mm/swap.c: annotate data races for lru_rotate_pvecs
      mm: annotate a data race in page_zonenum()

    Romain Naour <romain.naour@gmail.com>:
      include/asm-generic/vmlinux.lds.h: align ro_after_init

    Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>:
      sh: clkfwk: remove r8/r16/r32
      sh: use generic strncpy()

Subsystem: lib

    Krzysztof Kozlowski <krzk@kernel.org>:
    Patch series "iomap: Constify ioreadX() iomem argument", v3:
      iomap: constify ioreadX() iomem argument (as in generic implementation)
      rtl818x: constify ioreadX() iomem argument (as in generic implementation)
      ntb: intel: constify ioreadX() iomem argument (as in generic implementation)
      virtio: pci: constify ioreadX() iomem argument (as in generic implementation)

 .mailmap                                               |    1 
 arch/alpha/include/asm/core_apecs.h                    |    6 
 arch/alpha/include/asm/core_cia.h                      |    6 
 arch/alpha/include/asm/core_lca.h                      |    6 
 arch/alpha/include/asm/core_marvel.h                   |    4 
 arch/alpha/include/asm/core_mcpcia.h                   |    6 
 arch/alpha/include/asm/core_t2.h                       |    2 
 arch/alpha/include/asm/io.h                            |   12 -
 arch/alpha/include/asm/io_trivial.h                    |   16 -
 arch/alpha/include/asm/jensen.h                        |    2 
 arch/alpha/include/asm/machvec.h                       |    6 
 arch/alpha/kernel/core_marvel.c                        |    2 
 arch/alpha/kernel/io.c                                 |   12 -
 arch/alpha/kernel/syscalls/syscall.tbl                 |    3 
 arch/arm/configs/am200epdkit_defconfig                 |    1 
 arch/arm/tools/syscall.tbl                             |    3 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    6 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    3 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    3 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    3 
 arch/mips/configs/cu1000-neo_defconfig                 |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    3 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    3 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    3 
 arch/parisc/include/asm/io.h                           |    4 
 arch/parisc/kernel/syscalls/syscall.tbl                |    3 
 arch/parisc/lib/iomap.c                                |   72 +++---
 arch/powerpc/kernel/iomap.c                            |   28 +-
 arch/powerpc/kernel/syscalls/syscall.tbl               |    3 
 arch/s390/kernel/syscalls/syscall.tbl                  |    3 
 arch/sh/configs/dreamcast_defconfig                    |    1 
 arch/sh/configs/espt_defconfig                         |    1 
 arch/sh/configs/hp6xx_defconfig                        |    1 
 arch/sh/configs/landisk_defconfig                      |    1 
 arch/sh/configs/lboxre2_defconfig                      |    1 
 arch/sh/configs/microdev_defconfig                     |    1 
 arch/sh/configs/migor_defconfig                        |    1 
 arch/sh/configs/r7780mp_defconfig                      |    1 
 arch/sh/configs/r7785rp_defconfig                      |    1 
 arch/sh/configs/rts7751r2d1_defconfig                  |    1 
 arch/sh/configs/rts7751r2dplus_defconfig               |    1 
 arch/sh/configs/se7206_defconfig                       |    1 
 arch/sh/configs/se7343_defconfig                       |    1 
 arch/sh/configs/se7619_defconfig                       |    1 
 arch/sh/configs/se7705_defconfig                       |    1 
 arch/sh/configs/se7750_defconfig                       |    1 
 arch/sh/configs/se7751_defconfig                       |    1 
 arch/sh/configs/secureedge5410_defconfig               |    1 
 arch/sh/configs/sh03_defconfig                         |    1 
 arch/sh/configs/sh7710voipgw_defconfig                 |    1 
 arch/sh/configs/sh7757lcr_defconfig                    |    1 
 arch/sh/configs/sh7763rdp_defconfig                    |    1 
 arch/sh/configs/shmin_defconfig                        |    1 
 arch/sh/configs/titan_defconfig                        |    1 
 arch/sh/include/asm/string_32.h                        |   26 --
 arch/sh/kernel/iomap.c                                 |   22 -
 arch/sh/kernel/syscalls/syscall.tbl                    |    3 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    3 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    3 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    4 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    3 
 drivers/mailbox/bcm-pdc-mailbox.c                      |    2 
 drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h |    6 
 drivers/ntb/hw/intel/ntb_hw_gen1.c                     |    2 
 drivers/ntb/hw/intel/ntb_hw_gen3.h                     |    2 
 drivers/ntb/hw/intel/ntb_hw_intel.h                    |    2 
 drivers/nvdimm/btt.c                                   |    4 
 drivers/nvdimm/pmem.c                                  |    6 
 drivers/sh/clk/cpg.c                                   |   25 --
 drivers/virtio/virtio_pci_modern.c                     |    6 
 fs/autofs/dev-ioctl.c                                  |    4 
 fs/io_uring.c                                          |    2 
 fs/namei.c                                             |    4 
 include/asm-generic/iomap.h                            |   28 +-
 include/asm-generic/pgalloc.h                          |    2 
 include/asm-generic/vmlinux.lds.h                      |    1 
 include/linux/compat.h                                 |    5 
 include/linux/huge_mm.h                                |   58 ++++-
 include/linux/io-64-nonatomic-hi-lo.h                  |    4 
 include/linux/io-64-nonatomic-lo-hi.h                  |    4 
 include/linux/memcontrol.h                             |    2 
 include/linux/mm.h                                     |   16 -
 include/linux/mm_inline.h                              |    6 
 include/linux/mm_types.h                               |    1 
 include/linux/pagemap.h                                |    6 
 include/linux/pid.h                                    |    1 
 include/linux/syscalls.h                               |    4 
 include/linux/sysctl.h                                 |    6 
 include/uapi/asm-generic/unistd.h                      |    4 
 kernel/Makefile                                        |    2 
 kernel/exit.c                                          |   17 -
 kernel/pid.c                                           |   17 +
 kernel/sys_ni.c                                        |    3 
 kernel/sysctl_binary.c                                 |  171 --------------
 lib/iomap.c                                            |   30 +-
 lib/lz4/lz4_compress.c                                 |    4 
 lib/lz4/lz4_decompress.c                               |   18 -
 lib/lz4/lz4defs.h                                      |   10 
 lib/lz4/lz4hc_compress.c                               |    2 
 mm/compaction.c                                        |    2 
 mm/filemap.c                                           |   22 +
 mm/frontswap.c                                         |    8 
 mm/gup.c                                               |    2 
 mm/internal.h                                          |    4 
 mm/kmemleak.c                                          |    2 
 mm/list_lru.c                                          |    2 
 mm/madvise.c                                           |  190 ++++++++++++++--
 mm/memcontrol.c                                        |   10 
 mm/memory.c                                            |    4 
 mm/memory_hotplug.c                                    |    7 
 mm/mempolicy.c                                         |    2 
 mm/mempool.c                                           |    2 
 mm/migrate.c                                           |   18 -
 mm/mlock.c                                             |    9 
 mm/page_alloc.c                                        |    5 
 mm/page_counter.c                                      |   13 -
 mm/page_io.c                                           |   12 -
 mm/page_vma_mapped.c                                   |    6 
 mm/rmap.c                                              |   10 
 mm/swap.c                                              |   21 -
 mm/swap_state.c                                        |   10 
 mm/swapfile.c                                          |   33 +-
 mm/vmscan.c                                            |    6 
 mm/vmstat.c                                            |   12 -
 mm/workingset.c                                        |    6 
 tools/perf/arch/powerpc/entry/syscalls/syscall.tbl     |    2 
 tools/perf/arch/s390/entry/syscalls/syscall.tbl        |    2 
 tools/perf/arch/x86/entry/syscalls/syscall_64.tbl      |    2 
 tools/testing/selftests/exec/.gitignore                |    1 
 tools/testing/selftests/exec/Makefile                  |    5 
 tools/testing/selftests/exec/non-regular.c             |  196 +++++++++++++++++
 132 files changed, 815 insertions(+), 614 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-08-12  1:29 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-08-12  1:29 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- Most of the rest of MM

- various other subsystems


165 patches, based on 00e4db51259a5f936fec1424b884f029479d3981.

Subsystems affected by this patch series:

  mm/memcg
  mm/hugetlb
  mm/vmscan
  mm/proc
  mm/compaction
  mm/mempolicy
  mm/oom-kill
  mm/hugetlbfs
  mm/migration
  mm/thp
  mm/cma
  mm/util
  mm/memory-hotplug
  mm/cleanups
  mm/uaccess
  alpha
  misc
  sparse
  bitmap
  lib
  lz4
  bitops
  checkpatch
  autofs
  minix
  nilfs
  ufs
  fat
  signals
  kmod
  coredump
  exec
  kdump
  rapidio
  panic
  kcov
  kgdb
  ipc
  mm/migration
  mm/gup
  mm/pagemap

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
    Patch series "mm: memcg accounting of percpu memory", v3:
      percpu: return number of released bytes from pcpu_free_area()
      mm: memcg/percpu: account percpu memory to memory cgroups
      mm: memcg/percpu: per-memcg percpu memory statistics
      mm: memcg: charge memcg percpu memory to the parent cgroup
      kselftests: cgroup: add perpcu memory accounting test

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm/hugetlb: add mempolicy check in the reservation routine

Subsystem: mm/vmscan

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
    Patch series "workingset protection/detection on the anonymous LRU list", v7:
      mm/vmscan: make active/inactive ratio as 1:1 for anon lru
      mm/vmscan: protect the workingset on anonymous LRU
      mm/workingset: prepare the workingset detection infrastructure for anon LRU
      mm/swapcache: support to handle the shadow entries
      mm/swap: implement workingset detection for anonymous LRU
      mm/vmscan: restore active/inactive ratio for anonymous LRU

Subsystem: mm/proc

    Michal Koutný <mkoutny@suse.com>:
      /proc/PID/smaps: consistent whitespace output format

Subsystem: mm/compaction

    Nitin Gupta <nigupta@nvidia.com>:
      mm: proactive compaction
      mm: fix compile error due to COMPACTION_HPAGE_ORDER
      mm: use unsigned types for fragmentation score

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/compaction: correct the comments of compact_defer_shift

Subsystem: mm/mempolicy

    Krzysztof Kozlowski <krzk@kernel.org>:
      mm: mempolicy: fix kerneldoc of numa_map_to_online_node()

    Wenchao Hao <haowenchao22@gmail.com>:
      mm/mempolicy.c: check parameters first in kernel_get_mempolicy

    Yanfei Xu <yanfei.xu@windriver.com>:
      include/linux/mempolicy.h: fix typo

Subsystem: mm/oom-kill

    Yafang Shao <laoar.shao@gmail.com>:
      mm, oom: make the calculation of oom badness more accurate

    Michal Hocko <mhocko@suse.com>:
      doc, mm: sync up oom_score_adj documentation
      doc, mm: clarify /proc/<pid>/oom_score value range

    Yafang Shao <laoar.shao@gmail.com>:
      mm, oom: show process exiting information in __oom_kill_process()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: prevent filesystem stacking of hugetlbfs
      hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem

Subsystem: mm/migration

    Ralph Campbell <rcampbell@nvidia.com>:
    Patch series "mm/migrate: optimize migrate_vma_setup() for holes":
      mm/migrate: optimize migrate_vma_setup() for holes
      mm/migrate: add migrate-shared test for migrate_vma_*()

Subsystem: mm/thp

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: thp: remove debug_cow switch

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/vmstat: add events for THP migration without split

Subsystem: mm/cma

    Jianqun Xu <jay.xu@rock-chips.com>:
      mm/cma.c: fix NULL pointer dereference when cma could not be activated

    Barry Song <song.bao.hua@hisilicon.com>:
    Patch series "mm: fix the names of general cma and hugetlb cma", v2:
      mm: cma: fix the name of CMA areas
      mm: hugetlb: fix the name of hugetlb CMA

    Mike Kravetz <mike.kravetz@oracle.com>:
      cma: don't quit at first error when activating reserved areas

Subsystem: mm/util

    Waiman Long <longman@redhat.com>:
      include/linux/sched/mm.h: optimize current_gfp_context()

    Krzysztof Kozlowski <krzk@kernel.org>:
      mm: mmu_notifier: fix and extend kerneldoc

Subsystem: mm/memory-hotplug

    Daniel Jordan <daniel.m.jordan@oracle.com>:
      x86/mm: use max memory block size on bare metal

    Jia He <justin.he@arm.com>:
      mm/memory_hotplug: introduce default dummy memory_add_physaddr_to_nid()
      mm/memory_hotplug: fix unpaired mem_hotplug_begin/done

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, memory_hotplug: update pcp lists everytime onlining a memory block

Subsystem: mm/cleanups

    Randy Dunlap <rdunlap@infradead.org>:
      mm: drop duplicated words in <linux/pgtable.h>
      mm: drop duplicated words in <linux/mm.h>
      include/linux/highmem.h: fix duplicated words in a comment
      include/linux/frontswap.h:  drop duplicated word in a comment
      include/linux/memcontrol.h: drop duplicate word and fix spello

    Arvind Sankar <nivedita@alum.mit.edu>:
      sh/mm: drop unused MAX_PHYSADDR_BITS
      sparc: drop unused MAX_PHYSADDR_BITS

    Randy Dunlap <rdunlap@infradead.org>:
      mm/compaction.c: delete duplicated word
      mm/filemap.c: delete duplicated word
      mm/hmm.c: delete duplicated word
      mm/hugetlb.c: delete duplicated words
      mm/memcontrol.c: delete duplicated words
      mm/memory.c: delete duplicated words
      mm/migrate.c: delete duplicated word
      mm/nommu.c: delete duplicated words
      mm/page_alloc.c: delete or fix duplicated words
      mm/shmem.c: delete duplicated word
      mm/slab_common.c: delete duplicated word
      mm/usercopy.c: delete duplicated word
      mm/vmscan.c: delete or fix duplicated words
      mm/zpool.c: delete duplicated word and fix grammar
      mm/zsmalloc.c: fix duplicated words

Subsystem: mm/uaccess

    Christoph Hellwig <hch@lst.de>:
    Patch series "clean up address limit helpers", v2:
      syscalls: use uaccess_kernel in addr_limit_user_check
      nds32: use uaccess_kernel in show_regs
      riscv: include <asm/pgtable.h> in <asm/uaccess.h>
      uaccess: remove segment_eq
      uaccess: add force_uaccess_{begin,end} helpers
      exec: use force_uaccess_begin during exec and exit

Subsystem: alpha

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      alpha: fix annotation of io{read,write}{16,32}be()

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      include/linux/compiler-clang.h: drop duplicated word in a comment
      include/linux/exportfs.h: drop duplicated word in a comment
      include/linux/async_tx.h: drop duplicated word in a comment
      include/linux/xz.h: drop duplicated word

    Christoph Hellwig <hch@lst.de>:
      kernel: add a kernel_wait helper

    Feng Tang <feng.tang@intel.com>:
      ./Makefile: add debug option to enable function aligned on 32 bytes

    Arvind Sankar <nivedita@alum.mit.edu>:
      kernel.h: remove duplicate include of asm/div64.h

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      include/: replace HTTP links with HTTPS ones

    Matthew Wilcox <willy@infradead.org>:
      include/linux/poison.h: remove obsolete comment

Subsystem: sparse

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      sparse: group the defines by functionality

Subsystem: bitmap

    Stefano Brivio <sbrivio@redhat.com>:
    Patch series "lib: Fix bitmap_cut() for overlaps, add test":
      lib/bitmap.c: fix bitmap_cut() for partial overlapping case
      lib/test_bitmap.c: add test for bitmap_cut()

Subsystem: lib

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      lib/generic-radix-tree.c: remove unneeded __rcu

    Geert Uytterhoeven <geert@linux-m68k.org>:
      lib/test_bitops: do the full test during module init

    Wei Yongjun <weiyongjun1@huawei.com>:
      lib/test_lockup.c: make symbol 'test_works' static

    Tiezhu Yang <yangtiezhu@loongson.cn>:
      lib/Kconfig.debug: make TEST_LOCKUP depend on module
      lib/test_lockup.c: fix return value of test_lockup_init()

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      lib/: replace HTTP links with HTTPS ones

    "Kars Mulder" <kerneldev@karsmulder.nl>:
      kstrto*: correct documentation references to simple_strto*()
      kstrto*: do not describe simple_strto*() as obsolete/replaced

Subsystem: lz4

    Nick Terrell <terrelln@fb.com>:
      lz4: fix kernel decompression speed

Subsystem: bitops

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      lib/test_bits.c: add tests of GENMASK

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: add test for possible misuse of IS_ENABLED() without CONFIG_
      checkpatch: add --fix option for ASSIGN_IN_IF

    Quentin Monnet <quentin@isovalent.com>:
      checkpatch: fix CONST_STRUCT when const_structs.checkpatch is missing

    Joe Perches <joe@perches.com>:
      checkpatch: add test for repeated words
      checkpatch: remove missing switch/case break test

Subsystem: autofs

    Randy Dunlap <rdunlap@infradead.org>:
      autofs: fix doubled word

Subsystem: minix

    Eric Biggers <ebiggers@google.com>:
    Patch series "fs/minix: fix syzbot bugs and set s_maxbytes":
      fs/minix: check return value of sb_getblk()
      fs/minix: don't allow getting deleted inodes
      fs/minix: reject too-large maximum file size
      fs/minix: set s_maxbytes correctly
      fs/minix: fix block limit check for V1 filesystems
      fs/minix: remove expected error message in block_to_path()

Subsystem: nilfs

    Eric Biggers <ebiggers@google.com>:
    Patch series "nilfs2 updates":
      nilfs2: only call unlock_new_inode() if I_NEW

    Joe Perches <joe@perches.com>:
      nilfs2: convert __nilfs_msg to integrate the level and format
      nilfs2: use a more common logging style

Subsystem: ufs

    Colin Ian King <colin.king@canonical.com>:
      fs/ufs: avoid potential u32 multiplication overflow

Subsystem: fat

    Yubo Feng <fengyubo3@huawei.com>:
      fatfs: switch write_lock to read_lock in fat_ioctl_get_attributes

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      VFAT/FAT/MSDOS FILESYSTEM: replace HTTP links with HTTPS ones

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      fat: fix fat_ra_init() for data clusters == 0

Subsystem: signals

    Helge Deller <deller@gmx.de>:
      fs/signalfd.c: fix inconsistent return codes for signalfd4

Subsystem: kmod

    Tiezhu Yang <yangtiezhu@loongson.cn>:
    Patch series "kmod/umh: a few fixes":
      selftests: kmod: use variable NAME in kmod_test_0001()
      kmod: remove redundant "be an" in the comment
      test_kmod: avoid potential double free in trigger_config_run_type()

Subsystem: coredump

    Lepton Wu <ytht.net@gmail.com>:
      coredump: add %f for executable filename

Subsystem: exec

    Kees Cook <keescook@chromium.org>:
    Patch series "Relocate execve() sanity checks", v2:
      exec: change uselib(2) IS_SREG() failure to EACCES
      exec: move S_ISREG() check earlier
      exec: move path_noexec() check earlier

Subsystem: kdump

    Vijay Balakrishna <vijayb@linux.microsoft.com>:
      kdump: append kernel build-id string to VMCOREINFO

Subsystem: rapidio

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      drivers/rapidio/devices/rio_mport_cdev.c: use struct_size() helper
      drivers/rapidio/rio-scan.c: use struct_size() helper
      rapidio/rio_mport_cdev: use array_size() helper in copy_{from,to}_user()

Subsystem: panic

    Tiezhu Yang <yangtiezhu@loongson.cn>:
      kernel/panic.c: make oops_may_print() return bool
      lib/Kconfig.debug: fix typo in the help text of CONFIG_PANIC_TIMEOUT

    Yue Hu <huyue2@yulong.com>:
      panic: make print_oops_end_marker() static

Subsystem: kcov

    Marco Elver <elver@google.com>:
      kcov: unconditionally add -fno-stack-protector to compiler options

    Wei Yongjun <weiyongjun1@huawei.com>:
      kcov: make some symbols static

Subsystem: kgdb

    Nick Desaulniers <ndesaulniers@google.com>:
      scripts/gdb: fix python 3.8 SyntaxWarning

Subsystem: ipc

    Alexey Dobriyan <adobriyan@gmail.com>:
      ipc: uninline functions

    Liao Pingfang <liao.pingfang@zte.com.cn>:
      ipc/shm.c: remove the superfluous break

Subsystem: mm/migration

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
    Patch series "clean-up the migration target allocation functions", v5:
      mm/page_isolation: prefer the node of the source page
      mm/migrate: move migration helper from .h to .c
      mm/hugetlb: unify migration callbacks
      mm/migrate: clear __GFP_RECLAIM to make the migration callback consistent with regular THP allocations
      mm/migrate: introduce a standard migration target allocation function
      mm/mempolicy: use a standard migration target allocation callback
      mm/page_alloc: remove a wrapper for alloc_migration_target()

Subsystem: mm/gup

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/gup: restrict CMA region by using allocation scope API
      mm/hugetlb: make hugetlb migration callback CMA aware
      mm/gup: use a standard migration target allocation callback

Subsystem: mm/pagemap

    Peter Xu <peterx@redhat.com>:
    Patch series "mm: Page fault accounting cleanups", v5:
      mm: do page fault accounting in handle_mm_fault
      mm/alpha: use general page fault accounting
      mm/arc: use general page fault accounting
      mm/arm: use general page fault accounting
      mm/arm64: use general page fault accounting
      mm/csky: use general page fault accounting
      mm/hexagon: use general page fault accounting
      mm/ia64: use general page fault accounting
      mm/m68k: use general page fault accounting
      mm/microblaze: use general page fault accounting
      mm/mips: use general page fault accounting
      mm/nds32: use general page fault accounting
      mm/nios2: use general page fault accounting
      mm/openrisc: use general page fault accounting
      mm/parisc: use general page fault accounting
      mm/powerpc: use general page fault accounting
      mm/riscv: use general page fault accounting
      mm/s390: use general page fault accounting
      mm/sh: use general page fault accounting
      mm/sparc32: use general page fault accounting
      mm/sparc64: use general page fault accounting
      mm/x86: use general page fault accounting
      mm/xtensa: use general page fault accounting
      mm: clean up the last pieces of page fault accountings
      mm/gup: remove task_struct pointer for all gup code

 Documentation/admin-guide/cgroup-v2.rst         |    4 
 Documentation/admin-guide/sysctl/kernel.rst     |    3 
 Documentation/admin-guide/sysctl/vm.rst         |   15 +
 Documentation/filesystems/proc.rst              |   11 -
 Documentation/vm/page_migration.rst             |   27 +++
 Makefile                                        |    4 
 arch/alpha/include/asm/io.h                     |    8 
 arch/alpha/include/asm/uaccess.h                |    2 
 arch/alpha/mm/fault.c                           |   10 -
 arch/arc/include/asm/segment.h                  |    3 
 arch/arc/kernel/process.c                       |    2 
 arch/arc/mm/fault.c                             |   20 --
 arch/arm/include/asm/uaccess.h                  |    4 
 arch/arm/kernel/signal.c                        |    2 
 arch/arm/mm/fault.c                             |   27 ---
 arch/arm64/include/asm/uaccess.h                |    2 
 arch/arm64/kernel/sdei.c                        |    2 
 arch/arm64/mm/fault.c                           |   31 ---
 arch/arm64/mm/numa.c                            |   10 -
 arch/csky/include/asm/segment.h                 |    2 
 arch/csky/mm/fault.c                            |   15 -
 arch/h8300/include/asm/segment.h                |    2 
 arch/hexagon/mm/vm_fault.c                      |   11 -
 arch/ia64/include/asm/uaccess.h                 |    2 
 arch/ia64/mm/fault.c                            |   11 -
 arch/ia64/mm/numa.c                             |    2 
 arch/m68k/include/asm/segment.h                 |    2 
 arch/m68k/include/asm/tlbflush.h                |    6 
 arch/m68k/mm/fault.c                            |   16 -
 arch/microblaze/include/asm/uaccess.h           |    2 
 arch/microblaze/mm/fault.c                      |   11 -
 arch/mips/include/asm/uaccess.h                 |    2 
 arch/mips/kernel/unaligned.c                    |   27 +--
 arch/mips/mm/fault.c                            |   16 -
 arch/nds32/include/asm/uaccess.h                |    2 
 arch/nds32/kernel/process.c                     |    2 
 arch/nds32/mm/alignment.c                       |    7 
 arch/nds32/mm/fault.c                           |   21 --
 arch/nios2/include/asm/uaccess.h                |    2 
 arch/nios2/mm/fault.c                           |   16 -
 arch/openrisc/include/asm/uaccess.h             |    2 
 arch/openrisc/mm/fault.c                        |   11 -
 arch/parisc/include/asm/uaccess.h               |    2 
 arch/parisc/mm/fault.c                          |   10 -
 arch/powerpc/include/asm/uaccess.h              |    3 
 arch/powerpc/mm/copro_fault.c                   |    7 
 arch/powerpc/mm/fault.c                         |   13 -
 arch/riscv/include/asm/uaccess.h                |    6 
 arch/riscv/mm/fault.c                           |   18 --
 arch/s390/include/asm/uaccess.h                 |    2 
 arch/s390/kvm/interrupt.c                       |    2 
 arch/s390/kvm/kvm-s390.c                        |    2 
 arch/s390/kvm/priv.c                            |    8 
 arch/s390/mm/fault.c                            |   18 --
 arch/s390/mm/gmap.c                             |    4 
 arch/sh/include/asm/segment.h                   |    3 
 arch/sh/include/asm/sparsemem.h                 |    4 
 arch/sh/kernel/traps_32.c                       |   12 -
 arch/sh/mm/fault.c                              |   13 -
 arch/sh/mm/init.c                               |    9 -
 arch/sparc/include/asm/sparsemem.h              |    1 
 arch/sparc/include/asm/uaccess_32.h             |    2 
 arch/sparc/include/asm/uaccess_64.h             |    2 
 arch/sparc/mm/fault_32.c                        |   15 -
 arch/sparc/mm/fault_64.c                        |   13 -
 arch/um/kernel/trap.c                           |    6 
 arch/x86/include/asm/uaccess.h                  |    2 
 arch/x86/mm/fault.c                             |   19 --
 arch/x86/mm/init_64.c                           |    9 +
 arch/x86/mm/numa.c                              |    1 
 arch/xtensa/include/asm/uaccess.h               |    2 
 arch/xtensa/mm/fault.c                          |   17 -
 drivers/firmware/arm_sdei.c                     |    5 
 drivers/gpu/drm/i915/gem/i915_gem_userptr.c     |    2 
 drivers/infiniband/core/umem_odp.c              |    2 
 drivers/iommu/amd/iommu_v2.c                    |    2 
 drivers/iommu/intel/svm.c                       |    3 
 drivers/rapidio/devices/rio_mport_cdev.c        |    7 
 drivers/rapidio/rio-scan.c                      |    8 
 drivers/vfio/vfio_iommu_type1.c                 |    4 
 fs/coredump.c                                   |   17 +
 fs/exec.c                                       |   38 ++--
 fs/fat/Kconfig                                  |    2 
 fs/fat/fatent.c                                 |    3 
 fs/fat/file.c                                   |    4 
 fs/hugetlbfs/inode.c                            |    6 
 fs/minix/inode.c                                |   48 ++++-
 fs/minix/itree_common.c                         |    8 
 fs/minix/itree_v1.c                             |   16 -
 fs/minix/itree_v2.c                             |   15 -
 fs/minix/minix.h                                |    1 
 fs/namei.c                                      |   10 -
 fs/nilfs2/alloc.c                               |   38 ++--
 fs/nilfs2/btree.c                               |   42 ++--
 fs/nilfs2/cpfile.c                              |   10 -
 fs/nilfs2/dat.c                                 |   14 -
 fs/nilfs2/direct.c                              |   14 -
 fs/nilfs2/gcinode.c                             |    2 
 fs/nilfs2/ifile.c                               |    4 
 fs/nilfs2/inode.c                               |   32 +--
 fs/nilfs2/ioctl.c                               |   37 ++--
 fs/nilfs2/mdt.c                                 |    2 
 fs/nilfs2/namei.c                               |    6 
 fs/nilfs2/nilfs.h                               |   18 +-
 fs/nilfs2/page.c                                |   11 -
 fs/nilfs2/recovery.c                            |   32 +--
 fs/nilfs2/segbuf.c                              |    2 
 fs/nilfs2/segment.c                             |   38 ++--
 fs/nilfs2/sufile.c                              |   29 +--
 fs/nilfs2/super.c                               |   73 ++++----
 fs/nilfs2/sysfs.c                               |   29 +--
 fs/nilfs2/the_nilfs.c                           |   85 ++++-----
 fs/open.c                                       |    6 
 fs/proc/base.c                                  |   11 +
 fs/proc/task_mmu.c                              |    4 
 fs/signalfd.c                                   |   10 -
 fs/ufs/super.c                                  |    2 
 include/asm-generic/uaccess.h                   |    4 
 include/clocksource/timer-ti-dm.h               |    2 
 include/linux/async_tx.h                        |    2 
 include/linux/btree.h                           |    2 
 include/linux/compaction.h                      |    6 
 include/linux/compiler-clang.h                  |    2 
 include/linux/compiler_types.h                  |   44 ++---
 include/linux/crash_core.h                      |    6 
 include/linux/delay.h                           |    2 
 include/linux/dma/k3-psil.h                     |    2 
 include/linux/dma/k3-udma-glue.h                |    2 
 include/linux/dma/ti-cppi5.h                    |    2 
 include/linux/exportfs.h                        |    2 
 include/linux/frontswap.h                       |    2 
 include/linux/fs.h                              |   10 +
 include/linux/generic-radix-tree.h              |    2 
 include/linux/highmem.h                         |    2 
 include/linux/huge_mm.h                         |    7 
 include/linux/hugetlb.h                         |   53 ++++--
 include/linux/irqchip/irq-omap-intc.h           |    2 
 include/linux/jhash.h                           |    2 
 include/linux/kernel.h                          |   12 -
 include/linux/leds-ti-lmu-common.h              |    2 
 include/linux/memcontrol.h                      |   12 +
 include/linux/mempolicy.h                       |   18 +-
 include/linux/migrate.h                         |   42 +---
 include/linux/mm.h                              |   20 +-
 include/linux/mmzone.h                          |   17 +
 include/linux/oom.h                             |    4 
 include/linux/pgtable.h                         |   12 -
 include/linux/platform_data/davinci-cpufreq.h   |    2 
 include/linux/platform_data/davinci_asp.h       |    2 
 include/linux/platform_data/elm.h               |    2 
 include/linux/platform_data/gpio-davinci.h      |    2 
 include/linux/platform_data/gpmc-omap.h         |    2 
 include/linux/platform_data/mtd-davinci-aemif.h |    2 
 include/linux/platform_data/omap-twl4030.h      |    2 
 include/linux/platform_data/uio_pruss.h         |    2 
 include/linux/platform_data/usb-omap.h          |    2 
 include/linux/poison.h                          |    4 
 include/linux/sched/mm.h                        |    8 
 include/linux/sched/task.h                      |    1 
 include/linux/soc/ti/k3-ringacc.h               |    2 
 include/linux/soc/ti/knav_qmss.h                |    2 
 include/linux/soc/ti/ti-msgmgr.h                |    2 
 include/linux/swap.h                            |   25 ++
 include/linux/syscalls.h                        |    2 
 include/linux/uaccess.h                         |   20 ++
 include/linux/vm_event_item.h                   |    3 
 include/linux/wkup_m3_ipc.h                     |    2 
 include/linux/xxhash.h                          |    2 
 include/linux/xz.h                              |    4 
 include/linux/zlib.h                            |    2 
 include/soc/arc/aux.h                           |    2 
 include/trace/events/migrate.h                  |   17 +
 include/uapi/linux/auto_dev-ioctl.h             |    2 
 include/uapi/linux/elf.h                        |    2 
 include/uapi/linux/map_to_7segment.h            |    2 
 include/uapi/linux/types.h                      |    2 
 include/uapi/linux/usb/ch9.h                    |    2 
 ipc/sem.c                                       |    3 
 ipc/shm.c                                       |    4 
 kernel/Makefile                                 |    2 
 kernel/crash_core.c                             |   50 +++++
 kernel/events/callchain.c                       |    5 
 kernel/events/core.c                            |    5 
 kernel/events/uprobes.c                         |    8 
 kernel/exit.c                                   |   18 +-
 kernel/futex.c                                  |    2 
 kernel/kcov.c                                   |    6 
 kernel/kmod.c                                   |    5 
 kernel/kthread.c                                |    5 
 kernel/panic.c                                  |    4 
 kernel/stacktrace.c                             |    5 
 kernel/sysctl.c                                 |   11 +
 kernel/umh.c                                    |   29 ---
 lib/Kconfig.debug                               |   27 ++-
 lib/Makefile                                    |    1 
 lib/bitmap.c                                    |    4 
 lib/crc64.c                                     |    2 
 lib/decompress_bunzip2.c                        |    2 
 lib/decompress_unlzma.c                         |    6 
 lib/kstrtox.c                                   |   20 --
 lib/lz4/lz4_compress.c                          |    4 
 lib/lz4/lz4_decompress.c                        |   18 +-
 lib/lz4/lz4defs.h                               |   10 +
 lib/lz4/lz4hc_compress.c                        |    2 
 lib/math/rational.c                             |    2 
 lib/rbtree.c                                    |    2 
 lib/test_bitmap.c                               |   58 ++++++
 lib/test_bitops.c                               |   18 +-
 lib/test_bits.c                                 |   75 ++++++++
 lib/test_kmod.c                                 |    2 
 lib/test_lockup.c                               |    6 
 lib/ts_bm.c                                     |    2 
 lib/xxhash.c                                    |    2 
 lib/xz/xz_crc32.c                               |    2 
 lib/xz/xz_dec_bcj.c                             |    2 
 lib/xz/xz_dec_lzma2.c                           |    2 
 lib/xz/xz_lzma2.h                               |    2 
 lib/xz/xz_stream.h                              |    2 
 mm/cma.c                                        |   40 +---
 mm/cma.h                                        |    4 
 mm/compaction.c                                 |  207 +++++++++++++++++++++--
 mm/filemap.c                                    |    2 
 mm/gup.c                                        |  195 ++++++----------------
 mm/hmm.c                                        |    5 
 mm/huge_memory.c                                |   23 --
 mm/hugetlb.c                                    |   93 ++++------
 mm/internal.h                                   |    9 -
 mm/khugepaged.c                                 |    2 
 mm/ksm.c                                        |    3 
 mm/maccess.c                                    |   22 +-
 mm/memcontrol.c                                 |   42 +++-
 mm/memory-failure.c                             |    7 
 mm/memory.c                                     |  107 +++++++++---
 mm/memory_hotplug.c                             |   30 ++-
 mm/mempolicy.c                                  |   49 +----
 mm/migrate.c                                    |  151 ++++++++++++++---
 mm/mmu_notifier.c                               |    9 -
 mm/nommu.c                                      |    4 
 mm/oom_kill.c                                   |   24 +-
 mm/page_alloc.c                                 |   14 +
 mm/page_isolation.c                             |   21 --
 mm/percpu-internal.h                            |   55 ++++++
 mm/percpu-km.c                                  |    5 
 mm/percpu-stats.c                               |   36 ++--
 mm/percpu-vm.c                                  |    5 
 mm/percpu.c                                     |  208 +++++++++++++++++++++---
 mm/process_vm_access.c                          |    2 
 mm/rmap.c                                       |    2 
 mm/shmem.c                                      |    5 
 mm/slab_common.c                                |    2 
 mm/swap.c                                       |   13 -
 mm/swap_state.c                                 |   80 +++++++--
 mm/swapfile.c                                   |    4 
 mm/usercopy.c                                   |    2 
 mm/userfaultfd.c                                |    2 
 mm/vmscan.c                                     |   36 ++--
 mm/vmstat.c                                     |   32 +++
 mm/workingset.c                                 |   23 +-
 mm/zpool.c                                      |    8 
 mm/zsmalloc.c                                   |    2 
 scripts/checkpatch.pl                           |  116 +++++++++----
 scripts/gdb/linux/rbtree.py                     |    4 
 security/tomoyo/domain.c                        |    2 
 tools/testing/selftests/cgroup/test_kmem.c      |   70 +++++++-
 tools/testing/selftests/kmod/kmod.sh            |    4 
 tools/testing/selftests/vm/hmm-tests.c          |   35 ++++
 virt/kvm/async_pf.c                             |    2 
 virt/kvm/kvm_main.c                             |    2 
 268 files changed, 2481 insertions(+), 1551 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-08-07  6:16 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-08-07  6:16 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- A few MM hotfixes

- kthread, tools, scripts, ntfs and ocfs2

- Some of MM



163 patches, based on d6efb3ac3e6c19ab722b28bdb9252bae0b9676b6.

Subsystems affected by this patch series:

  mm/pagemap
  mm/hofixes
  mm/pagealloc
  kthread
  tools
  scripts
  ntfs
  ocfs2
  mm/slab-generic
  mm/slab
  mm/slub
  mm/kcsan
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/mincore
  mm/sparsemem
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/hugetlb
  mm/vmscan

Subsystem: mm/pagemap

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/memory.c: avoid access flag update TLB flush for retried page fault

Subsystem: mm/hofixes

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate: fix migrate_pgmap_owner w/o CONFIG_MMU_NOTIFIER

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
      mm/shuffle: don't move pages between zones and don't read garbage memmaps

Subsystem: kthread

    Peter Zijlstra <peterz@infradead.org>:
      mm: fix kthread_use_mm() vs TLB invalidate

    Ilias Stamatis <stamatis.iliass@gmail.com>:
      kthread: remove incorrect comment in kthread_create_on_cpu()

Subsystem: tools

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      tools/: replace HTTP links with HTTPS ones

    Gaurav Singh <gaurav1086@gmail.com>:
      tools/testing/selftests/cgroup/cgroup_util.c: cg_read_strcmp: fix null pointer dereference

Subsystem: scripts

    Jialu Xu <xujialu@vimux.org>:
      scripts/tags.sh: collect compiled source precisely

    Nikolay Borisov <nborisov@suse.com>:
      scripts/bloat-o-meter: Support comparing library archives

    Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
      scripts/decode_stacktrace.sh: skip missing symbols
      scripts/decode_stacktrace.sh: guess basepath if not specified
      scripts/decode_stacktrace.sh: guess path to modules
      scripts/decode_stacktrace.sh: guess path to vmlinux by release name

    Joe Perches <joe@perches.com>:
      const_structs.checkpatch: add regulator_ops

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Luca Stefani <luca.stefani.ge1@gmail.com>:
      ntfs: fix ntfs_test_inode and ntfs_init_locked_inode function type

Subsystem: ocfs2

    Gang He <ghe@suse.com>:
      ocfs2: fix remounting needed after setfacl command

    Randy Dunlap <rdunlap@infradead.org>:
      ocfs2: suballoc.h: delete a duplicated word

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: change slot number type s16 to u16

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      ocfs2: replace HTTP links with HTTPS ones

    Pavel Machek <pavel@ucw.cz>:
      ocfs2: fix unbalanced locking

Subsystem: mm/slab-generic

    Waiman Long <longman@redhat.com>:
      mm, treewide: rename kzfree() to kfree_sensitive()

    William Kucharski <william.kucharski@oracle.com>:
      mm: ksize() should silently accept a NULL pointer

Subsystem: mm/slab

    Kees Cook <keescook@chromium.org>:
    Patch series "mm: Expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB":
      mm/slab: expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB
      mm/slab: add naive detection of double free

    Long Li <lonuxli.64@gmail.com>:
      mm, slab: check GFP_SLAB_BUG_MASK before alloc_pages in kmalloc_order

    Xiao Yang <yangx.jy@cn.fujitsu.com>:
      mm/slab.c: update outdated kmem_list3 in a comment

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "slub_debug fixes and improvements":
      mm, slub: extend slub_debug syntax for multiple blocks
      mm, slub: make some slub_debug related attributes read-only
      mm, slub: remove runtime allocation order changes
      mm, slub: make remaining slub_debug related attributes read-only
      mm, slub: make reclaim_account attribute read-only
      mm, slub: introduce static key for slub_debug()
      mm, slub: introduce kmem_cache_debug_flags()
      mm, slub: extend checks guarded by slub_debug static key
      mm, slab/slub: move and improve cache_from_obj()
      mm, slab/slub: improve error reporting and overhead of cache_from_obj()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/slub.c: drop lockdep_assert_held() from put_map()

Subsystem: mm/kcsan

    Marco Elver <elver@google.com>:
      mm, kcsan: instrument SLAB/SLUB free with "ASSERT_EXCLUSIVE_ACCESS"

Subsystem: mm/debug

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/debug_vm_pgtable: Add some more tests", v5:
      mm/debug_vm_pgtable: add tests validating arch helpers for core MM features
      mm/debug_vm_pgtable: add tests validating advanced arch page table helpers
      mm/debug_vm_pgtable: add debug prints for individual tests
      Documentation/mm: add descriptions for arch page table helpers

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Improvements for dump_page()", v2:
      mm/debug: handle page->mapping better in dump_page
      mm/debug: dump compound page information on a second line
      mm/debug: print head flags in dump_page
      mm/debug: switch dump_page to get_kernel_nofault
      mm/debug: print the inode number in dump_page
      mm/debug: print hashed address of struct page

    John Hubbard <jhubbard@nvidia.com>:
      mm, dump_page: do not crash with bad compound_mapcount()

Subsystem: mm/pagecache

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: filemap: clear idle flag for writes
      mm: filemap: add missing FGP_ flags in kerneldoc comment for pagecache_get_page

Subsystem: mm/gup

    Tang Yizhou <tangyizhou@huawei.com>:
      mm/gup.c: fix the comment of return value for populate_vma_page_range()

Subsystem: mm/swap

    Zhen Lei <thunder.leizhen@huawei.com>:
    Patch series "clean up some functions in mm/swap_slots.c":
      mm/swap_slots.c: simplify alloc_swap_slot_cache()
      mm/swap_slots.c: simplify enable_swap_slots_cache()
      mm/swap_slots.c: remove redundant check for swap_slot_cache_initialized

    Krzysztof Kozlowski <krzk@kernel.org>:
      mm: swap: fix kerneldoc of swap_vma_readahead()

    Xianting Tian <xianting_tian@126.com>:
      mm/page_io.c: use blk_io_schedule() for avoiding task hung in sync io

Subsystem: mm/shmem

    Chris Down <chris@chrisdown.name>:
    Patch series "tmpfs: inode: Reduce risk of inum overflow", v7:
      tmpfs: per-superblock i_ino support
      tmpfs: support 64-bit inums per-sb

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: kmem: make memcg_kmem_enabled() irreversible
    Patch series "The new cgroup slab memory controller", v7:
      mm: memcg: factor out memcg- and lruvec-level changes out of __mod_lruvec_state()
      mm: memcg: prepare for byte-sized vmstat items
      mm: memcg: convert vmstat slab counters to bytes
      mm: slub: implement SLUB version of obj_to_index()

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: decouple reference counting from page accounting

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: obj_cgroup API
      mm: memcg/slab: allocate obj_cgroups for non-root slab pages
      mm: memcg/slab: save obj_cgroup for non-root slab objects
      mm: memcg/slab: charge individual slab objects instead of pages
      mm: memcg/slab: deprecate memory.kmem.slabinfo
      mm: memcg/slab: move memcg_kmem_bypass() to memcontrol.h
      mm: memcg/slab: use a single set of kmem_caches for all accounted allocations
      mm: memcg/slab: simplify memcg cache creation
      mm: memcg/slab: remove memcg_kmem_get_cache()
      mm: memcg/slab: deprecate slab_root_caches
      mm: memcg/slab: remove redundant check in memcg_accumulate_slabinfo()
      mm: memcg/slab: use a single set of kmem_caches for all allocations
      kselftests: cgroup: add kernel memory accounting tests
      tools/cgroup: add memcg_slabinfo.py tool

    Shakeel Butt <shakeelb@google.com>:
      mm: memcontrol: account kernel stack per node

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: remove unused argument by charge_slab_page()
      mm: slab: rename (un)charge_slab_page() to (un)account_slab_page()
      mm: kmem: switch to static_branch_likely() in memcg_kmem_enabled()
      mm: memcontrol: avoid workload stalls when lowering memory.high

    Chris Down <chris@chrisdown.name>:
    Patch series "mm, memcg: reclaim harder before high throttling", v2:
      mm, memcg: reclaim more aggressively before high allocator throttling
      mm, memcg: unify reclaim retry limits with page allocator

    Yafang Shao <laoar.shao@gmail.com>:
    Patch series "mm, memcg: memory.{low,min} reclaim fix & cleanup", v4:
      mm, memcg: avoid stale protection values when cgroup is above protection

    Chris Down <chris@chrisdown.name>:
      mm, memcg: decouple e{low,min} state mutations from protection checks

    Yafang Shao <laoar.shao@gmail.com>:
      memcg, oom: check memcg margin for parallel oom

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: restore proper dirty throttling when memory.high changes
      mm: memcontrol: don't count limit-setting reclaim as memory pressure

    Michal Koutný <mkoutny@suse.com>:
      mm/page_counter.c: fix protection usage propagation

Subsystem: mm/pagemap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: remove redundant check non_swap_entry()

    Alex Zhang <zhangalex@google.com>:
      mm/memory.c: make remap_pfn_range() reject unaligned addr

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: cleanup usage of <asm/pgalloc.h>":
      mm: remove unneeded includes of <asm/pgalloc.h>
      opeinrisc: switch to generic version of pte allocation
      xtensa: switch to generic version of pte allocation
      asm-generic: pgalloc: provide generic pmd_alloc_one() and pmd_free_one()
      asm-generic: pgalloc: provide generic pud_alloc_one() and pud_free_one()
      asm-generic: pgalloc: provide generic pgd_free()
      mm: move lib/ioremap.c to mm/

    Joerg Roedel <jroedel@suse.de>:
      mm: move p?d_alloc_track to separate header file

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm/mmap: optimize a branch judgment in ksys_mmap_pgoff()

    Feng Tang <feng.tang@intel.com>:
    Patch series "make vm_committed_as_batch aware of vm overcommit policy", v6:
      proc/meminfo: avoid open coded reading of vm_committed_as
      mm/util.c: make vm_memory_committed() more accurate
      percpu_counter: add percpu_counter_sync()
      mm: adjust vm_committed_as_batch according to vm overcommit policy

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "arm64: Enable vmemmap mapping from device memory", v4:
      mm/sparsemem: enable vmem_altmap support in vmemmap_populate_basepages()
      mm/sparsemem: enable vmem_altmap support in vmemmap_alloc_block_buf()
      arm64/mm: enable vmem_altmap support for vmemmap mappings

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: mmap: merge vma after call_mmap() if possible

    Peter Collingbourne <pcc@google.com>:
      mm: remove unnecessary wrapper function do_mmap_pgoff()

Subsystem: mm/mremap

    Wei Yang <richard.weiyang@linux.alibaba.com>:
    Patch series "mm/mremap: cleanup move_page_tables() a little", v5:
      mm/mremap: it is sure to have enough space when extent meets requirement
      mm/mremap: calculate extent in one place
      mm/mremap: start addresses are properly aligned

Subsystem: mm/mincore

    Ricardo Cañuelo <ricardo.canuelo@collabora.com>:
      selftests: add mincore() tests

Subsystem: mm/sparsemem

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/sparse: never partially remove memmap for early section
      mm/sparse: only sub-section aligned range would be populated

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/sparse: cleanup the code surrounding memory_present()

Subsystem: mm/vmalloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      vmalloc: convert to XArray

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: simplify merge_or_add_vmap_area()
      mm/vmalloc: simplify augment_tree_propagate_check()
      mm/vmalloc: switch to "propagate()" callback
      mm/vmalloc: update the header about KVA rework

    Mike Rapoport <rppt@linux.ibm.com>:
      mm: vmalloc: remove redundant assignment in unmap_kernel_range_noflush()

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc.c: remove BUG() from the find_va_links()

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: improve and simplify Kconfig.kasan
      kasan: update required compiler versions in documentation

    Walter Wu <walter-zh.wu@mediatek.com>:
    Patch series "kasan: memorize and print call_rcu stack", v8:
      rcu: kasan: record and print call_rcu() call stack
      kasan: record and print the free track
      kasan: add tests for call_rcu stack recording
      kasan: update documentation for generic kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kasan: remove kasan_unpoison_stack_above_sp_to()

    Walter Wu <walter-zh.wu@mediatek.com>:
      lib/test_kasan.c: fix KASAN unit tests for tag-based KASAN

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: support stack instrumentation for tag-based mode", v2:
      kasan: don't tag stacks allocated with pagealloc
      efi: provide empty efi_enter_virtual_mode implementation
      kasan, arm64: don't instrument functions that enable kasan
      kasan: allow enabling stack tagging for tag-based mode
      kasan: adjust kasan_stack_oob for tag-based mode

Subsystem: mm/pagealloc

    Vlastimil Babka <vbabka@suse.cz>:
      mm, page_alloc: use unlikely() in task_capc()

    Jaewon Kim <jaewon31.kim@samsung.com>:
      page_alloc: consider highatomic reserve in watermark fast

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, page_alloc: skip ->waternark_boost for atomic order-0 allocations

    David Hildenbrand <david@redhat.com>:
      mm: remove vm_total_pages
      mm/page_alloc: remove nr_free_pagecache_pages()
      mm/memory_hotplug: document why shuffle_zone() is relevant
      mm/shuffle: remove dynamic reconfiguration

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/page_alloc.c: replace the definition of NR_MIGRATETYPE_BITS with PB_migratetype_bits
      mm/page_alloc.c: extract the common part in pfn_to_bitidx()
      mm/page_alloc.c: simplify pageblock bitmap access
      mm/page_alloc.c: remove unnecessary end_bitidx for [set|get]_pfnblock_flags_mask()

    Qian Cai <cai@lca.pw>:
      mm/page_alloc: silence a KASAN false positive

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/page_alloc: fallbacks at most has 3 elements

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_alloc.c: skip setting nodemask when we are in interrupt

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/page_alloc: fix memalloc_nocma_{save/restore} APIs

Subsystem: mm/hugetlb

    "Alexander A. Klimov" <grandmaster@al2klimov.de>:
      mm: thp: replace HTTP links with HTTPS ones

    Peter Xu <peterx@redhat.com>:
      mm/hugetlb: fix calculation of adjust_range_if_pmd_sharing_possible

    Hugh Dickins <hughd@google.com>:
      khugepaged: collapse_pte_mapped_thp() flush the right range
      khugepaged: collapse_pte_mapped_thp() protect the pmd lock
      khugepaged: retract_page_tables() remember to test exit
      khugepaged: khugepaged_test_exit() check mmget_still_valid()

Subsystem: mm/vmscan

    dylan-meiners <spacct.spacct@gmail.com>:
      mm/vmscan.c: fix typo

    Shakeel Butt <shakeelb@google.com>:
      mm: vmscan: consistent update to pgrefill

 Documentation/admin-guide/kernel-parameters.txt        |    2 
 Documentation/dev-tools/kasan.rst                      |   10 
 Documentation/filesystems/dlmfs.rst                    |    2 
 Documentation/filesystems/ocfs2.rst                    |    2 
 Documentation/filesystems/tmpfs.rst                    |   18 
 Documentation/vm/arch_pgtable_helpers.rst              |  258 +++++
 Documentation/vm/memory-model.rst                      |    9 
 Documentation/vm/slub.rst                              |   51 -
 arch/alpha/include/asm/pgalloc.h                       |   21 
 arch/alpha/include/asm/tlbflush.h                      |    1 
 arch/alpha/kernel/core_irongate.c                      |    1 
 arch/alpha/kernel/core_marvel.c                        |    1 
 arch/alpha/kernel/core_titan.c                         |    1 
 arch/alpha/kernel/machvec_impl.h                       |    2 
 arch/alpha/kernel/smp.c                                |    1 
 arch/alpha/mm/numa.c                                   |    1 
 arch/arc/mm/fault.c                                    |    1 
 arch/arc/mm/init.c                                     |    1 
 arch/arm/include/asm/pgalloc.h                         |   12 
 arch/arm/include/asm/tlb.h                             |    1 
 arch/arm/kernel/machine_kexec.c                        |    1 
 arch/arm/kernel/smp.c                                  |    1 
 arch/arm/kernel/suspend.c                              |    1 
 arch/arm/mach-omap2/omap-mpuss-lowpower.c              |    1 
 arch/arm/mm/hugetlbpage.c                              |    1 
 arch/arm/mm/init.c                                     |    9 
 arch/arm/mm/mmu.c                                      |    1 
 arch/arm64/include/asm/pgalloc.h                       |   39 
 arch/arm64/kernel/setup.c                              |    2 
 arch/arm64/kernel/smp.c                                |    1 
 arch/arm64/mm/hugetlbpage.c                            |    1 
 arch/arm64/mm/init.c                                   |    6 
 arch/arm64/mm/ioremap.c                                |    1 
 arch/arm64/mm/mmu.c                                    |   63 -
 arch/csky/include/asm/pgalloc.h                        |    7 
 arch/csky/kernel/smp.c                                 |    1 
 arch/hexagon/include/asm/pgalloc.h                     |    7 
 arch/ia64/include/asm/pgalloc.h                        |   24 
 arch/ia64/include/asm/tlb.h                            |    1 
 arch/ia64/kernel/process.c                             |    1 
 arch/ia64/kernel/smp.c                                 |    1 
 arch/ia64/kernel/smpboot.c                             |    1 
 arch/ia64/mm/contig.c                                  |    1 
 arch/ia64/mm/discontig.c                               |    4 
 arch/ia64/mm/hugetlbpage.c                             |    1 
 arch/ia64/mm/tlb.c                                     |    1 
 arch/m68k/include/asm/mmu_context.h                    |    2 
 arch/m68k/include/asm/sun3_pgalloc.h                   |    7 
 arch/m68k/kernel/dma.c                                 |    2 
 arch/m68k/kernel/traps.c                               |    3 
 arch/m68k/mm/cache.c                                   |    2 
 arch/m68k/mm/fault.c                                   |    1 
 arch/m68k/mm/kmap.c                                    |    2 
 arch/m68k/mm/mcfmmu.c                                  |    1 
 arch/m68k/mm/memory.c                                  |    1 
 arch/m68k/sun3x/dvma.c                                 |    2 
 arch/microblaze/include/asm/pgalloc.h                  |    6 
 arch/microblaze/include/asm/tlbflush.h                 |    1 
 arch/microblaze/kernel/process.c                       |    1 
 arch/microblaze/kernel/signal.c                        |    1 
 arch/microblaze/mm/init.c                              |    3 
 arch/mips/include/asm/pgalloc.h                        |   19 
 arch/mips/kernel/setup.c                               |    8 
 arch/mips/loongson64/numa.c                            |    1 
 arch/mips/sgi-ip27/ip27-memory.c                       |    2 
 arch/mips/sgi-ip32/ip32-memory.c                       |    1 
 arch/nds32/mm/mm-nds32.c                               |    2 
 arch/nios2/include/asm/pgalloc.h                       |    7 
 arch/openrisc/include/asm/pgalloc.h                    |   33 
 arch/openrisc/include/asm/tlbflush.h                   |    1 
 arch/openrisc/kernel/or32_ksyms.c                      |    1 
 arch/parisc/include/asm/mmu_context.h                  |    1 
 arch/parisc/include/asm/pgalloc.h                      |   12 
 arch/parisc/kernel/cache.c                             |    1 
 arch/parisc/kernel/pci-dma.c                           |    1 
 arch/parisc/kernel/process.c                           |    1 
 arch/parisc/kernel/signal.c                            |    1 
 arch/parisc/kernel/smp.c                               |    1 
 arch/parisc/mm/hugetlbpage.c                           |    1 
 arch/parisc/mm/init.c                                  |    5 
 arch/parisc/mm/ioremap.c                               |    2 
 arch/powerpc/include/asm/tlb.h                         |    1 
 arch/powerpc/mm/book3s64/hash_hugetlbpage.c            |    1 
 arch/powerpc/mm/book3s64/hash_pgtable.c                |    1 
 arch/powerpc/mm/book3s64/hash_tlb.c                    |    1 
 arch/powerpc/mm/book3s64/radix_hugetlbpage.c           |    1 
 arch/powerpc/mm/init_32.c                              |    1 
 arch/powerpc/mm/init_64.c                              |    4 
 arch/powerpc/mm/kasan/8xx.c                            |    1 
 arch/powerpc/mm/kasan/book3s_32.c                      |    1 
 arch/powerpc/mm/mem.c                                  |    3 
 arch/powerpc/mm/nohash/40x.c                           |    1 
 arch/powerpc/mm/nohash/8xx.c                           |    1 
 arch/powerpc/mm/nohash/fsl_booke.c                     |    1 
 arch/powerpc/mm/nohash/kaslr_booke.c                   |    1 
 arch/powerpc/mm/nohash/tlb.c                           |    1 
 arch/powerpc/mm/numa.c                                 |    1 
 arch/powerpc/mm/pgtable.c                              |    1 
 arch/powerpc/mm/pgtable_64.c                           |    1 
 arch/powerpc/mm/ptdump/hashpagetable.c                 |    2 
 arch/powerpc/mm/ptdump/ptdump.c                        |    1 
 arch/powerpc/platforms/pseries/cmm.c                   |    1 
 arch/riscv/include/asm/pgalloc.h                       |   18 
 arch/riscv/mm/fault.c                                  |    1 
 arch/riscv/mm/init.c                                   |    3 
 arch/s390/crypto/prng.c                                |    4 
 arch/s390/include/asm/tlb.h                            |    1 
 arch/s390/include/asm/tlbflush.h                       |    1 
 arch/s390/kernel/machine_kexec.c                       |    1 
 arch/s390/kernel/ptrace.c                              |    1 
 arch/s390/kvm/diag.c                                   |    1 
 arch/s390/kvm/priv.c                                   |    1 
 arch/s390/kvm/pv.c                                     |    1 
 arch/s390/mm/cmm.c                                     |    1 
 arch/s390/mm/init.c                                    |    1 
 arch/s390/mm/mmap.c                                    |    1 
 arch/s390/mm/pgtable.c                                 |    1 
 arch/sh/include/asm/pgalloc.h                          |    4 
 arch/sh/kernel/idle.c                                  |    1 
 arch/sh/kernel/machine_kexec.c                         |    1 
 arch/sh/mm/cache-sh3.c                                 |    1 
 arch/sh/mm/cache-sh7705.c                              |    1 
 arch/sh/mm/hugetlbpage.c                               |    1 
 arch/sh/mm/init.c                                      |    7 
 arch/sh/mm/ioremap_fixed.c                             |    1 
 arch/sh/mm/numa.c                                      |    3 
 arch/sh/mm/tlb-sh3.c                                   |    1 
 arch/sparc/include/asm/ide.h                           |    1 
 arch/sparc/include/asm/tlb_64.h                        |    1 
 arch/sparc/kernel/leon_smp.c                           |    1 
 arch/sparc/kernel/process_32.c                         |    1 
 arch/sparc/kernel/signal_32.c                          |    1 
 arch/sparc/kernel/smp_32.c                             |    1 
 arch/sparc/kernel/smp_64.c                             |    1 
 arch/sparc/kernel/sun4m_irq.c                          |    1 
 arch/sparc/mm/highmem.c                                |    1 
 arch/sparc/mm/init_64.c                                |    1 
 arch/sparc/mm/io-unit.c                                |    1 
 arch/sparc/mm/iommu.c                                  |    1 
 arch/sparc/mm/tlb.c                                    |    1 
 arch/um/include/asm/pgalloc.h                          |    9 
 arch/um/include/asm/pgtable-3level.h                   |    3 
 arch/um/kernel/mem.c                                   |   17 
 arch/x86/ia32/ia32_aout.c                              |    1 
 arch/x86/include/asm/mmu_context.h                     |    1 
 arch/x86/include/asm/pgalloc.h                         |   42 
 arch/x86/kernel/alternative.c                          |    1 
 arch/x86/kernel/apic/apic.c                            |    1 
 arch/x86/kernel/mpparse.c                              |    1 
 arch/x86/kernel/traps.c                                |    1 
 arch/x86/mm/fault.c                                    |    1 
 arch/x86/mm/hugetlbpage.c                              |    1 
 arch/x86/mm/init_32.c                                  |    2 
 arch/x86/mm/init_64.c                                  |   12 
 arch/x86/mm/kaslr.c                                    |    1 
 arch/x86/mm/pgtable_32.c                               |    1 
 arch/x86/mm/pti.c                                      |    1 
 arch/x86/platform/uv/bios_uv.c                         |    1 
 arch/x86/power/hibernate.c                             |    2 
 arch/xtensa/include/asm/pgalloc.h                      |   46 
 arch/xtensa/kernel/xtensa_ksyms.c                      |    1 
 arch/xtensa/mm/cache.c                                 |    1 
 arch/xtensa/mm/fault.c                                 |    1 
 crypto/adiantum.c                                      |    2 
 crypto/ahash.c                                         |    4 
 crypto/api.c                                           |    2 
 crypto/asymmetric_keys/verify_pefile.c                 |    4 
 crypto/deflate.c                                       |    2 
 crypto/drbg.c                                          |   10 
 crypto/ecc.c                                           |    8 
 crypto/ecdh.c                                          |    2 
 crypto/gcm.c                                           |    2 
 crypto/gf128mul.c                                      |    4 
 crypto/jitterentropy-kcapi.c                           |    2 
 crypto/rng.c                                           |    2 
 crypto/rsa-pkcs1pad.c                                  |    6 
 crypto/seqiv.c                                         |    2 
 crypto/shash.c                                         |    2 
 crypto/skcipher.c                                      |    2 
 crypto/testmgr.c                                       |    6 
 crypto/zstd.c                                          |    2 
 drivers/base/node.c                                    |   10 
 drivers/block/xen-blkback/common.h                     |    1 
 drivers/crypto/allwinner/sun8i-ce/sun8i-ce-cipher.c    |    2 
 drivers/crypto/allwinner/sun8i-ss/sun8i-ss-cipher.c    |    2 
 drivers/crypto/amlogic/amlogic-gxl-cipher.c            |    4 
 drivers/crypto/atmel-ecc.c                             |    2 
 drivers/crypto/caam/caampkc.c                          |   28 
 drivers/crypto/cavium/cpt/cptvf_main.c                 |    6 
 drivers/crypto/cavium/cpt/cptvf_reqmanager.c           |   12 
 drivers/crypto/cavium/nitrox/nitrox_lib.c              |    4 
 drivers/crypto/cavium/zip/zip_crypto.c                 |    6 
 drivers/crypto/ccp/ccp-crypto-rsa.c                    |    6 
 drivers/crypto/ccree/cc_aead.c                         |    4 
 drivers/crypto/ccree/cc_buffer_mgr.c                   |    4 
 drivers/crypto/ccree/cc_cipher.c                       |    6 
 drivers/crypto/ccree/cc_hash.c                         |    8 
 drivers/crypto/ccree/cc_request_mgr.c                  |    2 
 drivers/crypto/marvell/cesa/hash.c                     |    2 
 drivers/crypto/marvell/octeontx/otx_cptvf_main.c       |    6 
 drivers/crypto/marvell/octeontx/otx_cptvf_reqmgr.h     |    2 
 drivers/crypto/nx/nx.c                                 |    4 
 drivers/crypto/virtio/virtio_crypto_algs.c             |   12 
 drivers/crypto/virtio/virtio_crypto_core.c             |    2 
 drivers/iommu/ipmmu-vmsa.c                             |    1 
 drivers/md/dm-crypt.c                                  |   32 
 drivers/md/dm-integrity.c                              |    6 
 drivers/misc/ibmvmc.c                                  |    6 
 drivers/net/ethernet/hisilicon/hns3/hns3pf/hclge_mbx.c |    2 
 drivers/net/ethernet/intel/ixgbe/ixgbe_ipsec.c         |    6 
 drivers/net/ppp/ppp_mppe.c                             |    6 
 drivers/net/wireguard/noise.c                          |    4 
 drivers/net/wireguard/peer.c                           |    2 
 drivers/net/wireless/intel/iwlwifi/pcie/rx.c           |    2 
 drivers/net/wireless/intel/iwlwifi/pcie/tx-gen2.c      |    6 
 drivers/net/wireless/intel/iwlwifi/pcie/tx.c           |    6 
 drivers/net/wireless/intersil/orinoco/wext.c           |    4 
 drivers/s390/crypto/ap_bus.h                           |    4 
 drivers/staging/ks7010/ks_hostif.c                     |    2 
 drivers/staging/rtl8723bs/core/rtw_security.c          |    2 
 drivers/staging/wlan-ng/p80211netdev.c                 |    2 
 drivers/target/iscsi/iscsi_target_auth.c               |    2 
 drivers/xen/balloon.c                                  |    1 
 drivers/xen/privcmd.c                                  |    1 
 fs/Kconfig                                             |   21 
 fs/aio.c                                               |    6 
 fs/binfmt_elf_fdpic.c                                  |    1 
 fs/cifs/cifsencrypt.c                                  |    2 
 fs/cifs/connect.c                                      |   10 
 fs/cifs/dfs_cache.c                                    |    2 
 fs/cifs/misc.c                                         |    8 
 fs/crypto/inline_crypt.c                               |    5 
 fs/crypto/keyring.c                                    |    6 
 fs/crypto/keysetup_v1.c                                |    4 
 fs/ecryptfs/keystore.c                                 |    4 
 fs/ecryptfs/messaging.c                                |    2 
 fs/hugetlbfs/inode.c                                   |    2 
 fs/ntfs/dir.c                                          |    2 
 fs/ntfs/inode.c                                        |   27 
 fs/ntfs/inode.h                                        |    4 
 fs/ntfs/mft.c                                          |    4 
 fs/ocfs2/Kconfig                                       |    6 
 fs/ocfs2/acl.c                                         |    2 
 fs/ocfs2/blockcheck.c                                  |    2 
 fs/ocfs2/dlmglue.c                                     |    8 
 fs/ocfs2/ocfs2.h                                       |    4 
 fs/ocfs2/suballoc.c                                    |    4 
 fs/ocfs2/suballoc.h                                    |    2 
 fs/ocfs2/super.c                                       |    4 
 fs/proc/meminfo.c                                      |   10 
 include/asm-generic/pgalloc.h                          |   80 +
 include/asm-generic/tlb.h                              |    1 
 include/crypto/aead.h                                  |    2 
 include/crypto/akcipher.h                              |    2 
 include/crypto/gf128mul.h                              |    2 
 include/crypto/hash.h                                  |    2 
 include/crypto/internal/acompress.h                    |    2 
 include/crypto/kpp.h                                   |    2 
 include/crypto/skcipher.h                              |    2 
 include/linux/efi.h                                    |    4 
 include/linux/fs.h                                     |   17 
 include/linux/huge_mm.h                                |    2 
 include/linux/kasan.h                                  |    4 
 include/linux/memcontrol.h                             |  209 +++-
 include/linux/mm.h                                     |   86 -
 include/linux/mm_types.h                               |    5 
 include/linux/mman.h                                   |    4 
 include/linux/mmu_notifier.h                           |   13 
 include/linux/mmzone.h                                 |   54 -
 include/linux/pageblock-flags.h                        |   30 
 include/linux/percpu_counter.h                         |    4 
 include/linux/sched/mm.h                               |    8 
 include/linux/shmem_fs.h                               |    3 
 include/linux/slab.h                                   |   11 
 include/linux/slab_def.h                               |    9 
 include/linux/slub_def.h                               |   31 
 include/linux/swap.h                                   |    2 
 include/linux/vmstat.h                                 |   14 
 init/Kconfig                                           |    9 
 init/main.c                                            |    2 
 ipc/shm.c                                              |    2 
 kernel/fork.c                                          |   54 -
 kernel/kthread.c                                       |    8 
 kernel/power/snapshot.c                                |    2 
 kernel/rcu/tree.c                                      |    2 
 kernel/scs.c                                           |    2 
 kernel/sysctl.c                                        |    2 
 lib/Kconfig.kasan                                      |   39 
 lib/Makefile                                           |    1 
 lib/ioremap.c                                          |  287 -----
 lib/mpi/mpiutil.c                                      |    6 
 lib/percpu_counter.c                                   |   19 
 lib/test_kasan.c                                       |   87 +
 mm/Kconfig                                             |    6 
 mm/Makefile                                            |    2 
 mm/debug.c                                             |  103 +-
 mm/debug_vm_pgtable.c                                  |  666 +++++++++++++
 mm/filemap.c                                           |    9 
 mm/gup.c                                               |    3 
 mm/huge_memory.c                                       |   14 
 mm/hugetlb.c                                           |   25 
 mm/ioremap.c                                           |  289 +++++
 mm/kasan/common.c                                      |   41 
 mm/kasan/generic.c                                     |   43 
 mm/kasan/generic_report.c                              |    1 
 mm/kasan/kasan.h                                       |   25 
 mm/kasan/quarantine.c                                  |    1 
 mm/kasan/report.c                                      |   54 -
 mm/kasan/tags.c                                        |   37 
 mm/khugepaged.c                                        |   75 -
 mm/memcontrol.c                                        |  832 ++++++++++-------
 mm/memory.c                                            |   15 
 mm/memory_hotplug.c                                    |   11 
 mm/migrate.c                                           |    6 
 mm/mm_init.c                                           |   20 
 mm/mmap.c                                              |   45 
 mm/mremap.c                                            |   19 
 mm/nommu.c                                             |    6 
 mm/oom_kill.c                                          |    2 
 mm/page-writeback.c                                    |    6 
 mm/page_alloc.c                                        |  226 ++--
 mm/page_counter.c                                      |    6 
 mm/page_io.c                                           |    2 
 mm/pgalloc-track.h                                     |   51 +
 mm/shmem.c                                             |  133 ++
 mm/shuffle.c                                           |   46 
 mm/shuffle.h                                           |   17 
 mm/slab.c                                              |  129 +-
 mm/slab.h                                              |  755 ++++++---------
 mm/slab_common.c                                       |  829 ++--------------
 mm/slob.c                                              |   12 
 mm/slub.c                                              |  680 ++++---------
 mm/sparse-vmemmap.c                                    |   62 -
 mm/sparse.c                                            |   31 
 mm/swap_slots.c                                        |   45 
 mm/swap_state.c                                        |    2 
 mm/util.c                                              |   52 +
 mm/vmalloc.c                                           |  176 +--
 mm/vmscan.c                                            |   39 
 mm/vmstat.c                                            |   38 
 mm/workingset.c                                        |    6 
 net/atm/mpoa_caches.c                                  |    4 
 net/bluetooth/ecdh_helper.c                            |    6 
 net/bluetooth/smp.c                                    |   24 
 net/core/sock.c                                        |    2 
 net/ipv4/tcp_fastopen.c                                |    2 
 net/mac80211/aead_api.c                                |    4 
 net/mac80211/aes_gmac.c                                |    2 
 net/mac80211/key.c                                     |    2 
 net/mac802154/llsec.c                                  |   20 
 net/sctp/auth.c                                        |    2 
 net/sunrpc/auth_gss/gss_krb5_crypto.c                  |    4 
 net/sunrpc/auth_gss/gss_krb5_keys.c                    |    6 
 net/sunrpc/auth_gss/gss_krb5_mech.c                    |    2 
 net/tipc/crypto.c                                      |   10 
 net/wireless/core.c                                    |    2 
 net/wireless/ibss.c                                    |    4 
 net/wireless/lib80211_crypt_tkip.c                     |    2 
 net/wireless/lib80211_crypt_wep.c                      |    2 
 net/wireless/nl80211.c                                 |   24 
 net/wireless/sme.c                                     |    6 
 net/wireless/util.c                                    |    2 
 net/wireless/wext-sme.c                                |    2 
 scripts/Makefile.kasan                                 |    3 
 scripts/bloat-o-meter                                  |    2 
 scripts/coccinelle/free/devm_free.cocci                |    4 
 scripts/coccinelle/free/ifnullfree.cocci               |    4 
 scripts/coccinelle/free/kfree.cocci                    |    6 
 scripts/coccinelle/free/kfreeaddr.cocci                |    2 
 scripts/const_structs.checkpatch                       |    1 
 scripts/decode_stacktrace.sh                           |   85 +
 scripts/spelling.txt                                   |   19 
 scripts/tags.sh                                        |   18 
 security/apparmor/domain.c                             |    4 
 security/apparmor/include/file.h                       |    2 
 security/apparmor/policy.c                             |   24 
 security/apparmor/policy_ns.c                          |    6 
 security/apparmor/policy_unpack.c                      |   14 
 security/keys/big_key.c                                |    6 
 security/keys/dh.c                                     |   14 
 security/keys/encrypted-keys/encrypted.c               |   14 
 security/keys/trusted-keys/trusted_tpm1.c              |   34 
 security/keys/user_defined.c                           |    6 
 tools/cgroup/memcg_slabinfo.py                         |  226 ++++
 tools/include/linux/jhash.h                            |    2 
 tools/lib/rbtree.c                                     |    2 
 tools/lib/traceevent/event-parse.h                     |    2 
 tools/testing/ktest/examples/README                    |    2 
 tools/testing/ktest/examples/crosstests.conf           |    2 
 tools/testing/selftests/Makefile                       |    1 
 tools/testing/selftests/cgroup/.gitignore              |    1 
 tools/testing/selftests/cgroup/Makefile                |    2 
 tools/testing/selftests/cgroup/cgroup_util.c           |    2 
 tools/testing/selftests/cgroup/test_kmem.c             |  382 +++++++
 tools/testing/selftests/mincore/.gitignore             |    2 
 tools/testing/selftests/mincore/Makefile               |    6 
 tools/testing/selftests/mincore/mincore_selftest.c     |  361 +++++++
 397 files changed, 5547 insertions(+), 4072 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-07-24  4:14 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-07-24  4:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


15 patches, based on f37e99aca03f63aa3f2bd13ceaf769455d12c4b0.

Subsystems affected by this patch series:

  mm/pagemap
  mm/shmem
  mm/hotfixes
  mm/memcg
  mm/hugetlb
  mailmap
  squashfs
  scripts
  io-mapping
  MAINTAINERS
  gdb

Subsystem: mm/pagemap

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/memory.c: avoid access flag update TLB flush for retried page fault

    "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
      mm/mmap.c: close race between munmap() and expand_upwards()/downwards()

Subsystem: mm/shmem

    Chengguang Xu <cgxu519@mykernel.net>:
      vfs/xattr: mm/shmem: kernfs: release simple xattr entry in a right way

Subsystem: mm/hotfixes

    Tom Rix <trix@redhat.com>:
      mm: initialize return of vm_insert_pages

    Bhupesh Sharma <bhsharma@redhat.com>:
      mm/memcontrol: fix OOPS inside mem_cgroup_get_nr_swap_pages()

Subsystem: mm/memcg

    Hugh Dickins <hughd@google.com>:
      mm/memcg: fix refcount error while moving and swapping

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix memory leak at non-root kmem_cache destroy

Subsystem: mm/hugetlb

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/hugetlb: avoid hardcoding while checking if cma is enabled

    "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
      khugepaged: fix null-pointer dereference due to race

Subsystem: mailmap

    Mike Rapoport <rppt@linux.ibm.com>:
      mailmap: add entry for Mike Rapoport

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix length field overlap check in metadata reading

Subsystem: scripts

    Pi-Hsun Shih <pihsun@chromium.org>:
      scripts/decode_stacktrace: strip basepath from all paths

Subsystem: io-mapping

    "Michael J. Ruhl" <michael.j.ruhl@intel.com>:
      io-mapping: indicate mapping failure

Subsystem: MAINTAINERS

    Andrey Konovalov <andreyknvl@google.com>:
      MAINTAINERS: add KCOV section

Subsystem: gdb

    Stefano Garzarella <sgarzare@redhat.com>:
      scripts/gdb: fix lx-symbols 'gdb.error' while loading modules

 .mailmap                     |    3 +++
 MAINTAINERS                  |   11 +++++++++++
 fs/squashfs/block.c          |    2 +-
 include/linux/io-mapping.h   |    5 ++++-
 include/linux/xattr.h        |    3 ++-
 mm/hugetlb.c                 |   15 ++++++++++-----
 mm/khugepaged.c              |    3 +++
 mm/memcontrol.c              |   13 ++++++++++---
 mm/memory.c                  |    9 +++++++--
 mm/mmap.c                    |   16 ++++++++++++++--
 mm/shmem.c                   |    2 +-
 mm/slab_common.c             |   35 ++++++++++++++++++++++++++++-------
 scripts/decode_stacktrace.sh |    4 ++--
 scripts/gdb/linux/symbols.py |    2 +-
 14 files changed, 97 insertions(+), 26 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-07-03 22:14 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm

5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822.

Subsystems affected by this patch series:

  mm/hugetlb
  samples
  mm/cma
  mm/vmalloc
  mm/pagealloc

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb.c: fix pages per hugetlb calculation

Subsystem: samples

    Kees Cook <keescook@chromium.org>:
      samples/vfs: avoid warning in statx override

Subsystem: mm/cma

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/cma.c: use exact_nid true to fix possible per-numa cma leak

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
      vmalloc: fix the owner argument for the new __vmalloc_node_range callers

Subsystem: mm/pagealloc

    Joel Savitz <jsavitz@redhat.com>:
      mm/page_alloc: fix documentation error

 arch/arm64/kernel/probes/kprobes.c |    2 +-
 arch/x86/hyperv/hv_init.c          |    3 ++-
 kernel/module.c                    |    2 +-
 mm/cma.c                           |    4 ++--
 mm/hugetlb.c                       |    2 +-
 mm/page_alloc.c                    |    2 +-
 samples/vfs/test-statx.c           |    2 ++
 7 files changed, 10 insertions(+), 7 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-26 17:39   ` incoming Konstantin Ryabitsev
@ 2020-06-26 17:40     ` Konstantin Ryabitsev
  0 siblings, 0 replies; 188+ messages in thread
From: Konstantin Ryabitsev @ 2020-06-26 17:40 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits

On Fri, 26 Jun 2020 at 13:39, Konstantin Ryabitsev
<konstantin@linuxfoundation.org> wrote:
> > Konstantin, maybe mm-commits could be on lore too and then they'd have
> > been caught that way?
>
> Yes, I already have a request from Kees for linux-mm addition, so that
> should show up in archives before long.

correction: mm-commits, that is

-K


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-26  6:51 ` incoming Linus Torvalds
  2020-06-26  7:31   ` incoming Linus Torvalds
@ 2020-06-26 17:39   ` Konstantin Ryabitsev
  2020-06-26 17:40     ` incoming Konstantin Ryabitsev
  1 sibling, 1 reply; 188+ messages in thread
From: Konstantin Ryabitsev @ 2020-06-26 17:39 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits

On Thu, Jun 25, 2020 at 11:51:06PM -0700, Linus Torvalds wrote:
> On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.
> 
> You didn't cc lkml, so now none of the nice 'b4' automation seems to
> work for this series..
> 
> Yes, this cover-letter went to linux-mm (which is on lore), but the
> individual patches didn't.
> 
> Konstantin, maybe mm-commits could be on lore too and then they'd have
> been caught that way?

Yes, I already have a request from Kees for linux-mm addition, so that 
should show up in archives before long.

-K


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-26  6:51 ` incoming Linus Torvalds
@ 2020-06-26  7:31   ` Linus Torvalds
  2020-06-26 17:39   ` incoming Konstantin Ryabitsev
  1 sibling, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2020-06-26  7:31 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits

On Thu, Jun 25, 2020 at 11:51 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> You didn't cc lkml, so now none of the nice 'b4' automation seems to
> work for this series..

Note that I've picked them up the old-fashioned way, so don't re-send them.

So more of a note for "please, next time..."

                Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-26  3:28 incoming Andrew Morton
@ 2020-06-26  6:51 ` Linus Torvalds
  2020-06-26  7:31   ` incoming Linus Torvalds
  2020-06-26 17:39   ` incoming Konstantin Ryabitsev
  0 siblings, 2 replies; 188+ messages in thread
From: Linus Torvalds @ 2020-06-26  6:51 UTC (permalink / raw)
  To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits

On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.

You didn't cc lkml, so now none of the nice 'b4' automation seems to
work for this series..

Yes, this cover-letter went to linux-mm (which is on lore), but the
individual patches didn't.

Konstantin, maybe mm-commits could be on lore too and then they'd have
been caught that way?

                   Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-26  3:28 Andrew Morton
  2020-06-26  6:51 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2020-06-26  3:28 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits

32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.

Subsystems affected by this patch series:

  hotfixes
  mm/pagealloc
  kexec
  ocfs2
  lib
  misc
  mm/slab
  mm/slab
  mm/slub
  mm/swap
  mm/pagemap
  mm/vmalloc
  mm/memcg
  mm/gup
  mm/thp
  mm/vmscan
  x86
  mm/memory-hotplug
  MAINTAINERS

Subsystem: hotfixes

    Stafford Horne <shorne@gmail.com>:
      openrisc: fix boot oops when DEBUG_VM is enabled

    Michal Hocko <mhocko@suse.com>:
      mm: do_swap_page(): fix up the error code

Subsystem: mm/pagealloc

    Vlastimil Babka <vbabka@suse.cz>:
      mm, compaction: make capture control handling safe wrt interrupts

Subsystem: kexec

    Lianbo Jiang <lijiang@redhat.com>:
      kexec: do not verify the signature without the lockdown or mandatory signature

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
    Patch series "ocfs2: fix nfsd over ocfs2 issues", v2:
      ocfs2: avoid inode removal while nfsd is accessing it
      ocfs2: load global_inode_alloc
      ocfs2: fix panic on nfs server over ocfs2
      ocfs2: fix value of OCFS2_INVALID_SLOT

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: fix test_hmm.c reference after free

Subsystem: misc

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      linux/bits.h: fix unsigned less than zero warnings

Subsystem: mm/slab

    Waiman Long <longman@redhat.com>:
      mm, slab: fix sign conversion problem in memcg_uncharge_slab()

Subsystem: mm/slab

    Waiman Long <longman@redhat.com>:
      mm/slab: use memzero_explicit() in kzfree()

Subsystem: mm/slub

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      slub: cure list_slab_objects() from double fix

Subsystem: mm/swap

    Hugh Dickins <hughd@google.com>:
      mm: fix swap cache node allocation mask

Subsystem: mm/pagemap

    Arjun Roy <arjunroy@google.com>:
      mm/memory.c: properly pte_offset_map_lock/unlock in vm_insert_pages()

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm/debug_vm_pgtable: fix build failure with powerpc 8xx

    Stephen Rothwell <sfr@canb.auug.org.au>:
      make asm-generic/cacheflush.h more standalone

    Nathan Chancellor <natechancellor@gmail.com>:
      media: omap3isp: remove cacheflush.h

Subsystem: mm/vmalloc

    Masanari Iida <standby24x7@gmail.com>:
      mm/vmalloc.c: fix a warning while make xmldocs

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: handle div0 crash race condition in memory.low

    Muchun Song <songmuchun@bytedance.com>:
      mm/memcontrol.c: add missed css_put()

    Chris Down <chris@chrisdown.name>:
      mm/memcontrol.c: prevent missed memory.low load tears

Subsystem: mm/gup

    Souptick Joarder <jrdr.linux@gmail.com>:
      docs: mm/gup: minor documentation update

Subsystem: mm/thp

    Yang Shi <yang.shi@linux.alibaba.com>:
      doc: THP CoW fault no longer allocate THP

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "fix for "mm: balance LRU lists based on relative thrashing" patchset":
      mm: workingset: age nonresident information alongside anonymous pages

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/swap: fix for "mm: workingset: age nonresident information alongside anonymous pages"
      mm/memory: fix IO cost for anonymous page

Subsystem: x86

    Christoph Hellwig <hch@lst.de>:
    Patch series "fix a hyperv W^X violation and remove vmalloc_exec":
      x86/hyperv: allocate the hypercall page with only read and execute bits
      arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page
      mm: remove vmalloc_exec

Subsystem: mm/memory-hotplug

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/memory_hotplug.c: fix false softlockup during pfn range removal

Subsystem: MAINTAINERS

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      MAINTAINERS: update info for sparse

 Documentation/admin-guide/cgroup-v2.rst    |    4 +-
 Documentation/admin-guide/mm/transhuge.rst |    3 -
 Documentation/core-api/pin_user_pages.rst  |    2 -
 MAINTAINERS                                |    4 +-
 arch/arm64/kernel/probes/kprobes.c         |   12 +------
 arch/openrisc/kernel/dma.c                 |    5 +++
 arch/x86/hyperv/hv_init.c                  |    4 +-
 arch/x86/include/asm/pgtable_types.h       |    2 +
 drivers/media/platform/omap3isp/isp.c      |    2 -
 drivers/media/platform/omap3isp/ispvideo.c |    1 
 fs/ocfs2/dlmglue.c                         |   17 ++++++++++
 fs/ocfs2/ocfs2.h                           |    1 
 fs/ocfs2/ocfs2_fs.h                        |    4 +-
 fs/ocfs2/suballoc.c                        |    9 +++--
 include/asm-generic/cacheflush.h           |    5 +++
 include/linux/bits.h                       |    3 +
 include/linux/mmzone.h                     |    4 +-
 include/linux/swap.h                       |    1 
 include/linux/vmalloc.h                    |    1 
 kernel/kexec_file.c                        |   36 ++++------------------
 kernel/module.c                            |    4 +-
 lib/test_hmm.c                             |    3 -
 mm/compaction.c                            |   17 ++++++++--
 mm/debug_vm_pgtable.c                      |    4 +-
 mm/memcontrol.c                            |   18 ++++++++---
 mm/memory.c                                |   33 +++++++++++++-------
 mm/memory_hotplug.c                        |   13 ++++++--
 mm/nommu.c                                 |   17 ----------
 mm/slab.h                                  |    4 +-
 mm/slab_common.c                           |    2 -
 mm/slub.c                                  |   19 ++---------
 mm/swap.c                                  |    3 -
 mm/swap_state.c                            |    4 +-
 mm/vmalloc.c                               |   21 -------------
 mm/vmscan.c                                |    3 +
 mm/workingset.c                            |   46 +++++++++++++++++------------
 36 files changed, 168 insertions(+), 163 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-12  0:30 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-06-12  0:30 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


A few fixes and stragglers.


5 patches, based on 623f6dc593eaf98b91916836785278eddddaacf8.

Subsystems affected by this patch series:

  mm/memory-failure
  ocfs2
  lib/lzo
  misc

Subsystem: mm/memory-failure

    Naoya Horiguchi <nao.horiguchi@gmail.com>:
    Patch series "hwpoison: fixes signaling on memory error":
      mm/memory-failure: prioritize prctl(PR_MCE_KILL) over vm.memory_failure_early_kill
      mm/memory-failure: send SIGBUS(BUS_MCEERR_AR) only to current thread

Subsystem: ocfs2

    Tom Seewald <tseewald@gmail.com>:
      ocfs2: fix build failure when TCP/IP is disabled

Subsystem: lib/lzo

    Dave Rodgman <dave.rodgman@arm.com>:
      lib/lzo: fix ambiguous encoding bug in lzo-rle

Subsystem: misc

    Christoph Hellwig <hch@lst.de>:
      amdgpu: a NULL ->mm does not mean a thread is a kthread

 Documentation/lzo.txt                      |    8 ++++-
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h |    2 -
 fs/ocfs2/Kconfig                           |    2 -
 lib/lzo/lzo1x_compress.c                   |   13 ++++++++
 mm/memory-failure.c                        |   43 +++++++++++++++++------------
 5 files changed, 47 insertions(+), 21 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-11  1:40 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-06-11  1:40 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- various hotfixes and minor things

- hch's use_mm/unuse_mm clearnups

- new syscall process_madvise(): perform madvise() on a process other
  than self

25 patches, based on 6f630784cc0d92fb58ea326e2bc01aa056279ecb.

Subsystems affected by this patch series:

  mm/hugetlb
  scripts
  kcov
  lib
  nilfs
  checkpatch
  lib
  mm/debug
  ocfs2
  lib
  misc
  mm/madvise

Subsystem: mm/hugetlb

    Dan Carpenter <dan.carpenter@oracle.com>:
      khugepaged: selftests: fix timeout condition in wait_for_scan()

Subsystem: scripts

    SeongJae Park <sjpark@amazon.de>:
      scripts/spelling: add a few more typos

Subsystem: kcov

    Andrey Konovalov <andreyknvl@google.com>:
      kcov: check kcov_softirq in kcov_remote_stop()

Subsystem: lib

    Joe Perches <joe@perches.com>:
      lib/lz4/lz4_decompress.c: document deliberate use of `&'

Subsystem: nilfs

    Ryusuke Konishi <konishi.ryusuke@gmail.com>:
      nilfs2: fix null pointer dereference at nilfs_segctor_do_construct()

Subsystem: checkpatch

    Tim Froidcoeur <tim.froidcoeur@tessares.net>:
      checkpatch: correct check for kernel parameters doc

Subsystem: lib

    Alexander Gordeev <agordeev@linux.ibm.com>:
      lib: fix bitmap_parse() on 64-bit big endian archs

Subsystem: mm/debug

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/debug_vm_pgtable: fix kernel crash by checking for THP support

Subsystem: ocfs2

    Keyur Patel <iamkeyur96@gmail.com>:
      ocfs2: fix spelling mistake and grammar

    Ben Widawsky <ben.widawsky@intel.com>:
      mm: add comments on pglist_data zones

Subsystem: lib

    Wei Yang <richard.weiyang@gmail.com>:
      lib: test get_count_order/long in test_bitops.c

Subsystem: misc

    Walter Wu <walter-zh.wu@mediatek.com>:
      stacktrace: cleanup inconsistent variable type

    Christoph Hellwig <hch@lst.de>:
    Patch series "improve use_mm / unuse_mm", v2:
      kernel: move use_mm/unuse_mm to kthread.c
      kernel: move use_mm/unuse_mm to kthread.c
      kernel: better document the use_mm/unuse_mm API contract
      kernel: set USER_DS in kthread_use_mm

Subsystem: mm/madvise

    Minchan Kim <minchan@kernel.org>:
    Patch series "introduce memory hinting API for external process", v7:
      mm/madvise: pass task and mm to do_madvise
      mm/madvise: introduce process_madvise() syscall: an external memory hinting API
      mm/madvise: check fatal signal pending of target process
      pid: move pidfd_get_pid() to pid.c
      mm/madvise: support both pid and pidfd for process_madvise

    Oleksandr Natalenko <oleksandr@redhat.com>:
      mm/madvise: allow KSM hints for remote API

    Minchan Kim <minchan@kernel.org>:
      mm: support vector address ranges for process_madvise
      mm: use only pidfd for process_madvise syscall

    YueHaibing <yuehaibing@huawei.com>:
      mm/madvise.c: remove duplicated include

 arch/alpha/kernel/syscalls/syscall.tbl              |    1 
 arch/arm/tools/syscall.tbl                          |    1 
 arch/arm64/include/asm/unistd.h                     |    2 
 arch/arm64/include/asm/unistd32.h                   |    4 
 arch/ia64/kernel/syscalls/syscall.tbl               |    1 
 arch/m68k/kernel/syscalls/syscall.tbl               |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl         |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl           |    3 
 arch/mips/kernel/syscalls/syscall_n64.tbl           |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl           |    3 
 arch/parisc/kernel/syscalls/syscall.tbl             |    3 
 arch/powerpc/kernel/syscalls/syscall.tbl            |    3 
 arch/powerpc/platforms/powernv/vas-fault.c          |    4 
 arch/s390/kernel/syscalls/syscall.tbl               |    3 
 arch/sh/kernel/syscalls/syscall.tbl                 |    1 
 arch/sparc/kernel/syscalls/syscall.tbl              |    3 
 arch/x86/entry/syscalls/syscall_32.tbl              |    3 
 arch/x86/entry/syscalls/syscall_64.tbl              |    5 
 arch/xtensa/kernel/syscalls/syscall.tbl             |    1 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h          |    5 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_arcturus.c |    1 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v10.c  |    1 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c   |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c   |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v9.c   |    2 
 drivers/gpu/drm/i915/gvt/kvmgt.c                    |    2 
 drivers/usb/gadget/function/f_fs.c                  |   10 
 drivers/usb/gadget/legacy/inode.c                   |    6 
 drivers/vfio/vfio_iommu_type1.c                     |    6 
 drivers/vhost/vhost.c                               |    8 
 fs/aio.c                                            |    1 
 fs/io-wq.c                                          |   15 -
 fs/io_uring.c                                       |   11 
 fs/nilfs2/segment.c                                 |    2 
 fs/ocfs2/mmap.c                                     |    2 
 include/linux/compat.h                              |   10 
 include/linux/kthread.h                             |    9 
 include/linux/mm.h                                  |    3 
 include/linux/mmu_context.h                         |    5 
 include/linux/mmzone.h                              |   14 
 include/linux/pid.h                                 |    1 
 include/linux/stacktrace.h                          |    2 
 include/linux/syscalls.h                            |   16 -
 include/uapi/asm-generic/unistd.h                   |    7 
 kernel/exit.c                                       |   17 -
 kernel/kcov.c                                       |   26 +
 kernel/kthread.c                                    |   95 +++++-
 kernel/pid.c                                        |   17 +
 kernel/sys_ni.c                                     |    2 
 lib/Kconfig.debug                                   |   10 
 lib/bitmap.c                                        |    9 
 lib/lz4/lz4_decompress.c                            |    3 
 lib/test_bitops.c                                   |   53 +++
 mm/Makefile                                         |    2 
 mm/debug_vm_pgtable.c                               |    6 
 mm/madvise.c                                        |  295 ++++++++++++++------
 mm/mmu_context.c                                    |   64 ----
 mm/oom_kill.c                                       |    6 
 mm/vmacache.c                                       |    4 
 scripts/checkpatch.pl                               |    4 
 scripts/spelling.txt                                |    9 
 tools/testing/selftests/vm/khugepaged.c             |    2 
 62 files changed, 526 insertions(+), 285 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-09  4:29 incoming Andrew Morton
@ 2020-06-09 16:58 ` Linus Torvalds
  0 siblings, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2020-06-09 16:58 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Mon, Jun 8, 2020 at 9:29 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
>  942 files changed, 4580 insertions(+), 5662 deletions(-)

If you use proper tools, add a "-M" to your diff script, so that you see

   941 files changed, 2614 insertions(+), 3696 deletions(-)

because a big portion of the lines were due to a rename:

   rename include/{asm-generic => linux}/pgtable.h (91%)

but at some earlier point you mentioned "diffstat", so I guess "proper
tools" isn't an option ;(

                 Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-09  4:29 Andrew Morton
  2020-06-09 16:58 ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2020-06-09  4:29 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


- a kernel-wide sweep of show_stack()

- pagetable cleanups

- abstract out accesses to mmap_sem - prep for mmap_sem scalability work

- hch's user acess work


93 patches, based on abfbb29297c27e3f101f348dc9e467b0fe70f919:

Subsystems affected by this patch series:

  debug
  mm/pagemap
  mm/maccess
  mm/documentation

Subsystem: debug

    Dmitry Safonov <dima@arista.com>:
    Patch series "Add log level to show_stack()", v3:
      kallsyms/printk: add loglvl to print_ip_sym()
      alpha: add show_stack_loglvl()
      arc: add show_stack_loglvl()
      arm/asm: add loglvl to c_backtrace()
      arm: add loglvl to unwind_backtrace()
      arm: add loglvl to dump_backtrace()
      arm: wire up dump_backtrace_{entry,stm}
      arm: add show_stack_loglvl()
      arm64: add loglvl to dump_backtrace()
      arm64: add show_stack_loglvl()
      c6x: add show_stack_loglvl()
      csky: add show_stack_loglvl()
      h8300: add show_stack_loglvl()
      hexagon: add show_stack_loglvl()
      ia64: pass log level as arg into ia64_do_show_stack()
      ia64: add show_stack_loglvl()
      m68k: add show_stack_loglvl()
      microblaze: add loglvl to microblaze_unwind_inner()
      microblaze: add loglvl to microblaze_unwind()
      microblaze: add show_stack_loglvl()
      mips: add show_stack_loglvl()
      nds32: add show_stack_loglvl()
      nios2: add show_stack_loglvl()
      openrisc: add show_stack_loglvl()
      parisc: add show_stack_loglvl()
      powerpc: add show_stack_loglvl()
      riscv: add show_stack_loglvl()
      s390: add show_stack_loglvl()
      sh: add loglvl to dump_mem()
      sh: remove needless printk()
      sh: add loglvl to printk_address()
      sh: add loglvl to show_trace()
      sh: add show_stack_loglvl()
      sparc: add show_stack_loglvl()
      um/sysrq: remove needless variable sp
      um: add show_stack_loglvl()
      unicore32: remove unused pmode argument in c_backtrace()
      unicore32: add loglvl to c_backtrace()
      unicore32: add show_stack_loglvl()
      x86: add missing const qualifiers for log_lvl
      x86: add show_stack_loglvl()
      xtensa: add loglvl to show_trace()
      xtensa: add show_stack_loglvl()
      sysrq: use show_stack_loglvl()
      x86/amd_gart: print stacktrace for a leak with KERN_ERR
      power: use show_stack_loglvl()
      kdb: don't play with console_loglevel
      sched: print stack trace with KERN_INFO
      kernel: use show_stack_loglvl()
      kernel: rename show_stack_loglvl() => show_stack()

Subsystem: mm/pagemap

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: consolidate definitions of page table accessors", v2:
      mm: don't include asm/pgtable.h if linux/mm.h is already included
      mm: introduce include/linux/pgtable.h
      mm: reorder includes after introduction of linux/pgtable.h
      csky: replace definitions of __pXd_offset() with pXd_index()
      m68k/mm/motorola: move comment about page table allocation funcitons
      m68k/mm: move {cache,nocahe}_page() definitions close to their user
      x86/mm: simplify init_trampoline() and surrounding logic
      mm: pgtable: add shortcuts for accessing kernel PMD and PTE
      mm: consolidate pte_index() and pte_offset_*() definitions

    Michel Lespinasse <walken@google.com>:
      mmap locking API: initial implementation as rwsem wrappers
      MMU notifier: use the new mmap locking API
      DMA reservations: use the new mmap locking API
      mmap locking API: use coccinelle to convert mmap_sem rwsem call sites
      mmap locking API: convert mmap_sem call sites missed by coccinelle
      mmap locking API: convert nested write lock sites
      mmap locking API: add mmap_read_trylock_non_owner()
      mmap locking API: add MMAP_LOCK_INITIALIZER
      mmap locking API: add mmap_assert_locked() and mmap_assert_write_locked()
      mmap locking API: rename mmap_sem to mmap_lock
      mmap locking API: convert mmap_sem API comments
      mmap locking API: convert mmap_sem comments

Subsystem: mm/maccess

    Christoph Hellwig <hch@lst.de>:
    Patch series "clean up and streamline probe_kernel_* and friends", v4:
      maccess: unexport probe_kernel_write()
      maccess: remove various unused weak aliases
      maccess: remove duplicate kerneldoc comments
      maccess: clarify kerneldoc comments
      maccess: update the top of file comment
      maccess: rename strncpy_from_unsafe_user to strncpy_from_user_nofault
      maccess: rename strncpy_from_unsafe_strict to strncpy_from_kernel_nofault
      maccess: rename strnlen_unsafe_user to strnlen_user_nofault
      maccess: remove probe_read_common and probe_write_common
      maccess: unify the probe kernel arch hooks
      bpf: factor out a bpf_trace_copy_string helper
      bpf: handle the compat string in bpf_trace_copy_string better

    Andrew Morton <akpm@linux-foundation.org>:
      bpf:bpf_seq_printf(): handle potentially unsafe format string better

    Christoph Hellwig <hch@lst.de>:
      bpf: rework the compat kernel probe handling
      tracing/kprobes: handle mixed kernel/userspace probes better
      maccess: remove strncpy_from_unsafe
      maccess: always use strict semantics for probe_kernel_read
      maccess: move user access routines together
      maccess: allow architectures to provide kernel probing directly
      x86: use non-set_fs based maccess routines
      maccess: return -ERANGE when probe_kernel_read() fails

Subsystem: mm/documentation

    Luis Chamberlain <mcgrof@kernel.org>:
      include/linux/cache.h: expand documentation over __read_mostly

 Documentation/admin-guide/mm/numa_memory_policy.rst   |   10 
 Documentation/admin-guide/mm/userfaultfd.rst          |    2 
 Documentation/filesystems/locking.rst                 |    2 
 Documentation/vm/hmm.rst                              |    6 
 Documentation/vm/transhuge.rst                        |    4 
 arch/alpha/boot/bootp.c                               |    1 
 arch/alpha/boot/bootpz.c                              |    1 
 arch/alpha/boot/main.c                                |    1 
 arch/alpha/include/asm/io.h                           |    1 
 arch/alpha/include/asm/pgtable.h                      |   16 
 arch/alpha/kernel/process.c                           |    1 
 arch/alpha/kernel/proto.h                             |    4 
 arch/alpha/kernel/ptrace.c                            |    1 
 arch/alpha/kernel/setup.c                             |    1 
 arch/alpha/kernel/smp.c                               |    1 
 arch/alpha/kernel/sys_alcor.c                         |    1 
 arch/alpha/kernel/sys_cabriolet.c                     |    1 
 arch/alpha/kernel/sys_dp264.c                         |    1 
 arch/alpha/kernel/sys_eb64p.c                         |    1 
 arch/alpha/kernel/sys_eiger.c                         |    1 
 arch/alpha/kernel/sys_jensen.c                        |    1 
 arch/alpha/kernel/sys_marvel.c                        |    1 
 arch/alpha/kernel/sys_miata.c                         |    1 
 arch/alpha/kernel/sys_mikasa.c                        |    1 
 arch/alpha/kernel/sys_nautilus.c                      |    1 
 arch/alpha/kernel/sys_noritake.c                      |    1 
 arch/alpha/kernel/sys_rawhide.c                       |    1 
 arch/alpha/kernel/sys_ruffian.c                       |    1 
 arch/alpha/kernel/sys_rx164.c                         |    1 
 arch/alpha/kernel/sys_sable.c                         |    1 
 arch/alpha/kernel/sys_sio.c                           |    1 
 arch/alpha/kernel/sys_sx164.c                         |    1 
 arch/alpha/kernel/sys_takara.c                        |    1 
 arch/alpha/kernel/sys_titan.c                         |    1 
 arch/alpha/kernel/sys_wildfire.c                      |    1 
 arch/alpha/kernel/traps.c                             |   40 
 arch/alpha/mm/fault.c                                 |   12 
 arch/alpha/mm/init.c                                  |    1 
 arch/arc/include/asm/bug.h                            |    3 
 arch/arc/include/asm/pgtable.h                        |   24 
 arch/arc/kernel/process.c                             |    4 
 arch/arc/kernel/stacktrace.c                          |   29 
 arch/arc/kernel/troubleshoot.c                        |    6 
 arch/arc/mm/fault.c                                   |    6 
 arch/arc/mm/highmem.c                                 |   14 
 arch/arc/mm/tlbex.S                                   |    4 
 arch/arm/include/asm/bug.h                            |    3 
 arch/arm/include/asm/efi.h                            |    3 
 arch/arm/include/asm/fixmap.h                         |    4 
 arch/arm/include/asm/idmap.h                          |    2 
 arch/arm/include/asm/pgtable-2level.h                 |    1 
 arch/arm/include/asm/pgtable-3level.h                 |    7 
 arch/arm/include/asm/pgtable-nommu.h                  |    3 
 arch/arm/include/asm/pgtable.h                        |   25 
 arch/arm/include/asm/traps.h                          |    3 
 arch/arm/include/asm/unwind.h                         |    3 
 arch/arm/kernel/head.S                                |    4 
 arch/arm/kernel/machine_kexec.c                       |    1 
 arch/arm/kernel/module.c                              |    1 
 arch/arm/kernel/process.c                             |    4 
 arch/arm/kernel/ptrace.c                              |    1 
 arch/arm/kernel/smp.c                                 |    1 
 arch/arm/kernel/suspend.c                             |    4 
 arch/arm/kernel/swp_emulate.c                         |    4 
 arch/arm/kernel/traps.c                               |   61 
 arch/arm/kernel/unwind.c                              |    7 
 arch/arm/kernel/vdso.c                                |    2 
 arch/arm/kernel/vmlinux.lds.S                         |    4 
 arch/arm/lib/backtrace-clang.S                        |    9 
 arch/arm/lib/backtrace.S                              |   14 
 arch/arm/lib/uaccess_with_memcpy.c                    |   16 
 arch/arm/mach-ebsa110/core.c                          |    1 
 arch/arm/mach-footbridge/common.c                     |    1 
 arch/arm/mach-imx/mm-imx21.c                          |    1 
 arch/arm/mach-imx/mm-imx27.c                          |    1 
 arch/arm/mach-imx/mm-imx3.c                           |    1 
 arch/arm/mach-integrator/core.c                       |    4 
 arch/arm/mach-iop32x/i2c.c                            |    1 
 arch/arm/mach-iop32x/iq31244.c                        |    1 
 arch/arm/mach-iop32x/iq80321.c                        |    1 
 arch/arm/mach-iop32x/n2100.c                          |    1 
 arch/arm/mach-ixp4xx/common.c                         |    1 
 arch/arm/mach-keystone/platsmp.c                      |    4 
 arch/arm/mach-sa1100/assabet.c                        |    3 
 arch/arm/mach-sa1100/hackkit.c                        |    4 
 arch/arm/mach-tegra/iomap.h                           |    2 
 arch/arm/mach-zynq/common.c                           |    4 
 arch/arm/mm/copypage-v4mc.c                           |    1 
 arch/arm/mm/copypage-v6.c                             |    1 
 arch/arm/mm/copypage-xscale.c                         |    1 
 arch/arm/mm/dump.c                                    |    1 
 arch/arm/mm/fault-armv.c                              |    1 
 arch/arm/mm/fault.c                                   |    9 
 arch/arm/mm/highmem.c                                 |    4 
 arch/arm/mm/idmap.c                                   |    4 
 arch/arm/mm/ioremap.c                                 |   31 
 arch/arm/mm/mm.h                                      |    8 
 arch/arm/mm/mmu.c                                     |    7 
 arch/arm/mm/pageattr.c                                |    1 
 arch/arm/mm/proc-arm1020.S                            |    4 
 arch/arm/mm/proc-arm1020e.S                           |    4 
 arch/arm/mm/proc-arm1022.S                            |    4 
 arch/arm/mm/proc-arm1026.S                            |    4 
 arch/arm/mm/proc-arm720.S                             |    4 
 arch/arm/mm/proc-arm740.S                             |    4 
 arch/arm/mm/proc-arm7tdmi.S                           |    4 
 arch/arm/mm/proc-arm920.S                             |    4 
 arch/arm/mm/proc-arm922.S                             |    4 
 arch/arm/mm/proc-arm925.S                             |    4 
 arch/arm/mm/proc-arm926.S                             |    4 
 arch/arm/mm/proc-arm940.S                             |    4 
 arch/arm/mm/proc-arm946.S                             |    4 
 arch/arm/mm/proc-arm9tdmi.S                           |    4 
 arch/arm/mm/proc-fa526.S                              |    4 
 arch/arm/mm/proc-feroceon.S                           |    4 
 arch/arm/mm/proc-mohawk.S                             |    4 
 arch/arm/mm/proc-sa110.S                              |    4 
 arch/arm/mm/proc-sa1100.S                             |    4 
 arch/arm/mm/proc-v6.S                                 |    4 
 arch/arm/mm/proc-v7.S                                 |    4 
 arch/arm/mm/proc-xsc3.S                               |    4 
 arch/arm/mm/proc-xscale.S                             |    4 
 arch/arm/mm/pv-fixup-asm.S                            |    4 
 arch/arm64/include/asm/io.h                           |    4 
 arch/arm64/include/asm/kernel-pgtable.h               |    2 
 arch/arm64/include/asm/kvm_mmu.h                      |    4 
 arch/arm64/include/asm/mmu_context.h                  |    4 
 arch/arm64/include/asm/pgtable.h                      |   40 
 arch/arm64/include/asm/stacktrace.h                   |    3 
 arch/arm64/include/asm/stage2_pgtable.h               |    2 
 arch/arm64/include/asm/vmap_stack.h                   |    4 
 arch/arm64/kernel/acpi.c                              |    4 
 arch/arm64/kernel/head.S                              |    4 
 arch/arm64/kernel/hibernate.c                         |    5 
 arch/arm64/kernel/kaslr.c                             |    4 
 arch/arm64/kernel/process.c                           |    2 
 arch/arm64/kernel/ptrace.c                            |    1 
 arch/arm64/kernel/smp.c                               |    1 
 arch/arm64/kernel/suspend.c                           |    4 
 arch/arm64/kernel/traps.c                             |   37 
 arch/arm64/kernel/vdso.c                              |    8 
 arch/arm64/kernel/vmlinux.lds.S                       |    3 
 arch/arm64/kvm/mmu.c                                  |   14 
 arch/arm64/mm/dump.c                                  |    1 
 arch/arm64/mm/fault.c                                 |    9 
 arch/arm64/mm/kasan_init.c                            |    3 
 arch/arm64/mm/mmu.c                                   |    8 
 arch/arm64/mm/pageattr.c                              |    1 
 arch/arm64/mm/proc.S                                  |    4 
 arch/c6x/include/asm/pgtable.h                        |    3 
 arch/c6x/kernel/traps.c                               |   28 
 arch/csky/include/asm/io.h                            |    2 
 arch/csky/include/asm/pgtable.h                       |   37 
 arch/csky/kernel/module.c                             |    1 
 arch/csky/kernel/ptrace.c                             |    5 
 arch/csky/kernel/stacktrace.c                         |   20 
 arch/csky/kernel/vdso.c                               |    4 
 arch/csky/mm/fault.c                                  |   10 
 arch/csky/mm/highmem.c                                |    2 
 arch/csky/mm/init.c                                   |    7 
 arch/csky/mm/tlb.c                                    |    1 
 arch/h8300/include/asm/pgtable.h                      |    1 
 arch/h8300/kernel/process.c                           |    1 
 arch/h8300/kernel/setup.c                             |    1 
 arch/h8300/kernel/signal.c                            |    1 
 arch/h8300/kernel/traps.c                             |   26 
 arch/h8300/mm/fault.c                                 |    1 
 arch/h8300/mm/init.c                                  |    1 
 arch/h8300/mm/memory.c                                |    1 
 arch/hexagon/include/asm/fixmap.h                     |    4 
 arch/hexagon/include/asm/pgtable.h                    |   55 
 arch/hexagon/kernel/traps.c                           |   39 
 arch/hexagon/kernel/vdso.c                            |    4 
 arch/hexagon/mm/uaccess.c                             |    2 
 arch/hexagon/mm/vm_fault.c                            |    9 
 arch/ia64/include/asm/pgtable.h                       |   34 
 arch/ia64/include/asm/ptrace.h                        |    1 
 arch/ia64/include/asm/uaccess.h                       |    2 
 arch/ia64/kernel/efi.c                                |    1 
 arch/ia64/kernel/entry.S                              |    4 
 arch/ia64/kernel/head.S                               |    5 
 arch/ia64/kernel/irq_ia64.c                           |    4 
 arch/ia64/kernel/ivt.S                                |    4 
 arch/ia64/kernel/kprobes.c                            |    4 
 arch/ia64/kernel/mca.c                                |    2 
 arch/ia64/kernel/mca_asm.S                            |    4 
 arch/ia64/kernel/perfmon.c                            |    8 
 arch/ia64/kernel/process.c                            |   37 
 arch/ia64/kernel/ptrace.c                             |    1 
 arch/ia64/kernel/relocate_kernel.S                    |    6 
 arch/ia64/kernel/setup.c                              |    4 
 arch/ia64/kernel/smp.c                                |    1 
 arch/ia64/kernel/smpboot.c                            |    1 
 arch/ia64/kernel/uncached.c                           |    4 
 arch/ia64/kernel/vmlinux.lds.S                        |    4 
 arch/ia64/mm/contig.c                                 |    1 
 arch/ia64/mm/fault.c                                  |   17 
 arch/ia64/mm/init.c                                   |   12 
 arch/m68k/68000/m68EZ328.c                            |    2 
 arch/m68k/68000/m68VZ328.c                            |    4 
 arch/m68k/68000/timers.c                              |    1 
 arch/m68k/amiga/config.c                              |    1 
 arch/m68k/apollo/config.c                             |    1 
 arch/m68k/atari/atasound.c                            |    1 
 arch/m68k/atari/stram.c                               |    1 
 arch/m68k/bvme6000/config.c                           |    1 
 arch/m68k/include/asm/mcf_pgtable.h                   |   63 
 arch/m68k/include/asm/motorola_pgalloc.h              |    8 
 arch/m68k/include/asm/motorola_pgtable.h              |   84 -
 arch/m68k/include/asm/pgtable_mm.h                    |    1 
 arch/m68k/include/asm/pgtable_no.h                    |    2 
 arch/m68k/include/asm/sun3_pgtable.h                  |   24 
 arch/m68k/include/asm/sun3xflop.h                     |    4 
 arch/m68k/kernel/head.S                               |    4 
 arch/m68k/kernel/process.c                            |    1 
 arch/m68k/kernel/ptrace.c                             |    1 
 arch/m68k/kernel/setup_no.c                           |    1 
 arch/m68k/kernel/signal.c                             |    1 
 arch/m68k/kernel/sys_m68k.c                           |   14 
 arch/m68k/kernel/traps.c                              |   27 
 arch/m68k/kernel/uboot.c                              |    1 
 arch/m68k/mac/config.c                                |    1 
 arch/m68k/mm/fault.c                                  |   10 
 arch/m68k/mm/init.c                                   |    2 
 arch/m68k/mm/mcfmmu.c                                 |    1 
 arch/m68k/mm/motorola.c                               |   65 
 arch/m68k/mm/sun3kmap.c                               |    1 
 arch/m68k/mm/sun3mmu.c                                |    1 
 arch/m68k/mvme147/config.c                            |    1 
 arch/m68k/mvme16x/config.c                            |    1 
 arch/m68k/q40/config.c                                |    1 
 arch/m68k/sun3/config.c                               |    1 
 arch/m68k/sun3/dvma.c                                 |    1 
 arch/m68k/sun3/mmu_emu.c                              |    1 
 arch/m68k/sun3/sun3dvma.c                             |    1 
 arch/m68k/sun3x/dvma.c                                |    1 
 arch/m68k/sun3x/prom.c                                |    1 
 arch/microblaze/include/asm/pgalloc.h                 |    4 
 arch/microblaze/include/asm/pgtable.h                 |   23 
 arch/microblaze/include/asm/uaccess.h                 |    2 
 arch/microblaze/include/asm/unwind.h                  |    3 
 arch/microblaze/kernel/hw_exception_handler.S         |    4 
 arch/microblaze/kernel/module.c                       |    4 
 arch/microblaze/kernel/setup.c                        |    4 
 arch/microblaze/kernel/signal.c                       |    9 
 arch/microblaze/kernel/stacktrace.c                   |    4 
 arch/microblaze/kernel/traps.c                        |   28 
 arch/microblaze/kernel/unwind.c                       |   46 
 arch/microblaze/mm/fault.c                            |   17 
 arch/microblaze/mm/init.c                             |    9 
 arch/microblaze/mm/pgtable.c                          |    4 
 arch/mips/fw/arc/memory.c                             |    1 
 arch/mips/include/asm/fixmap.h                        |    3 
 arch/mips/include/asm/mach-generic/floppy.h           |    1 
 arch/mips/include/asm/mach-jazz/floppy.h              |    1 
 arch/mips/include/asm/pgtable-32.h                    |   22 
 arch/mips/include/asm/pgtable-64.h                    |   32 
 arch/mips/include/asm/pgtable.h                       |    2 
 arch/mips/jazz/irq.c                                  |    4 
 arch/mips/jazz/jazzdma.c                              |    1 
 arch/mips/jazz/setup.c                                |    4 
 arch/mips/kernel/module.c                             |    1 
 arch/mips/kernel/process.c                            |    1 
 arch/mips/kernel/ptrace.c                             |    1 
 arch/mips/kernel/ptrace32.c                           |    1 
 arch/mips/kernel/smp-bmips.c                          |    1 
 arch/mips/kernel/traps.c                              |   58 
 arch/mips/kernel/vdso.c                               |    4 
 arch/mips/kvm/mips.c                                  |    4 
 arch/mips/kvm/mmu.c                                   |   20 
 arch/mips/kvm/tlb.c                                   |    1 
 arch/mips/kvm/trap_emul.c                             |    2 
 arch/mips/lib/dump_tlb.c                              |    1 
 arch/mips/lib/r3k_dump_tlb.c                          |    1 
 arch/mips/mm/c-octeon.c                               |    1 
 arch/mips/mm/c-r3k.c                                  |   11 
 arch/mips/mm/c-r4k.c                                  |   11 
 arch/mips/mm/c-tx39.c                                 |   11 
 arch/mips/mm/fault.c                                  |   12 
 arch/mips/mm/highmem.c                                |    2 
 arch/mips/mm/init.c                                   |    1 
 arch/mips/mm/page.c                                   |    1 
 arch/mips/mm/pgtable-32.c                             |    1 
 arch/mips/mm/pgtable-64.c                             |    1 
 arch/mips/mm/sc-ip22.c                                |    1 
 arch/mips/mm/sc-mips.c                                |    1 
 arch/mips/mm/sc-r5k.c                                 |    1 
 arch/mips/mm/tlb-r3k.c                                |    1 
 arch/mips/mm/tlb-r4k.c                                |    1 
 arch/mips/mm/tlbex.c                                  |    4 
 arch/mips/sgi-ip27/ip27-init.c                        |    1 
 arch/mips/sgi-ip27/ip27-timer.c                       |    1 
 arch/mips/sgi-ip32/ip32-memory.c                      |    1 
 arch/nds32/include/asm/highmem.h                      |    3 
 arch/nds32/include/asm/pgtable.h                      |   22 
 arch/nds32/kernel/head.S                              |    4 
 arch/nds32/kernel/module.c                            |    2 
 arch/nds32/kernel/traps.c                             |   33 
 arch/nds32/kernel/vdso.c                              |    6 
 arch/nds32/mm/fault.c                                 |   17 
 arch/nds32/mm/init.c                                  |   13 
 arch/nds32/mm/proc.c                                  |    7 
 arch/nios2/include/asm/pgtable.h                      |   24 
 arch/nios2/kernel/module.c                            |    1 
 arch/nios2/kernel/nios2_ksyms.c                       |    4 
 arch/nios2/kernel/traps.c                             |   35 
 arch/nios2/mm/fault.c                                 |   14 
 arch/nios2/mm/init.c                                  |    5 
 arch/nios2/mm/pgtable.c                               |    1 
 arch/nios2/mm/tlb.c                                   |    1 
 arch/openrisc/include/asm/io.h                        |    3 
 arch/openrisc/include/asm/pgtable.h                   |   33 
 arch/openrisc/include/asm/tlbflush.h                  |    1 
 arch/openrisc/kernel/asm-offsets.c                    |    1 
 arch/openrisc/kernel/entry.S                          |    4 
 arch/openrisc/kernel/head.S                           |    4 
 arch/openrisc/kernel/or32_ksyms.c                     |    4 
 arch/openrisc/kernel/process.c                        |    1 
 arch/openrisc/kernel/ptrace.c                         |    1 
 arch/openrisc/kernel/setup.c                          |    1 
 arch/openrisc/kernel/traps.c                          |   27 
 arch/openrisc/mm/fault.c                              |   12 
 arch/openrisc/mm/init.c                               |    1 
 arch/openrisc/mm/ioremap.c                            |    4 
 arch/openrisc/mm/tlb.c                                |    1 
 arch/parisc/include/asm/io.h                          |    2 
 arch/parisc/include/asm/mmu_context.h                 |    1 
 arch/parisc/include/asm/pgtable.h                     |   33 
 arch/parisc/kernel/asm-offsets.c                      |    4 
 arch/parisc/kernel/entry.S                            |    4 
 arch/parisc/kernel/head.S                             |    4 
 arch/parisc/kernel/module.c                           |    1 
 arch/parisc/kernel/pacache.S                          |    4 
 arch/parisc/kernel/pci-dma.c                          |    2 
 arch/parisc/kernel/pdt.c                              |    4 
 arch/parisc/kernel/ptrace.c                           |    1 
 arch/parisc/kernel/smp.c                              |    1 
 arch/parisc/kernel/traps.c                            |   42 
 arch/parisc/lib/memcpy.c                              |   14 
 arch/parisc/mm/fault.c                                |   10 
 arch/parisc/mm/fixmap.c                               |    6 
 arch/parisc/mm/init.c                                 |    1 
 arch/powerpc/include/asm/book3s/32/pgtable.h          |   20 
 arch/powerpc/include/asm/book3s/64/pgtable.h          |   43 
 arch/powerpc/include/asm/fixmap.h                     |    4 
 arch/powerpc/include/asm/io.h                         |    1 
 arch/powerpc/include/asm/kup.h                        |    2 
 arch/powerpc/include/asm/nohash/32/pgtable.h          |   17 
 arch/powerpc/include/asm/nohash/64/pgtable-4k.h       |    4 
 arch/powerpc/include/asm/nohash/64/pgtable.h          |   22 
 arch/powerpc/include/asm/nohash/pgtable.h             |    2 
 arch/powerpc/include/asm/pgtable.h                    |   28 
 arch/powerpc/include/asm/pkeys.h                      |    2 
 arch/powerpc/include/asm/tlb.h                        |    2 
 arch/powerpc/kernel/asm-offsets.c                     |    1 
 arch/powerpc/kernel/btext.c                           |    4 
 arch/powerpc/kernel/fpu.S                             |    3 
 arch/powerpc/kernel/head_32.S                         |    4 
 arch/powerpc/kernel/head_40x.S                        |    4 
 arch/powerpc/kernel/head_44x.S                        |    4 
 arch/powerpc/kernel/head_8xx.S                        |    4 
 arch/powerpc/kernel/head_fsl_booke.S                  |    4 
 arch/powerpc/kernel/io-workarounds.c                  |    4 
 arch/powerpc/kernel/irq.c                             |    4 
 arch/powerpc/kernel/mce_power.c                       |    4 
 arch/powerpc/kernel/paca.c                            |    4 
 arch/powerpc/kernel/process.c                         |   30 
 arch/powerpc/kernel/prom.c                            |    4 
 arch/powerpc/kernel/prom_init.c                       |    4 
 arch/powerpc/kernel/rtas_pci.c                        |    4 
 arch/powerpc/kernel/setup-common.c                    |    4 
 arch/powerpc/kernel/setup_32.c                        |    4 
 arch/powerpc/kernel/setup_64.c                        |    4 
 arch/powerpc/kernel/signal_32.c                       |    1 
 arch/powerpc/kernel/signal_64.c                       |    1 
 arch/powerpc/kernel/smp.c                             |    4 
 arch/powerpc/kernel/stacktrace.c                      |    2 
 arch/powerpc/kernel/traps.c                           |    1 
 arch/powerpc/kernel/vdso.c                            |    7 
 arch/powerpc/kvm/book3s_64_mmu_radix.c                |    4 
 arch/powerpc/kvm/book3s_hv.c                          |    6 
 arch/powerpc/kvm/book3s_hv_nested.c                   |    4 
 arch/powerpc/kvm/book3s_hv_rm_xics.c                  |    4 
 arch/powerpc/kvm/book3s_hv_rm_xive.c                  |    4 
 arch/powerpc/kvm/book3s_hv_uvmem.c                    |   18 
 arch/powerpc/kvm/e500_mmu_host.c                      |    4 
 arch/powerpc/kvm/fpu.S                                |    4 
 arch/powerpc/lib/code-patching.c                      |    1 
 arch/powerpc/mm/book3s32/hash_low.S                   |    4 
 arch/powerpc/mm/book3s32/mmu.c                        |    2 
 arch/powerpc/mm/book3s32/tlb.c                        |    6 
 arch/powerpc/mm/book3s64/hash_hugetlbpage.c           |    1 
 arch/powerpc/mm/book3s64/hash_native.c                |    4 
 arch/powerpc/mm/book3s64/hash_pgtable.c               |    5 
 arch/powerpc/mm/book3s64/hash_utils.c                 |    4 
 arch/powerpc/mm/book3s64/iommu_api.c                  |    4 
 arch/powerpc/mm/book3s64/radix_hugetlbpage.c          |    1 
 arch/powerpc/mm/book3s64/radix_pgtable.c              |    1 
 arch/powerpc/mm/book3s64/slb.c                        |    4 
 arch/powerpc/mm/book3s64/subpage_prot.c               |   16 
 arch/powerpc/mm/copro_fault.c                         |    4 
 arch/powerpc/mm/fault.c                               |   23 
 arch/powerpc/mm/hugetlbpage.c                         |    1 
 arch/powerpc/mm/init-common.c                         |    4 
 arch/powerpc/mm/init_32.c                             |    1 
 arch/powerpc/mm/init_64.c                             |    1 
 arch/powerpc/mm/kasan/8xx.c                           |    4 
 arch/powerpc/mm/kasan/book3s_32.c                     |    2 
 arch/powerpc/mm/kasan/kasan_init_32.c                 |    8 
 arch/powerpc/mm/mem.c                                 |    1 
 arch/powerpc/mm/nohash/40x.c                          |    5 
 arch/powerpc/mm/nohash/8xx.c                          |    2 
 arch/powerpc/mm/nohash/fsl_booke.c                    |    1 
 arch/powerpc/mm/nohash/tlb_low_64e.S                  |    4 
 arch/powerpc/mm/pgtable.c                             |    2 
 arch/powerpc/mm/pgtable_32.c                          |    5 
 arch/powerpc/mm/pgtable_64.c                          |    1 
 arch/powerpc/mm/ptdump/8xx.c                          |    2 
 arch/powerpc/mm/ptdump/bats.c                         |    4 
 arch/powerpc/mm/ptdump/book3s64.c                     |    2 
 arch/powerpc/mm/ptdump/hashpagetable.c                |    1 
 arch/powerpc/mm/ptdump/ptdump.c                       |    1 
 arch/powerpc/mm/ptdump/shared.c                       |    2 
 arch/powerpc/oprofile/cell/spu_task_sync.c            |    6 
 arch/powerpc/perf/callchain.c                         |    1 
 arch/powerpc/perf/callchain_32.c                      |    1 
 arch/powerpc/perf/callchain_64.c                      |    1 
 arch/powerpc/platforms/85xx/corenet_generic.c         |    4 
 arch/powerpc/platforms/85xx/mpc85xx_cds.c             |    4 
 arch/powerpc/platforms/85xx/qemu_e500.c               |    4 
 arch/powerpc/platforms/85xx/sbc8548.c                 |    4 
 arch/powerpc/platforms/85xx/smp.c                     |    4 
 arch/powerpc/platforms/86xx/mpc86xx_smp.c             |    4 
 arch/powerpc/platforms/8xx/cpm1.c                     |    1 
 arch/powerpc/platforms/8xx/micropatch.c               |    1 
 arch/powerpc/platforms/cell/cbe_regs.c                |    4 
 arch/powerpc/platforms/cell/interrupt.c               |    4 
 arch/powerpc/platforms/cell/pervasive.c               |    4 
 arch/powerpc/platforms/cell/setup.c                   |    1 
 arch/powerpc/platforms/cell/smp.c                     |    4 
 arch/powerpc/platforms/cell/spider-pic.c              |    4 
 arch/powerpc/platforms/cell/spufs/file.c              |   10 
 arch/powerpc/platforms/chrp/pci.c                     |    4 
 arch/powerpc/platforms/chrp/setup.c                   |    1 
 arch/powerpc/platforms/chrp/smp.c                     |    4 
 arch/powerpc/platforms/maple/setup.c                  |    1 
 arch/powerpc/platforms/maple/time.c                   |    1 
 arch/powerpc/platforms/powermac/setup.c               |    1 
 arch/powerpc/platforms/powermac/smp.c                 |    4 
 arch/powerpc/platforms/powermac/time.c                |    1 
 arch/powerpc/platforms/pseries/lpar.c                 |    4 
 arch/powerpc/platforms/pseries/setup.c                |    1 
 arch/powerpc/platforms/pseries/smp.c                  |    4 
 arch/powerpc/sysdev/cpm2.c                            |    1 
 arch/powerpc/sysdev/fsl_85xx_cache_sram.c             |    2 
 arch/powerpc/sysdev/mpic.c                            |    4 
 arch/powerpc/xmon/xmon.c                              |    1 
 arch/riscv/include/asm/fixmap.h                       |    4 
 arch/riscv/include/asm/io.h                           |    4 
 arch/riscv/include/asm/kasan.h                        |    4 
 arch/riscv/include/asm/pgtable-64.h                   |    7 
 arch/riscv/include/asm/pgtable.h                      |   22 
 arch/riscv/kernel/module.c                            |    2 
 arch/riscv/kernel/setup.c                             |    1 
 arch/riscv/kernel/soc.c                               |    2 
 arch/riscv/kernel/stacktrace.c                        |   23 
 arch/riscv/kernel/vdso.c                              |    4 
 arch/riscv/mm/cacheflush.c                            |    3 
 arch/riscv/mm/fault.c                                 |   14 
 arch/riscv/mm/init.c                                  |   31 
 arch/riscv/mm/kasan_init.c                            |    4 
 arch/riscv/mm/pageattr.c                              |    6 
 arch/riscv/mm/ptdump.c                                |    2 
 arch/s390/boot/ipl_parm.c                             |    4 
 arch/s390/boot/kaslr.c                                |    4 
 arch/s390/include/asm/hugetlb.h                       |    4 
 arch/s390/include/asm/kasan.h                         |    4 
 arch/s390/include/asm/pgtable.h                       |   15 
 arch/s390/include/asm/tlbflush.h                      |    1 
 arch/s390/kernel/asm-offsets.c                        |    4 
 arch/s390/kernel/dumpstack.c                          |   25 
 arch/s390/kernel/machine_kexec.c                      |    1 
 arch/s390/kernel/ptrace.c                             |    1 
 arch/s390/kernel/uv.c                                 |    4 
 arch/s390/kernel/vdso.c                               |    5 
 arch/s390/kvm/gaccess.c                               |    8 
 arch/s390/kvm/interrupt.c                             |    4 
 arch/s390/kvm/kvm-s390.c                              |   32 
 arch/s390/kvm/priv.c                                  |   38 
 arch/s390/mm/dump_pagetables.c                        |    1 
 arch/s390/mm/extmem.c                                 |    4 
 arch/s390/mm/fault.c                                  |   17 
 arch/s390/mm/gmap.c                                   |   80 
 arch/s390/mm/init.c                                   |    1 
 arch/s390/mm/kasan_init.c                             |    4 
 arch/s390/mm/pageattr.c                               |   13 
 arch/s390/mm/pgalloc.c                                |    2 
 arch/s390/mm/pgtable.c                                |    1 
 arch/s390/mm/vmem.c                                   |    1 
 arch/s390/pci/pci_mmio.c                              |    4 
 arch/sh/include/asm/io.h                              |    2 
 arch/sh/include/asm/kdebug.h                          |    6 
 arch/sh/include/asm/pgtable-3level.h                  |    7 
 arch/sh/include/asm/pgtable.h                         |    2 
 arch/sh/include/asm/pgtable_32.h                      |   25 
 arch/sh/include/asm/processor_32.h                    |    2 
 arch/sh/kernel/dumpstack.c                            |   54 
 arch/sh/kernel/machine_kexec.c                        |    1 
 arch/sh/kernel/process_32.c                           |    2 
 arch/sh/kernel/ptrace_32.c                            |    1 
 arch/sh/kernel/signal_32.c                            |    1 
 arch/sh/kernel/sys_sh.c                               |    6 
 arch/sh/kernel/traps.c                                |    4 
 arch/sh/kernel/vsyscall/vsyscall.c                    |    4 
 arch/sh/mm/cache-sh3.c                                |    1 
 arch/sh/mm/cache-sh4.c                                |   11 
 arch/sh/mm/cache-sh7705.c                             |    1 
 arch/sh/mm/fault.c                                    |   16 
 arch/sh/mm/kmap.c                                     |    5 
 arch/sh/mm/nommu.c                                    |    1 
 arch/sh/mm/pmb.c                                      |    4 
 arch/sparc/include/asm/floppy_32.h                    |    4 
 arch/sparc/include/asm/highmem.h                      |    4 
 arch/sparc/include/asm/ide.h                          |    2 
 arch/sparc/include/asm/io-unit.h                      |    4 
 arch/sparc/include/asm/pgalloc_32.h                   |    4 
 arch/sparc/include/asm/pgalloc_64.h                   |    2 
 arch/sparc/include/asm/pgtable_32.h                   |   34 
 arch/sparc/include/asm/pgtable_64.h                   |   32 
 arch/sparc/kernel/cpu.c                               |    4 
 arch/sparc/kernel/entry.S                             |    4 
 arch/sparc/kernel/head_64.S                           |    4 
 arch/sparc/kernel/ktlb.S                              |    4 
 arch/sparc/kernel/leon_smp.c                          |    1 
 arch/sparc/kernel/pci.c                               |    4 
 arch/sparc/kernel/process_32.c                        |   29 
 arch/sparc/kernel/process_64.c                        |    3 
 arch/sparc/kernel/ptrace_32.c                         |    1 
 arch/sparc/kernel/ptrace_64.c                         |    1 
 arch/sparc/kernel/setup_32.c                          |    1 
 arch/sparc/kernel/setup_64.c                          |    1 
 arch/sparc/kernel/signal32.c                          |    1 
 arch/sparc/kernel/signal_32.c                         |    1 
 arch/sparc/kernel/signal_64.c                         |    1 
 arch/sparc/kernel/smp_32.c                            |    1 
 arch/sparc/kernel/smp_64.c                            |    1 
 arch/sparc/kernel/sun4m_irq.c                         |    4 
 arch/sparc/kernel/trampoline_64.S                     |    4 
 arch/sparc/kernel/traps_32.c                          |    4 
 arch/sparc/kernel/traps_64.c                          |   24 
 arch/sparc/lib/clear_page.S                           |    4 
 arch/sparc/lib/copy_page.S                            |    2 
 arch/sparc/mm/fault_32.c                              |   21 
 arch/sparc/mm/fault_64.c                              |   17 
 arch/sparc/mm/highmem.c                               |   12 
 arch/sparc/mm/hugetlbpage.c                           |    1 
 arch/sparc/mm/init_32.c                               |    1 
 arch/sparc/mm/init_64.c                               |    7 
 arch/sparc/mm/io-unit.c                               |   11 
 arch/sparc/mm/iommu.c                                 |    9 
 arch/sparc/mm/tlb.c                                   |    1 
 arch/sparc/mm/tsb.c                                   |    4 
 arch/sparc/mm/ultra.S                                 |    4 
 arch/sparc/vdso/vma.c                                 |    4 
 arch/um/drivers/mconsole_kern.c                       |    2 
 arch/um/include/asm/mmu_context.h                     |    5 
 arch/um/include/asm/pgtable-3level.h                  |    4 
 arch/um/include/asm/pgtable.h                         |   69 
 arch/um/kernel/maccess.c                              |   12 
 arch/um/kernel/mem.c                                  |   10 
 arch/um/kernel/process.c                              |    1 
 arch/um/kernel/skas/mmu.c                             |    3 
 arch/um/kernel/skas/uaccess.c                         |    1 
 arch/um/kernel/sysrq.c                                |   35 
 arch/um/kernel/tlb.c                                  |    5 
 arch/um/kernel/trap.c                                 |   15 
 arch/um/kernel/um_arch.c                              |    1 
 arch/unicore32/include/asm/pgtable.h                  |   19 
 arch/unicore32/kernel/hibernate.c                     |    4 
 arch/unicore32/kernel/hibernate_asm.S                 |    4 
 arch/unicore32/kernel/module.c                        |    1 
 arch/unicore32/kernel/setup.h                         |    4 
 arch/unicore32/kernel/traps.c                         |   50 
 arch/unicore32/lib/backtrace.S                        |   24 
 arch/unicore32/mm/alignment.c                         |    4 
 arch/unicore32/mm/fault.c                             |    9 
 arch/unicore32/mm/mm.h                                |   10 
 arch/unicore32/mm/proc-ucv2.S                         |    4 
 arch/x86/boot/compressed/kaslr_64.c                   |    4 
 arch/x86/entry/vdso/vma.c                             |   14 
 arch/x86/events/core.c                                |    4 
 arch/x86/include/asm/agp.h                            |    2 
 arch/x86/include/asm/asm-prototypes.h                 |    4 
 arch/x86/include/asm/efi.h                            |    4 
 arch/x86/include/asm/iomap.h                          |    1 
 arch/x86/include/asm/kaslr.h                          |    2 
 arch/x86/include/asm/mmu.h                            |    2 
 arch/x86/include/asm/pgtable-3level.h                 |    8 
 arch/x86/include/asm/pgtable.h                        |   89 -
 arch/x86/include/asm/pgtable_32.h                     |   11 
 arch/x86/include/asm/pgtable_64.h                     |    4 
 arch/x86/include/asm/setup.h                          |   12 
 arch/x86/include/asm/stacktrace.h                     |    2 
 arch/x86/include/asm/uaccess.h                        |   16 
 arch/x86/include/asm/xen/hypercall.h                  |    4 
 arch/x86/include/asm/xen/page.h                       |    1 
 arch/x86/kernel/acpi/boot.c                           |    4 
 arch/x86/kernel/acpi/sleep.c                          |    4 
 arch/x86/kernel/alternative.c                         |    1 
 arch/x86/kernel/amd_gart_64.c                         |    5 
 arch/x86/kernel/apic/apic_numachip.c                  |    4 
 arch/x86/kernel/cpu/bugs.c                            |    4 
 arch/x86/kernel/cpu/common.c                          |    4 
 arch/x86/kernel/cpu/intel.c                           |    4 
 arch/x86/kernel/cpu/resctrl/pseudo_lock.c             |    6 
 arch/x86/kernel/cpu/resctrl/rdtgroup.c                |    6 
 arch/x86/kernel/crash_core_32.c                       |    4 
 arch/x86/kernel/crash_core_64.c                       |    4 
 arch/x86/kernel/doublefault_32.c                      |    1 
 arch/x86/kernel/dumpstack.c                           |   21 
 arch/x86/kernel/early_printk.c                        |    4 
 arch/x86/kernel/espfix_64.c                           |    2 
 arch/x86/kernel/head64.c                              |    4 
 arch/x86/kernel/head_64.S                             |    4 
 arch/x86/kernel/i8259.c                               |    4 
 arch/x86/kernel/irqinit.c                             |    4 
 arch/x86/kernel/kprobes/core.c                        |    4 
 arch/x86/kernel/kprobes/opt.c                         |    4 
 arch/x86/kernel/ldt.c                                 |    2 
 arch/x86/kernel/machine_kexec_32.c                    |    1 
 arch/x86/kernel/machine_kexec_64.c                    |    1 
 arch/x86/kernel/module.c                              |    1 
 arch/x86/kernel/paravirt.c                            |    4 
 arch/x86/kernel/process_32.c                          |    1 
 arch/x86/kernel/process_64.c                          |    1 
 arch/x86/kernel/ptrace.c                              |    1 
 arch/x86/kernel/reboot.c                              |    4 
 arch/x86/kernel/smpboot.c                             |    4 
 arch/x86/kernel/tboot.c                               |    3 
 arch/x86/kernel/vm86_32.c                             |    4 
 arch/x86/kvm/mmu/paging_tmpl.h                        |    8 
 arch/x86/mm/cpu_entry_area.c                          |    4 
 arch/x86/mm/debug_pagetables.c                        |    2 
 arch/x86/mm/dump_pagetables.c                         |    1 
 arch/x86/mm/fault.c                                   |   22 
 arch/x86/mm/init.c                                    |   22 
 arch/x86/mm/init_32.c                                 |   27 
 arch/x86/mm/init_64.c                                 |    1 
 arch/x86/mm/ioremap.c                                 |    4 
 arch/x86/mm/kasan_init_64.c                           |    1 
 arch/x86/mm/kaslr.c                                   |   37 
 arch/x86/mm/maccess.c                                 |   44 
 arch/x86/mm/mem_encrypt_boot.S                        |    2 
 arch/x86/mm/mmio-mod.c                                |    4 
 arch/x86/mm/pat/cpa-test.c                            |    1 
 arch/x86/mm/pat/memtype.c                             |    1 
 arch/x86/mm/pat/memtype_interval.c                    |    4 
 arch/x86/mm/pgtable.c                                 |    1 
 arch/x86/mm/pgtable_32.c                              |    1 
 arch/x86/mm/pti.c                                     |    1 
 arch/x86/mm/setup_nx.c                                |    4 
 arch/x86/platform/efi/efi_32.c                        |    4 
 arch/x86/platform/efi/efi_64.c                        |    1 
 arch/x86/platform/olpc/olpc_ofw.c                     |    4 
 arch/x86/power/cpu.c                                  |    4 
 arch/x86/power/hibernate.c                            |    4 
 arch/x86/power/hibernate_32.c                         |    4 
 arch/x86/power/hibernate_64.c                         |    4 
 arch/x86/realmode/init.c                              |    4 
 arch/x86/um/vdso/vma.c                                |    4 
 arch/x86/xen/enlighten_pv.c                           |    1 
 arch/x86/xen/grant-table.c                            |    1 
 arch/x86/xen/mmu_pv.c                                 |    4 
 arch/x86/xen/smp_pv.c                                 |    2 
 arch/xtensa/include/asm/fixmap.h                      |   12 
 arch/xtensa/include/asm/highmem.h                     |    4 
 arch/xtensa/include/asm/initialize_mmu.h              |    2 
 arch/xtensa/include/asm/mmu_context.h                 |    4 
 arch/xtensa/include/asm/pgtable.h                     |   20 
 arch/xtensa/kernel/entry.S                            |    4 
 arch/xtensa/kernel/process.c                          |    1 
 arch/xtensa/kernel/ptrace.c                           |    1 
 arch/xtensa/kernel/setup.c                            |    1 
 arch/xtensa/kernel/traps.c                            |   42 
 arch/xtensa/kernel/vectors.S                          |    4 
 arch/xtensa/mm/cache.c                                |    4 
 arch/xtensa/mm/fault.c                                |   12 
 arch/xtensa/mm/highmem.c                              |    2 
 arch/xtensa/mm/ioremap.c                              |    4 
 arch/xtensa/mm/kasan_init.c                           |   10 
 arch/xtensa/mm/misc.S                                 |    4 
 arch/xtensa/mm/mmu.c                                  |    5 
 drivers/acpi/scan.c                                   |    3 
 drivers/android/binder_alloc.c                        |   14 
 drivers/atm/fore200e.c                                |    4 
 drivers/base/power/main.c                             |    4 
 drivers/block/z2ram.c                                 |    4 
 drivers/char/agp/frontend.c                           |    1 
 drivers/char/agp/generic.c                            |    1 
 drivers/char/bsr.c                                    |    1 
 drivers/char/mspec.c                                  |    3 
 drivers/dma-buf/dma-resv.c                            |    5 
 drivers/firmware/efi/arm-runtime.c                    |    4 
 drivers/firmware/efi/efi.c                            |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h            |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c     |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c     |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c      |    4 
 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c               |   10 
 drivers/gpu/drm/amd/amdkfd/kfd_events.c               |    4 
 drivers/gpu/drm/drm_vm.c                              |    4 
 drivers/gpu/drm/etnaviv/etnaviv_gem.c                 |    2 
 drivers/gpu/drm/i915/gem/i915_gem_mman.c              |    4 
 drivers/gpu/drm/i915/gem/i915_gem_userptr.c           |   14 
 drivers/gpu/drm/i915/i915_mm.c                        |    1 
 drivers/gpu/drm/i915/i915_perf.c                      |    2 
 drivers/gpu/drm/nouveau/nouveau_svm.c                 |   22 
 drivers/gpu/drm/radeon/radeon_cs.c                    |    4 
 drivers/gpu/drm/radeon/radeon_gem.c                   |    6 
 drivers/gpu/drm/ttm/ttm_bo_vm.c                       |   10 
 drivers/infiniband/core/umem_odp.c                    |    4 
 drivers/infiniband/core/uverbs_main.c                 |    6 
 drivers/infiniband/hw/hfi1/mmu_rb.c                   |    2 
 drivers/infiniband/hw/mlx4/mr.c                       |    4 
 drivers/infiniband/hw/qib/qib_file_ops.c              |    4 
 drivers/infiniband/hw/qib/qib_user_pages.c            |    6 
 drivers/infiniband/hw/usnic/usnic_uiom.c              |    4 
 drivers/infiniband/sw/rdmavt/mmap.c                   |    1 
 drivers/infiniband/sw/rxe/rxe_mmap.c                  |    1 
 drivers/infiniband/sw/siw/siw_mem.c                   |    4 
 drivers/iommu/amd_iommu_v2.c                          |    4 
 drivers/iommu/intel-svm.c                             |    4 
 drivers/macintosh/macio-adb.c                         |    4 
 drivers/macintosh/mediabay.c                          |    4 
 drivers/macintosh/via-pmu.c                           |    4 
 drivers/media/pci/bt8xx/bt878.c                       |    4 
 drivers/media/pci/bt8xx/btcx-risc.c                   |    4 
 drivers/media/pci/bt8xx/bttv-risc.c                   |    4 
 drivers/media/platform/davinci/vpbe_display.c         |    1 
 drivers/media/v4l2-core/v4l2-common.c                 |    1 
 drivers/media/v4l2-core/videobuf-core.c               |    4 
 drivers/media/v4l2-core/videobuf-dma-contig.c         |    4 
 drivers/media/v4l2-core/videobuf-dma-sg.c             |   10 
 drivers/media/v4l2-core/videobuf-vmalloc.c            |    4 
 drivers/misc/cxl/cxllib.c                             |    9 
 drivers/misc/cxl/fault.c                              |    4 
 drivers/misc/genwqe/card_utils.c                      |    2 
 drivers/misc/sgi-gru/grufault.c                       |   25 
 drivers/misc/sgi-gru/grufile.c                        |    4 
 drivers/mtd/ubi/ubi.h                                 |    2 
 drivers/net/ethernet/amd/7990.c                       |    4 
 drivers/net/ethernet/amd/hplance.c                    |    4 
 drivers/net/ethernet/amd/mvme147.c                    |    4 
 drivers/net/ethernet/amd/sun3lance.c                  |    4 
 drivers/net/ethernet/amd/sunlance.c                   |    4 
 drivers/net/ethernet/apple/bmac.c                     |    4 
 drivers/net/ethernet/apple/mace.c                     |    4 
 drivers/net/ethernet/freescale/fs_enet/fs_enet-main.c |    4 
 drivers/net/ethernet/freescale/fs_enet/mac-fcc.c      |    4 
 drivers/net/ethernet/freescale/fs_enet/mii-fec.c      |    4 
 drivers/net/ethernet/i825xx/82596.c                   |    4 
 drivers/net/ethernet/korina.c                         |    4 
 drivers/net/ethernet/marvell/pxa168_eth.c             |    4 
 drivers/net/ethernet/natsemi/jazzsonic.c              |    4 
 drivers/net/ethernet/natsemi/macsonic.c               |    4 
 drivers/net/ethernet/natsemi/xtsonic.c                |    4 
 drivers/net/ethernet/sun/sunbmac.c                    |    4 
 drivers/net/ethernet/sun/sunhme.c                     |    1 
 drivers/net/ethernet/sun/sunqe.c                      |    4 
 drivers/oprofile/buffer_sync.c                        |   12 
 drivers/sbus/char/flash.c                             |    1 
 drivers/sbus/char/uctrl.c                             |    1 
 drivers/scsi/53c700.c                                 |    4 
 drivers/scsi/a2091.c                                  |    1 
 drivers/scsi/a3000.c                                  |    1 
 drivers/scsi/arm/cumana_2.c                           |    4 
 drivers/scsi/arm/eesox.c                              |    4 
 drivers/scsi/arm/powertec.c                           |    4 
 drivers/scsi/dpt_i2o.c                                |    4 
 drivers/scsi/gvp11.c                                  |    1 
 drivers/scsi/lasi700.c                                |    1 
 drivers/scsi/mac53c94.c                               |    4 
 drivers/scsi/mesh.c                                   |    4 
 drivers/scsi/mvme147.c                                |    1 
 drivers/scsi/qlogicpti.c                              |    4 
 drivers/scsi/sni_53c710.c                             |    1 
 drivers/scsi/zorro_esp.c                              |    4 
 drivers/staging/android/ashmem.c                      |    4 
 drivers/staging/comedi/comedi_fops.c                  |    2 
 drivers/staging/kpc2000/kpc_dma/fileops.c             |    4 
 drivers/staging/media/atomisp/pci/hmm/hmm_bo.c        |    4 
 drivers/tee/optee/call.c                              |    4 
 drivers/tty/sysrq.c                                   |    4 
 drivers/tty/vt/consolemap.c                           |    2 
 drivers/vfio/pci/vfio_pci.c                           |   22 
 drivers/vfio/vfio_iommu_type1.c                       |    8 
 drivers/vhost/vdpa.c                                  |    4 
 drivers/video/console/newport_con.c                   |    1 
 drivers/video/fbdev/acornfb.c                         |    1 
 drivers/video/fbdev/atafb.c                           |    1 
 drivers/video/fbdev/cirrusfb.c                        |    1 
 drivers/video/fbdev/cyber2000fb.c                     |    1 
 drivers/video/fbdev/fb-puv3.c                         |    1 
 drivers/video/fbdev/hitfb.c                           |    1 
 drivers/video/fbdev/neofb.c                           |    1 
 drivers/video/fbdev/q40fb.c                           |    1 
 drivers/video/fbdev/savage/savagefb_driver.c          |    1 
 drivers/xen/balloon.c                                 |    1 
 drivers/xen/gntdev.c                                  |    6 
 drivers/xen/grant-table.c                             |    1 
 drivers/xen/privcmd.c                                 |   15 
 drivers/xen/xenbus/xenbus_probe.c                     |    1 
 drivers/xen/xenbus/xenbus_probe_backend.c             |    1 
 drivers/xen/xenbus/xenbus_probe_frontend.c            |    1 
 fs/aio.c                                              |    4 
 fs/coredump.c                                         |    8 
 fs/exec.c                                             |   18 
 fs/ext2/file.c                                        |    2 
 fs/ext4/super.c                                       |    6 
 fs/hugetlbfs/inode.c                                  |    2 
 fs/io_uring.c                                         |    4 
 fs/kernfs/file.c                                      |    4 
 fs/proc/array.c                                       |    1 
 fs/proc/base.c                                        |   24 
 fs/proc/meminfo.c                                     |    1 
 fs/proc/nommu.c                                       |    1 
 fs/proc/task_mmu.c                                    |   34 
 fs/proc/task_nommu.c                                  |   18 
 fs/proc/vmcore.c                                      |    1 
 fs/userfaultfd.c                                      |   46 
 fs/xfs/xfs_file.c                                     |    2 
 fs/xfs/xfs_inode.c                                    |   14 
 fs/xfs/xfs_iops.c                                     |    4 
 include/asm-generic/io.h                              |    2 
 include/asm-generic/pgtable-nopmd.h                   |    1 
 include/asm-generic/pgtable-nopud.h                   |    1 
 include/asm-generic/pgtable.h                         | 1322 ----------------
 include/linux/cache.h                                 |   10 
 include/linux/crash_dump.h                            |    3 
 include/linux/dax.h                                   |    1 
 include/linux/dma-noncoherent.h                       |    2 
 include/linux/fs.h                                    |    4 
 include/linux/hmm.h                                   |    2 
 include/linux/huge_mm.h                               |    2 
 include/linux/hugetlb.h                               |    2 
 include/linux/io-mapping.h                            |    4 
 include/linux/kallsyms.h                              |    4 
 include/linux/kasan.h                                 |    4 
 include/linux/mempolicy.h                             |    2 
 include/linux/mm.h                                    |   15 
 include/linux/mm_types.h                              |    4 
 include/linux/mmap_lock.h                             |  128 +
 include/linux/mmu_notifier.h                          |   13 
 include/linux/pagemap.h                               |    2 
 include/linux/pgtable.h                               | 1444 +++++++++++++++++-
 include/linux/rmap.h                                  |    2 
 include/linux/sched/debug.h                           |    7 
 include/linux/sched/mm.h                              |   10 
 include/linux/uaccess.h                               |   62 
 include/xen/arm/page.h                                |    4 
 init/init_task.c                                      |    1 
 ipc/shm.c                                             |    8 
 kernel/acct.c                                         |    6 
 kernel/bpf/stackmap.c                                 |   21 
 kernel/bpf/syscall.c                                  |    2 
 kernel/cgroup/cpuset.c                                |    4 
 kernel/debug/kdb/kdb_bt.c                             |   17 
 kernel/events/core.c                                  |   10 
 kernel/events/uprobes.c                               |   20 
 kernel/exit.c                                         |   11 
 kernel/fork.c                                         |   15 
 kernel/futex.c                                        |    4 
 kernel/locking/lockdep.c                              |    4 
 kernel/locking/rtmutex-debug.c                        |    4 
 kernel/power/snapshot.c                               |    1 
 kernel/relay.c                                        |    2 
 kernel/sched/core.c                                   |   10 
 kernel/sched/fair.c                                   |    4 
 kernel/sys.c                                          |   22 
 kernel/trace/bpf_trace.c                              |  176 +-
 kernel/trace/ftrace.c                                 |    8 
 kernel/trace/trace_kprobe.c                           |   80 
 kernel/trace/trace_output.c                           |    4 
 lib/dump_stack.c                                      |    4 
 lib/ioremap.c                                         |    1 
 lib/test_hmm.c                                        |   14 
 lib/test_lockup.c                                     |   16 
 mm/debug.c                                            |   10 
 mm/debug_vm_pgtable.c                                 |    1 
 mm/filemap.c                                          |   46 
 mm/frame_vector.c                                     |    6 
 mm/gup.c                                              |   73 
 mm/hmm.c                                              |    2 
 mm/huge_memory.c                                      |    8 
 mm/hugetlb.c                                          |    3 
 mm/init-mm.c                                          |    6 
 mm/internal.h                                         |    6 
 mm/khugepaged.c                                       |   72 
 mm/ksm.c                                              |   48 
 mm/maccess.c                                          |  496 +++---
 mm/madvise.c                                          |   40 
 mm/memcontrol.c                                       |   10 
 mm/memory.c                                           |   61 
 mm/mempolicy.c                                        |   36 
 mm/migrate.c                                          |   16 
 mm/mincore.c                                          |    8 
 mm/mlock.c                                            |   22 
 mm/mmap.c                                             |   74 
 mm/mmu_gather.c                                       |    2 
 mm/mmu_notifier.c                                     |   22 
 mm/mprotect.c                                         |   22 
 mm/mremap.c                                           |   14 
 mm/msync.c                                            |    8 
 mm/nommu.c                                            |   22 
 mm/oom_kill.c                                         |   14 
 mm/page_io.c                                          |    1 
 mm/page_reporting.h                                   |    2 
 mm/pagewalk.c                                         |   12 
 mm/pgtable-generic.c                                  |    6 
 mm/process_vm_access.c                                |    4 
 mm/ptdump.c                                           |    4 
 mm/rmap.c                                             |   12 
 mm/shmem.c                                            |    5 
 mm/sparse-vmemmap.c                                   |    1 
 mm/sparse.c                                           |    1 
 mm/swap_state.c                                       |    5 
 mm/swapfile.c                                         |    5 
 mm/userfaultfd.c                                      |   26 
 mm/util.c                                             |   12 
 mm/vmacache.c                                         |    1 
 mm/zsmalloc.c                                         |    4 
 net/ipv4/tcp.c                                        |    8 
 net/xdp/xdp_umem.c                                    |    4 
 security/keys/keyctl.c                                |    2 
 sound/core/oss/pcm_oss.c                              |    2 
 sound/core/sgbuf.c                                    |    1 
 sound/pci/hda/hda_intel.c                             |    4 
 sound/soc/intel/common/sst-firmware.c                 |    4 
 sound/soc/intel/haswell/sst-haswell-pcm.c             |    4 
 tools/include/linux/kallsyms.h                        |    2 
 virt/kvm/async_pf.c                                   |    4 
 virt/kvm/kvm_main.c                                   |    9 
 942 files changed, 4580 insertions(+), 5662 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-08  4:35 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-06-08  4:35 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


Various trees.  Mainly those parts of MM whose linux-next dependents
are now merged.  I'm still sitting on ~160 patches which await merges
from -next.


54 patches, based on 9aa900c8094dba7a60dc805ecec1e9f720744ba1.

Subsystems affected by this patch series:

  mm/proc
  ipc
  dynamic-debug
  panic
  lib
  sysctl
  mm/gup
  mm/pagemap

Subsystem: mm/proc

    SeongJae Park <sjpark@amazon.de>:
      mm/page_idle.c: skip offline pages

Subsystem: ipc

    Jules Irenge <jbi.octave@gmail.com>:
      ipc/msg: add missing annotation for freeque()

    Giuseppe Scrivano <gscrivan@redhat.com>:
      ipc/namespace.c: use a work queue to free_ipc

Subsystem: dynamic-debug

    Orson Zhai <orson.zhai@unisoc.com>:
      dynamic_debug: add an option to enable dynamic debug for modules only

Subsystem: panic

    Rafael Aquini <aquini@redhat.com>:
      kernel: add panic_on_taint

Subsystem: lib

    Manfred Spraul <manfred@colorfullife.com>:
      xarray.h: correct return code documentation for xa_store_{bh,irq}()

Subsystem: sysctl

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "support setting sysctl parameters from kernel command line", v3:
      kernel/sysctl: support setting sysctl parameters from kernel command line
      kernel/sysctl: support handling command line aliases
      kernel/hung_task convert hung_task_panic boot parameter to sysctl
      tools/testing/selftests/sysctl/sysctl.sh: support CONFIG_TEST_SYSCTL=y
      lib/test_sysctl: support testing of sysctl. boot parameter

    "Guilherme G. Piccoli" <gpiccoli@canonical.com>:
      kernel/watchdog.c: convert {soft/hard}lockup boot parameters to sysctl aliases
      kernel/hung_task.c: introduce sysctl to print all traces when a hung task is detected
      panic: add sysctl to dump all CPUs backtraces on oops event

    Rafael Aquini <aquini@redhat.com>:
      kernel/sysctl.c: ignore out-of-range taint bits introduced via kernel.tainted

Subsystem: mm/gup

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm/gup.c: convert to use get_user_{page|pages}_fast_only()

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: update pin_user_pages.rst for "case 3" (mmu notifiers)
    Patch series "mm/gup: introduce pin_user_pages_locked(), use it in frame_vector.c", v2:
      mm/gup: introduce pin_user_pages_locked()
      mm/gup: frame_vector: convert get_user_pages() --> pin_user_pages()
      mm/gup: documentation fix for pin_user_pages*() APIs
    Patch series "vhost, docs: convert to pin_user_pages(), new "case 5"":
      docs: mm/gup: pin_user_pages.rst: add a "case 5"
      vhost: convert get_user_pages() --> pin_user_pages()

Subsystem: mm/pagemap

    Alexander Gordeev <agordeev@linux.ibm.com>:
      mm/mmap.c: add more sanity checks to get_unmapped_area()
      mm/mmap.c: do not allow mappings outside of allowed limits

    Christoph Hellwig <hch@lst.de>:
    Patch series "sort out the flush_icache_range mess", v2:
      arm: fix the flush_icache_range arguments in set_fiq_handler
      nds32: unexport flush_icache_page
      powerpc: unexport flush_icache_user_range
      unicore32: remove flush_cache_user_range
      asm-generic: fix the inclusion guards for cacheflush.h
      asm-generic: don't include <linux/mm.h> in cacheflush.h
      asm-generic: improve the flush_dcache_page stub
      alpha: use asm-generic/cacheflush.h
      arm64: use asm-generic/cacheflush.h
      c6x: use asm-generic/cacheflush.h
      hexagon: use asm-generic/cacheflush.h
      ia64: use asm-generic/cacheflush.h
      microblaze: use asm-generic/cacheflush.h
      m68knommu: use asm-generic/cacheflush.h
      openrisc: use asm-generic/cacheflush.h
      powerpc: use asm-generic/cacheflush.h
      riscv: use asm-generic/cacheflush.h
      arm,sparc,unicore32: remove flush_icache_user_range
      mm: rename flush_icache_user_range to flush_icache_user_page
      asm-generic: add a flush_icache_user_range stub
      sh: implement flush_icache_user_range
      xtensa: implement flush_icache_user_range
      arm: rename flush_cache_user_range to flush_icache_user_range
      m68k: implement flush_icache_user_range
      exec: only build read_code when needed
      exec: use flush_icache_user_range in read_code
      binfmt_flat: use flush_icache_user_range
      nommu: use flush_icache_user_range in brk and mmap
      module: move the set_fs hack for flush_icache_range to m68k

    Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
      doc: cgroup: update note about conditions when oom killer is invoked

 Documentation/admin-guide/cgroup-v2.rst           |   17 +-
 Documentation/admin-guide/dynamic-debug-howto.rst |    5 
 Documentation/admin-guide/kdump/kdump.rst         |    8 +
 Documentation/admin-guide/kernel-parameters.txt   |   34 +++-
 Documentation/admin-guide/sysctl/kernel.rst       |   37 ++++
 Documentation/core-api/pin_user_pages.rst         |   47 ++++--
 arch/alpha/include/asm/cacheflush.h               |   38 +----
 arch/alpha/kernel/smp.c                           |    2 
 arch/arm/include/asm/cacheflush.h                 |    7 
 arch/arm/kernel/fiq.c                             |    4 
 arch/arm/kernel/traps.c                           |    2 
 arch/arm64/include/asm/cacheflush.h               |   46 ------
 arch/c6x/include/asm/cacheflush.h                 |   19 --
 arch/hexagon/include/asm/cacheflush.h             |   19 --
 arch/ia64/include/asm/cacheflush.h                |   30 ----
 arch/m68k/include/asm/cacheflush_mm.h             |    6 
 arch/m68k/include/asm/cacheflush_no.h             |   19 --
 arch/m68k/mm/cache.c                              |   13 +
 arch/microblaze/include/asm/cacheflush.h          |   29 ---
 arch/nds32/include/asm/cacheflush.h               |    4 
 arch/nds32/mm/cacheflush.c                        |    3 
 arch/openrisc/include/asm/cacheflush.h            |   33 ----
 arch/powerpc/include/asm/cacheflush.h             |   46 +-----
 arch/powerpc/kvm/book3s_64_mmu_hv.c               |    2 
 arch/powerpc/kvm/book3s_64_mmu_radix.c            |    2 
 arch/powerpc/mm/mem.c                             |    3 
 arch/powerpc/perf/callchain_64.c                  |    4 
 arch/riscv/include/asm/cacheflush.h               |   65 --------
 arch/sh/include/asm/cacheflush.h                  |    1 
 arch/sparc/include/asm/cacheflush_32.h            |    2 
 arch/sparc/include/asm/cacheflush_64.h            |    1 
 arch/um/include/asm/tlb.h                         |    2 
 arch/unicore32/include/asm/cacheflush.h           |   11 -
 arch/x86/include/asm/cacheflush.h                 |    2 
 arch/xtensa/include/asm/cacheflush.h              |    2 
 drivers/media/platform/omap3isp/ispvideo.c        |    2 
 drivers/nvdimm/pmem.c                             |    3 
 drivers/vhost/vhost.c                             |    5 
 fs/binfmt_flat.c                                  |    2 
 fs/exec.c                                         |    5 
 fs/proc/proc_sysctl.c                             |  163 ++++++++++++++++++++--
 include/asm-generic/cacheflush.h                  |   25 +--
 include/linux/dev_printk.h                        |    6 
 include/linux/dynamic_debug.h                     |    2 
 include/linux/ipc_namespace.h                     |    2 
 include/linux/kernel.h                            |    9 +
 include/linux/mm.h                                |   12 +
 include/linux/net.h                               |    3 
 include/linux/netdevice.h                         |    6 
 include/linux/printk.h                            |    9 -
 include/linux/sched/sysctl.h                      |    7 
 include/linux/sysctl.h                            |    4 
 include/linux/xarray.h                            |    4 
 include/rdma/ib_verbs.h                           |    6 
 init/main.c                                       |    2 
 ipc/msg.c                                         |    2 
 ipc/namespace.c                                   |   24 ++-
 kernel/events/core.c                              |    4 
 kernel/events/uprobes.c                           |    2 
 kernel/hung_task.c                                |   30 ++--
 kernel/module.c                                   |    8 -
 kernel/panic.c                                    |   45 ++++++
 kernel/sysctl.c                                   |   38 ++++-
 kernel/watchdog.c                                 |   37 +---
 lib/Kconfig.debug                                 |   12 +
 lib/Makefile                                      |    2 
 lib/dynamic_debug.c                               |    9 -
 lib/test_sysctl.c                                 |   13 +
 mm/frame_vector.c                                 |    7 
 mm/gup.c                                          |   74 +++++++--
 mm/mmap.c                                         |   28 ++-
 mm/nommu.c                                        |    4 
 mm/page_alloc.c                                   |    9 -
 mm/page_idle.c                                    |    7 
 tools/testing/selftests/sysctl/sysctl.sh          |   44 +++++
 virt/kvm/kvm_main.c                               |    8 -
 76 files changed, 732 insertions(+), 517 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-04 23:45 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-06-04 23:45 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: linux-mm, mm-commits


- More MM work.  100ish more to go.  Mike's "mm: remove
  __ARCH_HAS_5LEVEL_HACK" series should fix the current ppc issue.

- Various other little subsystems

127 patches, based on 6929f71e46bdddbf1c4d67c2728648176c67c555.


Subsystems affected by this patch series:

  kcov
  mm/pagemap
  mm/vmalloc
  mm/kmap
  mm/util
  mm/memory-hotplug
  mm/cleanups
  mm/zram
  procfs
  core-kernel
  get_maintainer
  lib
  bitops
  checkpatch
  binfmt
  init
  fat
  seq_file
  exec
  rapidio
  relay
  selftests
  ubsan

Subsystem: kcov

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kcov: collect coverage from usb soft interrupts", v4:
      kcov: cleanup debug messages
      kcov: fix potential use-after-free in kcov_remote_start
      kcov: move t->kcov assignments into kcov_start/stop
      kcov: move t->kcov_sequence assignment
      kcov: use t->kcov_mode as enabled indicator
      kcov: collect coverage from interrupts
      usb: core: kcov: collect coverage from usb complete callback

Subsystem: mm/pagemap

    Feng Tang <feng.tang@intel.com>:
      mm/util.c: remove the VM_WARN_ONCE for vm_committed_as underflow check

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: remove __ARCH_HAS_5LEVEL_HACK", v4:
      h8300: remove usage of __ARCH_USE_5LEVEL_HACK
      arm: add support for folded p4d page tables
      arm64: add support for folded p4d page tables
      hexagon: remove __ARCH_USE_5LEVEL_HACK
      ia64: add support for folded p4d page tables
      nios2: add support for folded p4d page tables
      openrisc: add support for folded p4d page tables
      powerpc: add support for folded p4d page tables

    Geert Uytterhoeven <geert+renesas@glider.be>:
      sh: fault: modernize printing of kernel messages

    Mike Rapoport <rppt@linux.ibm.com>:
      sh: drop __pXd_offset() macros that duplicate pXd_index() ones
      sh: add support for folded p4d page tables
      unicore32: remove __ARCH_USE_5LEVEL_HACK
      asm-generic: remove pgtable-nop4d-hack.h
      mm: remove __ARCH_HAS_5LEVEL_HACK and include/asm-generic/5level-fixup.h

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/debug: Add tests validating architecture page table:
      x86/mm: define mm_p4d_folded()
      mm/debug: add tests validating architecture page table helpers

Subsystem: mm/vmalloc

    Jeongtae Park <jtp.park@samsung.com>:
      mm/vmalloc: fix a typo in comment

Subsystem: mm/kmap

    Ira Weiny <ira.weiny@intel.com>:
    Patch series "Remove duplicated kmap code", v3:
      arch/kmap: remove BUG_ON()
      arch/xtensa: move kmap build bug out of the way
      arch/kmap: remove redundant arch specific kmaps
      arch/kunmap: remove duplicate kunmap implementations
      {x86,powerpc,microblaze}/kmap: move preempt disable
      arch/kmap_atomic: consolidate duplicate code
      arch/kunmap_atomic: consolidate duplicate code
      arch/kmap: ensure kmap_prot visibility
      arch/kmap: don't hard code kmap_prot values
      arch/kmap: define kmap_atomic_prot() for all arch's
      drm: remove drm specific kmap_atomic code
      kmap: remove kmap_atomic_to_page()
      parisc/kmap: remove duplicate kmap code
      sparc: remove unnecessary includes
      kmap: consolidate kmap_prot definitions

Subsystem: mm/util

    Waiman Long <longman@redhat.com>:
      mm: add kvfree_sensitive() for freeing sensitive data objects

Subsystem: mm/memory-hotplug

    Vishal Verma <vishal.l.verma@intel.com>:
      mm/memory_hotplug: refrain from adding memory into an impossible node

    David Hildenbrand <david@redhat.com>:
      powerpc/pseries/hotplug-memory: stop checking is_mem_section_removable()
      mm/memory_hotplug: remove is_mem_section_removable()
    Patch series "mm/memory_hotplug: handle memblocks only with:
      mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0
      mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK
    Patch series "mm/memory_hotplug: Interface to add driver-managed system:
      mm/memory_hotplug: introduce add_memory_driver_managed()
      kexec_file: don't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED
      device-dax: add memory via add_memory_driver_managed()

    Michal Hocko <mhocko@kernel.org>:
      mm/memory_hotplug: disable the functionality for 32b

Subsystem: mm/cleanups

    chenqiwu <chenqiwu@xiaomi.com>:
      mm: replace zero-length array with flexible-array member

    Ethon Paul <ethp@qq.com>:
      mm/memory_hotplug: fix a typo in comment "recoreded"->"recorded"
      mm: ksm: fix a typo in comment "alreaady"->"already"
      mm: mmap: fix a typo in comment "compatbility"->"compatibility"
      mm/hugetlb: fix a typos in comments
      mm/vmsan: fix some typos in comment
      mm/compaction: fix a typo in comment "pessemistic"->"pessimistic"
      mm/memblock: fix a typo in comment "implict"->"implicit"
      mm/list_lru: fix a typo in comment "numbesr"->"numbers"
      mm/filemap: fix a typo in comment "unneccssary"->"unnecessary"
      mm/frontswap: fix some typos in frontswap.c
      mm, memcg: fix some typos in memcontrol.c
      mm: fix a typo in comment "strucure"->"structure"
      mm/slub: fix a typo in comment "disambiguiation"->"disambiguation"
      mm/sparse: fix a typo in comment "convienence"->"convenience"
      mm/page-writeback: fix a typo in comment "effictive"->"effective"
      mm/memory: fix a typo in comment "attampt"->"attempt"

    Zou Wei <zou_wei@huawei.com>:
      mm: use false for bool variable

    Jason Yan <yanaijie@huawei.com>:
      include/linux/mm.h: return true in cpupid_pid_unset()

Subsystem: mm/zram

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      zcomp: Use ARRAY_SIZE() for backends list

Subsystem: procfs

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: rename "catch" function argument

Subsystem: core-kernel

    Jason Yan <yanaijie@huawei.com>:
      user.c: make uidhash_table static

Subsystem: get_maintainer

    Joe Perches <joe@perches.com>:
      get_maintainer: add email addresses from .yaml files
      get_maintainer: fix unexpected behavior for path/to//file (double slashes)

Subsystem: lib

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      lib/math: avoid trailing newline hidden in pr_fmt()

    KP Singh <kpsingh@chromium.org>:
      lib: Add might_fault() to strncpy_from_user.

    Jason Yan <yanaijie@huawei.com>:
      lib/test_lockup.c: make test_inode static

    Jann Horn <jannh@google.com>:
      lib/zlib: remove outdated and incorrect pre-increment optimization

    Joe Perches <joe@perches.com>:
      lib/percpu-refcount.c: use a more common logging style

    Tan Hu <tan.hu@zte.com.cn>:
      lib/flex_proportions.c: cleanup __fprop_inc_percpu_max

    Jesse Brandeburg <jesse.brandeburg@intel.com>:
      lib: make a test module with set/clear bit

Subsystem: bitops

    Arnd Bergmann <arnd@arndb.de>:
      include/linux/bitops.h: avoid clang shift-count-overflow warnings

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: additional MAINTAINER section entry ordering checks
      checkpatch: look for c99 comments in ctx_locate_comment
      checkpatch: disallow --git and --file/--fix

    Geert Uytterhoeven <geert+renesas@glider.be>:
      checkpatch: use patch subject when reading from stdin

Subsystem: binfmt

    Anthony Iliopoulos <ailiop@suse.com>:
      fs/binfmt_elf: remove redundant elf_map ifndef

    Nick Desaulniers <ndesaulniers@google.com>:
      elfnote: mark all .note sections SHF_ALLOC

Subsystem: init

    Chris Down <chris@chrisdown.name>:
      init: allow distribution configuration of default init

Subsystem: fat

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      fat: don't allow to mount if the FAT length == 0
      fat: improve the readahead for FAT entries

Subsystem: seq_file

    Joe Perches <joe@perches.com>:
      fs/seq_file.c: seq_read: Update pr_info_ratelimited

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "seq_file: Introduce DEFINE_SEQ_ATTRIBUTE() helper macro":
      include/linux/seq_file.h: introduce DEFINE_SEQ_ATTRIBUTE() helper macro
      mm/vmstat.c: convert to use DEFINE_SEQ_ATTRIBUTE macro
      kernel/kprobes.c: convert to use DEFINE_SEQ_ATTRIBUTE macro

Subsystem: exec

    Christoph Hellwig <hch@lst.de>:
      exec: simplify the copy_strings_kernel calling convention
      exec: open code copy_string_kernel

Subsystem: rapidio

    Madhuparna Bhowmik <madhuparnabhowmik10@gmail.com>:
      rapidio: avoid data race between file operation callbacks and mport_cdev_add().

    John Hubbard <jhubbard@nvidia.com>:
      rapidio: convert get_user_pages() --> pin_user_pages()

Subsystem: relay

    Daniel Axtens <dja@axtens.net>:
      kernel/relay.c: handle alloc_percpu returning NULL in relay_open

    Pengcheng Yang <yangpc@wangsu.com>:
      kernel/relay.c: fix read_pos error when multiple readers

Subsystem: selftests

    Ram Pai <linuxram@us.ibm.com>:
    Patch series "selftests, powerpc, x86: Memory Protection Keys", v19:
      selftests/x86/pkeys: move selftests to arch-neutral directory
      selftests/vm/pkeys: rename all references to pkru to a generic name
      selftests/vm/pkeys: move generic definitions to header file

    Thiago Jung Bauermann <bauerman@linux.ibm.com>:
      selftests/vm/pkeys: move some definitions to arch-specific header
      selftests/vm/pkeys: make gcc check arguments of sigsafe_printf()

    Sandipan Das <sandipan@linux.ibm.com>:
      selftests: vm: pkeys: Use sane types for pkey register
      selftests: vm: pkeys: add helpers for pkey bits

    Ram Pai <linuxram@us.ibm.com>:
      selftests/vm/pkeys: fix pkey_disable_clear()
      selftests/vm/pkeys: fix assertion in pkey_disable_set/clear()
      selftests/vm/pkeys: fix alloc_random_pkey() to make it really random

    Sandipan Das <sandipan@linux.ibm.com>:
      selftests: vm: pkeys: use the correct huge page size

    Ram Pai <linuxram@us.ibm.com>:
      selftests/vm/pkeys: introduce generic pkey abstractions
      selftests/vm/pkeys: introduce powerpc support

    "Desnes A. Nunes do Rosario" <desnesn@linux.vnet.ibm.com>:
      selftests/vm/pkeys: fix number of reserved powerpc pkeys

    Ram Pai <linuxram@us.ibm.com>:
      selftests/vm/pkeys: fix assertion in test_pkey_alloc_exhaust()
      selftests/vm/pkeys: improve checks to determine pkey support
      selftests/vm/pkeys: associate key on a mapped page and detect access violation
      selftests/vm/pkeys: associate key on a mapped page and detect write violation
      selftests/vm/pkeys: detect write violation on a mapped access-denied-key page
      selftests/vm/pkeys: introduce a sub-page allocator
      selftests/vm/pkeys: test correct behaviour of pkey-0
      selftests/vm/pkeys: override access right definitions on powerpc

    Sandipan Das <sandipan@linux.ibm.com>:
      selftests: vm: pkeys: use the correct page size on powerpc
      selftests: vm: pkeys: fix multilib builds for x86

    Jagadeesh Pagadala <jagdsh.linux@gmail.com>:
      tools/testing/selftests/vm: remove duplicate headers

Subsystem: ubsan

    Arnd Bergmann <arnd@arndb.de>:
      lib/ubsan.c: fix gcc-10 warnings

 Documentation/dev-tools/kcov.rst                               |   17 
 Documentation/features/debug/debug-vm-pgtable/arch-support.txt |   34 
 arch/arc/Kconfig                                               |    1 
 arch/arc/include/asm/highmem.h                                 |   20 
 arch/arc/mm/highmem.c                                          |   34 
 arch/arm/include/asm/highmem.h                                 |    9 
 arch/arm/include/asm/pgtable.h                                 |    1 
 arch/arm/lib/uaccess_with_memcpy.c                             |    7 
 arch/arm/mach-sa1100/assabet.c                                 |    2 
 arch/arm/mm/dump.c                                             |   29 
 arch/arm/mm/fault-armv.c                                       |    7 
 arch/arm/mm/fault.c                                            |   22 
 arch/arm/mm/highmem.c                                          |   41 
 arch/arm/mm/idmap.c                                            |    3 
 arch/arm/mm/init.c                                             |    2 
 arch/arm/mm/ioremap.c                                          |   12 
 arch/arm/mm/mm.h                                               |    2 
 arch/arm/mm/mmu.c                                              |   35 
 arch/arm/mm/pgd.c                                              |   40 
 arch/arm64/Kconfig                                             |    1 
 arch/arm64/include/asm/kvm_mmu.h                               |   10 
 arch/arm64/include/asm/pgalloc.h                               |   10 
 arch/arm64/include/asm/pgtable-types.h                         |    5 
 arch/arm64/include/asm/pgtable.h                               |   37 
 arch/arm64/include/asm/stage2_pgtable.h                        |   48 
 arch/arm64/kernel/hibernate.c                                  |   44 
 arch/arm64/kvm/mmu.c                                           |  209 
 arch/arm64/mm/fault.c                                          |    9 
 arch/arm64/mm/hugetlbpage.c                                    |   15 
 arch/arm64/mm/kasan_init.c                                     |   26 
 arch/arm64/mm/mmu.c                                            |   52 
 arch/arm64/mm/pageattr.c                                       |    7 
 arch/csky/include/asm/highmem.h                                |   12 
 arch/csky/mm/highmem.c                                         |   64 
 arch/h8300/include/asm/pgtable.h                               |    1 
 arch/hexagon/include/asm/fixmap.h                              |    4 
 arch/hexagon/include/asm/pgtable.h                             |    1 
 arch/ia64/include/asm/pgalloc.h                                |    4 
 arch/ia64/include/asm/pgtable.h                                |   17 
 arch/ia64/mm/fault.c                                           |    7 
 arch/ia64/mm/hugetlbpage.c                                     |   18 
 arch/ia64/mm/init.c                                            |   28 
 arch/microblaze/include/asm/highmem.h                          |   55 
 arch/microblaze/mm/highmem.c                                   |   21 
 arch/microblaze/mm/init.c                                      |    3 
 arch/mips/include/asm/highmem.h                                |   11 
 arch/mips/mm/cache.c                                           |    6 
 arch/mips/mm/highmem.c                                         |   62 
 arch/nds32/include/asm/highmem.h                               |    9 
 arch/nds32/mm/highmem.c                                        |   49 
 arch/nios2/include/asm/pgtable.h                               |    3 
 arch/nios2/mm/fault.c                                          |    9 
 arch/nios2/mm/ioremap.c                                        |    6 
 arch/openrisc/include/asm/pgtable.h                            |    1 
 arch/openrisc/mm/fault.c                                       |   10 
 arch/openrisc/mm/init.c                                        |    4 
 arch/parisc/include/asm/cacheflush.h                           |   32 
 arch/powerpc/Kconfig                                           |    1 
 arch/powerpc/include/asm/book3s/32/pgtable.h                   |    1 
 arch/powerpc/include/asm/book3s/64/hash.h                      |    4 
 arch/powerpc/include/asm/book3s/64/pgalloc.h                   |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h                   |   60 
 arch/powerpc/include/asm/book3s/64/radix.h                     |    6 
 arch/powerpc/include/asm/highmem.h                             |   56 
 arch/powerpc/include/asm/nohash/32/pgtable.h                   |    1 
 arch/powerpc/include/asm/nohash/64/pgalloc.h                   |    2 
 arch/powerpc/include/asm/nohash/64/pgtable-4k.h                |   32 
 arch/powerpc/include/asm/nohash/64/pgtable.h                   |    6 
 arch/powerpc/include/asm/pgtable.h                             |   10 
 arch/powerpc/kvm/book3s_64_mmu_radix.c                         |   32 
 arch/powerpc/lib/code-patching.c                               |    7 
 arch/powerpc/mm/book3s64/hash_pgtable.c                        |    4 
 arch/powerpc/mm/book3s64/radix_pgtable.c                       |   26 
 arch/powerpc/mm/book3s64/subpage_prot.c                        |    6 
 arch/powerpc/mm/highmem.c                                      |   26 
 arch/powerpc/mm/hugetlbpage.c                                  |   28 
 arch/powerpc/mm/kasan/kasan_init_32.c                          |    2 
 arch/powerpc/mm/mem.c                                          |    3 
 arch/powerpc/mm/nohash/book3e_pgtable.c                        |   15 
 arch/powerpc/mm/pgtable.c                                      |   30 
 arch/powerpc/mm/pgtable_64.c                                   |   10 
 arch/powerpc/mm/ptdump/hashpagetable.c                         |   20 
 arch/powerpc/mm/ptdump/ptdump.c                                |   12 
 arch/powerpc/platforms/pseries/hotplug-memory.c                |   26 
 arch/powerpc/xmon/xmon.c                                       |   27 
 arch/s390/Kconfig                                              |    1 
 arch/sh/include/asm/pgtable-2level.h                           |    1 
 arch/sh/include/asm/pgtable-3level.h                           |    1 
 arch/sh/include/asm/pgtable_32.h                               |    5 
 arch/sh/include/asm/pgtable_64.h                               |    5 
 arch/sh/kernel/io_trapped.c                                    |    7 
 arch/sh/mm/cache-sh4.c                                         |    4 
 arch/sh/mm/cache-sh5.c                                         |    7 
 arch/sh/mm/fault.c                                             |   64 
 arch/sh/mm/hugetlbpage.c                                       |   28 
 arch/sh/mm/init.c                                              |   15 
 arch/sh/mm/kmap.c                                              |    2 
 arch/sh/mm/tlbex_32.c                                          |    6 
 arch/sh/mm/tlbex_64.c                                          |    7 
 arch/sparc/include/asm/highmem.h                               |   29 
 arch/sparc/mm/highmem.c                                        |   31 
 arch/sparc/mm/io-unit.c                                        |    1 
 arch/sparc/mm/iommu.c                                          |    1 
 arch/unicore32/include/asm/pgtable.h                           |    1 
 arch/unicore32/kernel/hibernate.c                              |    4 
 arch/x86/Kconfig                                               |    1 
 arch/x86/include/asm/fixmap.h                                  |    1 
 arch/x86/include/asm/highmem.h                                 |   37 
 arch/x86/include/asm/pgtable_64.h                              |    6 
 arch/x86/mm/highmem_32.c                                       |   52 
 arch/xtensa/include/asm/highmem.h                              |   31 
 arch/xtensa/mm/highmem.c                                       |   28 
 drivers/block/zram/zcomp.c                                     |    7 
 drivers/dax/dax-private.h                                      |    1 
 drivers/dax/kmem.c                                             |   28 
 drivers/gpu/drm/ttm/ttm_bo_util.c                              |   56 
 drivers/gpu/drm/vmwgfx/vmwgfx_blit.c                           |   17 
 drivers/rapidio/devices/rio_mport_cdev.c                       |   27 
 drivers/usb/core/hcd.c                                         |    3 
 fs/binfmt_elf.c                                                |    4 
 fs/binfmt_em86.c                                               |    6 
 fs/binfmt_misc.c                                               |    4 
 fs/binfmt_script.c                                             |    6 
 fs/exec.c                                                      |   58 
 fs/fat/fatent.c                                                |  103 
 fs/fat/inode.c                                                 |    6 
 fs/proc/array.c                                                |    8 
 fs/seq_file.c                                                  |    7 
 include/asm-generic/5level-fixup.h                             |   59 
 include/asm-generic/pgtable-nop4d-hack.h                       |   64 
 include/asm-generic/pgtable-nopud.h                            |    4 
 include/drm/ttm/ttm_bo_api.h                                   |    4 
 include/linux/binfmts.h                                        |    3 
 include/linux/bitops.h                                         |    2 
 include/linux/elfnote.h                                        |    2 
 include/linux/highmem.h                                        |   89 
 include/linux/ioport.h                                         |    1 
 include/linux/memory_hotplug.h                                 |    9 
 include/linux/mm.h                                             |   12 
 include/linux/sched.h                                          |    3 
 include/linux/seq_file.h                                       |   19 
 init/Kconfig                                                   |   10 
 init/main.c                                                    |   10 
 kernel/kcov.c                                                  |  282 -
 kernel/kexec_file.c                                            |    5 
 kernel/kprobes.c                                               |   34 
 kernel/relay.c                                                 |   22 
 kernel/user.c                                                  |    2 
 lib/Kconfig.debug                                              |   44 
 lib/Makefile                                                   |    2 
 lib/flex_proportions.c                                         |    7 
 lib/math/prime_numbers.c                                       |   10 
 lib/percpu-refcount.c                                          |    6 
 lib/strncpy_from_user.c                                        |    1 
 lib/test_bitops.c                                              |   60 
 lib/test_lockup.c                                              |    2 
 lib/ubsan.c                                                    |   33 
 lib/zlib_inflate/inffast.c                                     |   91 
 mm/Kconfig                                                     |    4 
 mm/Makefile                                                    |    1 
 mm/compaction.c                                                |    2 
 mm/debug_vm_pgtable.c                                          |  382 +
 mm/filemap.c                                                   |    2 
 mm/frontswap.c                                                 |    6 
 mm/huge_memory.c                                               |    2 
 mm/hugetlb.c                                                   |   16 
 mm/internal.h                                                  |    2 
 mm/kasan/init.c                                                |   11 
 mm/ksm.c                                                       |   10 
 mm/list_lru.c                                                  |    2 
 mm/memblock.c                                                  |    2 
 mm/memcontrol.c                                                |    4 
 mm/memory.c                                                    |   10 
 mm/memory_hotplug.c                                            |  179 
 mm/mmap.c                                                      |    2 
 mm/mremap.c                                                    |    2 
 mm/page-writeback.c                                            |    2 
 mm/slub.c                                                      |    2 
 mm/sparse.c                                                    |    2 
 mm/util.c                                                      |   22 
 mm/vmalloc.c                                                   |    2 
 mm/vmscan.c                                                    |    6 
 mm/vmstat.c                                                    |   32 
 mm/zbud.c                                                      |    2 
 scripts/checkpatch.pl                                          |   62 
 scripts/get_maintainer.pl                                      |   46 
 security/keys/internal.h                                       |   11 
 security/keys/keyctl.c                                         |   16 
 tools/testing/selftests/lib/config                             |    1 
 tools/testing/selftests/vm/.gitignore                          |    1 
 tools/testing/selftests/vm/Makefile                            |   75 
 tools/testing/selftests/vm/mremap_dontunmap.c                  |    1 
 tools/testing/selftests/vm/pkey-helpers.h                      |  557 +-
 tools/testing/selftests/vm/pkey-powerpc.h                      |  153 
 tools/testing/selftests/vm/pkey-x86.h                          |  191 
 tools/testing/selftests/vm/protection_keys.c                   | 2370 ++++++++--
 tools/testing/selftests/x86/.gitignore                         |    1 
 tools/testing/selftests/x86/Makefile                           |    2 
 tools/testing/selftests/x86/pkey-helpers.h                     |  219 
 tools/testing/selftests/x86/protection_keys.c                  | 1506 ------
 200 files changed, 5182 insertions(+), 4033 deletions(-)




^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-03 22:55 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-06-03 22:55 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


More mm/ work, plenty more to come.

131 patches, based on d6f9469a03d832dcd17041ed67774ffb5f3e73b3.

Subsystems affected by this patch series:

  mm/slub
  mm/memcg
  mm/gup
  mm/kasan
  mm/pagealloc
  mm/hugetlb
  mm/vmscan
  mm/tools
  mm/mempolicy
  mm/memblock
  mm/hugetlbfs
  mm/thp
  mm/mmap
  mm/kconfig

Subsystem: mm/slub

    Wang Hai <wanghai38@huawei.com>:
      mm/slub: fix a memory leak in sysfs_slab_add()

Subsystem: mm/memcg

    Shakeel Butt <shakeelb@google.com>:
      mm/memcg: optimize memory.numa_stat like memory.stat

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "mm/gup, drm/i915: refactor gup_fast, convert to pin_user_pages()", v2:
      mm/gup: move __get_user_pages_fast() down a few lines in gup.c
      mm/gup: refactor and de-duplicate gup_fast() code
      mm/gup: introduce pin_user_pages_fast_only()
      drm/i915: convert get_user_pages() --> pin_user_pages()
      mm/gup: might_lock_read(mmap_sem) in get_user_pages_fast()

Subsystem: mm/kasan

    Daniel Axtens <dja@axtens.net>:
    Patch series "Fix some incompatibilites between KASAN and FORTIFY_SOURCE", v4:
      kasan: stop tests being eliminated as dead code with FORTIFY_SOURCE
      string.h: fix incompatibility between FORTIFY_SOURCE and KASAN

Subsystem: mm/pagealloc

    Michal Hocko <mhocko@suse.com>:
      mm: clarify __GFP_MEMALLOC usage

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: rework free_area_init*() funcitons":
      mm: memblock: replace dereferences of memblock_region.nid with API calls
      mm: make early_pfn_to_nid() and related defintions close to each other
      mm: remove CONFIG_HAVE_MEMBLOCK_NODE_MAP option
      mm: free_area_init: use maximal zone PFNs rather than zone sizes
      mm: use free_area_init() instead of free_area_init_nodes()
      alpha: simplify detection of memory zone boundaries
      arm: simplify detection of memory zone boundaries
      arm64: simplify detection of memory zone boundaries for UMA configs
      csky: simplify detection of memory zone boundaries
      m68k: mm: simplify detection of memory zone boundaries
      parisc: simplify detection of memory zone boundaries
      sparc32: simplify detection of memory zone boundaries
      unicore32: simplify detection of memory zone boundaries
      xtensa: simplify detection of memory zone boundaries

    Baoquan He <bhe@redhat.com>:
      mm: memmap_init: iterate over memblock regions rather that check each PFN

    Mike Rapoport <rppt@linux.ibm.com>:
      mm: remove early_pfn_in_nid() and CONFIG_NODES_SPAN_OTHER_NODES
      mm: free_area_init: allow defining max_zone_pfn in descending order
      mm: rename free_area_init_node() to free_area_init_memoryless_node()
      mm: clean up free_area_init_node() and its helpers
      mm: simplify find_min_pfn_with_active_regions()
      docs/vm: update memory-models documentation

    Wei Yang <richard.weiyang@gmail.com>:
    Patch series "mm/page_alloc.c: cleanup on check page", v3:
      mm/page_alloc.c: bad_[reason|flags] is not necessary when PageHWPoison
      mm/page_alloc.c: bad_flags is not necessary for bad_page()
      mm/page_alloc.c: rename free_pages_check_bad() to check_free_page_bad()
      mm/page_alloc.c: rename free_pages_check() to check_free_page()
      mm/page_alloc.c: extract check_[new|free]_page_bad() common part to page_bad_reason()

    Roman Gushchin <guro@fb.com>:
      mm,page_alloc,cma: conditionally prefer cma pageblocks for movable allocations

    Baoquan He <bhe@redhat.com>:
      mm/page_alloc.c: remove unused free_bootmem_with_active_regions
    Patch series "improvements about lowmem_reserve and /proc/zoneinfo", v2:
      mm/page_alloc.c: only tune sysctl_lowmem_reserve_ratio value once when changing it
      mm/page_alloc.c: clear out zone->lowmem_reserve[] if the zone is empty
      mm/vmstat.c: do not show lowmem reserve protection information of empty zone

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
    Patch series "integrate classzone_idx and high_zoneidx", v5:
      mm/page_alloc: use ac->high_zoneidx for classzone_idx
      mm/page_alloc: integrate classzone_idx and high_zoneidx

    Wei Yang <richard.weiyang@gmail.com>:
      mm/page_alloc.c: use NODE_MASK_NONE in build_zonelists()
      mm: rename gfpflags_to_migratetype to gfp_migratetype for same convention

    Sandipan Das <sandipan@linux.ibm.com>:
      mm/page_alloc.c: reset numa stats for boot pagesets

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, page_alloc: reset the zone->watermark_boost early

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/page_alloc: restrict and formalize compound_page_dtors[]

    Daniel Jordan <daniel.m.jordan@oracle.com>:
    Patch series "initialize deferred pages with interrupts enabled", v4:
      mm/pagealloc.c: call touch_nmi_watchdog() on max order boundaries in deferred init

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      mm: initialize deferred pages with interrupts enabled
      mm: call cond_resched() from deferred_init_memmap()

    Daniel Jordan <daniel.m.jordan@oracle.com>:
    Patch series "padata: parallelize deferred page init", v3:
      padata: remove exit routine
      padata: initialize earlier
      padata: allocate work structures for parallel jobs from a pool
      padata: add basic support for multithreaded jobs
      mm: don't track number of pages during deferred initialization
      mm: parallelize deferred_init_memmap()
      mm: make deferred init's max threads arch-specific
      padata: document multithreaded jobs

    Chen Tao <chentao107@huawei.com>:
      mm/page_alloc.c: add missing newline

Subsystem: mm/hugetlb

    "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
    Patch series "thp/khugepaged improvements and CoW semantics", v4:
      khugepaged: add self test
      khugepaged: do not stop collapse if less than half PTEs are referenced
      khugepaged: drain all LRU caches before scanning pages
      khugepaged: drain LRU add pagevec after swapin
      khugepaged: allow to collapse a page shared across fork
      khugepaged: allow to collapse PTE-mapped compound pages
      thp: change CoW semantics for anon-THP
      khugepaged: introduce 'max_ptes_shared' tunable

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "Clean up hugetlb boot command line processing", v4:
      hugetlbfs: add arch_hugetlb_valid_size
      hugetlbfs: move hugepagesz= parsing to arch independent code
      hugetlbfs: remove hugetlb_add_hstate() warning for existing hstate
      hugetlbfs: clean up command line processing
      hugetlbfs: fix changes to command line processing

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb: avoid unnecessary check on pud and pmd entry in huge_pte_offset

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/hugetlb: Add some new generic fallbacks", v3:
      arm64/mm: drop __HAVE_ARCH_HUGE_PTEP_GET
      mm/hugetlb: define a generic fallback for is_hugepage_only_range()
      mm/hugetlb: define a generic fallback for arch_clear_hugepage_flags()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: simplify calling a compound page destructor

Subsystem: mm/vmscan

    Wei Yang <richard.weiyang@gmail.com>:
      mm/vmscan.c: use update_lru_size() in update_lru_sizes()

    Jaewon Kim <jaewon31.kim@samsung.com>:
      mm/vmscan: count layzfree pages and fix nr_isolated_* mismatch

    Maninder Singh <maninder1.s@samsung.com>:
      mm/vmscan.c: change prototype for shrink_page_list

    Qiwu Chen <qiwuchen55@gmail.com>:
      mm/vmscan: update the comment of should_continue_reclaim()

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "mm: memcontrol: charge swapin pages on instantiation", v2:
      mm: fix NUMA node file count error in replace_page_cache()
      mm: memcontrol: fix stat-corrupting race in charge moving
      mm: memcontrol: drop @compound parameter from memcg charging API
      mm: shmem: remove rare optimization when swapin races with hole punching
      mm: memcontrol: move out cgroup swaprate throttling
      mm: memcontrol: convert page cache to a new mem_cgroup_charge() API
      mm: memcontrol: prepare uncharging for removal of private page type counters
      mm: memcontrol: prepare move_account for removal of private page type counters
      mm: memcontrol: prepare cgroup vmstat infrastructure for native anon counters
      mm: memcontrol: switch to native NR_FILE_PAGES and NR_SHMEM counters
      mm: memcontrol: switch to native NR_ANON_MAPPED counter
      mm: memcontrol: switch to native NR_ANON_THPS counter
      mm: memcontrol: convert anon and file-thp to new mem_cgroup_charge() API
      mm: memcontrol: drop unused try/commit/cancel charge API
      mm: memcontrol: prepare swap controller setup for integration
      mm: memcontrol: make swap tracking an integral part of memory control
      mm: memcontrol: charge swapin pages on instantiation

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm: memcontrol: document the new swap control behavior

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: delete unused lrucare handling
      mm: memcontrol: update page->mem_cgroup stability rules
      mm: fix LRU balancing effect of new transparent huge pages
      mm: keep separate anon and file statistics on page reclaim activity
      mm: allow swappiness that prefers reclaiming anon over the file workingset
      mm: fold and remove lru_cache_add_anon() and lru_cache_add_file()
      mm: workingset: let cache workingset challenge anon
      mm: remove use-once cache bias from LRU balancing
      mm: vmscan: drop unnecessary div0 avoidance rounding in get_scan_count()
      mm: base LRU balancing on an explicit cost model
      mm: deactivations shouldn't bias the LRU balance
      mm: only count actual rotations as LRU reclaim cost
      mm: balance LRU lists based on relative thrashing
      mm: vmscan: determine anon/file pressure balance at the reclaim root
      mm: vmscan: reclaim writepage is IO cost
      mm: vmscan: limit the range of LRU type balancing

    Shakeel Butt <shakeelb@google.com>:
      mm: swap: fix vmstats for huge pages
      mm: swap: memcg: fix memcg stats for huge pages

Subsystem: mm/tools

    Changhee Han <ch0.han@lge.com>:
      tools/vm/page_owner_sort.c: filter out unneeded line

Subsystem: mm/mempolicy

    Michal Hocko <mhocko@suse.com>:
      mm, mempolicy: fix up gup usage in lookup_node

Subsystem: mm/memblock

    chenqiwu <chenqiwu@xiaomi.com>:
      include/linux/memblock.h: fix minor typo and unclear comment

    Mike Rapoport <rppt@linux.ibm.com>:
      sparc32: register memory occupied by kernel as memblock.memory

Subsystem: mm/hugetlbfs

    Shijie Hu <hushijie3@huawei.com>:
      hugetlbfs: get unmapped area below TASK_UNMAPPED_BASE for hugetlbfs

Subsystem: mm/thp

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: thp: don't need to drain lru cache when splitting and mlocking THP

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/thp: Rename pmd_mknotpresent() as pmd_mknotvalid()", v2:
      powerpc/mm: drop platform defined pmd_mknotpresent()
      mm/thp: rename pmd_mknotpresent() as pmd_mkinvalid()

Subsystem: mm/mmap

    Scott Cheloha <cheloha@linux.vnet.ibm.com>:
      drivers/base/memory.c: cache memory blocks in xarray to accelerate lookup

Subsystem: mm/kconfig

    Zong Li <zong.li@sifive.com>:
    Patch series "Extract DEBUG_WX to shared use":
      mm: add DEBUG_WX support
      riscv: support DEBUG_WX
      x86: mm: use ARCH_HAS_DEBUG_WX instead of arch defined
      arm64: mm: use ARCH_HAS_DEBUG_WX instead of arch defined

 Documentation/admin-guide/cgroup-v1/memory.rst           |   19 
 Documentation/admin-guide/kernel-parameters.txt          |   40 
 Documentation/admin-guide/mm/hugetlbpage.rst             |   35 
 Documentation/admin-guide/mm/transhuge.rst               |    7 
 Documentation/admin-guide/sysctl/vm.rst                  |   23 
 Documentation/core-api/padata.rst                        |   41 
 Documentation/features/vm/numa-memblock/arch-support.txt |   34 
 Documentation/vm/memory-model.rst                        |    9 
 Documentation/vm/page_owner.rst                          |    3 
 arch/alpha/mm/init.c                                     |   16 
 arch/alpha/mm/numa.c                                     |   22 
 arch/arc/include/asm/hugepage.h                          |    2 
 arch/arc/mm/init.c                                       |   41 
 arch/arm/include/asm/hugetlb.h                           |    7 
 arch/arm/include/asm/pgtable-3level.h                    |    2 
 arch/arm/mm/init.c                                       |   66 
 arch/arm64/Kconfig                                       |    2 
 arch/arm64/Kconfig.debug                                 |   29 
 arch/arm64/include/asm/hugetlb.h                         |   13 
 arch/arm64/include/asm/pgtable.h                         |    2 
 arch/arm64/mm/hugetlbpage.c                              |   48 
 arch/arm64/mm/init.c                                     |   56 
 arch/arm64/mm/numa.c                                     |    9 
 arch/c6x/mm/init.c                                       |    8 
 arch/csky/kernel/setup.c                                 |   26 
 arch/h8300/mm/init.c                                     |    6 
 arch/hexagon/mm/init.c                                   |    6 
 arch/ia64/Kconfig                                        |    1 
 arch/ia64/include/asm/hugetlb.h                          |    5 
 arch/ia64/mm/contig.c                                    |    2 
 arch/ia64/mm/discontig.c                                 |    2 
 arch/m68k/mm/init.c                                      |    6 
 arch/m68k/mm/mcfmmu.c                                    |    9 
 arch/m68k/mm/motorola.c                                  |   15 
 arch/m68k/mm/sun3mmu.c                                   |   10 
 arch/microblaze/Kconfig                                  |    1 
 arch/microblaze/mm/init.c                                |    2 
 arch/mips/Kconfig                                        |    1 
 arch/mips/include/asm/hugetlb.h                          |   11 
 arch/mips/include/asm/pgtable.h                          |    2 
 arch/mips/loongson64/numa.c                              |    2 
 arch/mips/mm/init.c                                      |    2 
 arch/mips/sgi-ip27/ip27-memory.c                         |    2 
 arch/nds32/mm/init.c                                     |   11 
 arch/nios2/mm/init.c                                     |    8 
 arch/openrisc/mm/init.c                                  |    9 
 arch/parisc/include/asm/hugetlb.h                        |   10 
 arch/parisc/mm/init.c                                    |   22 
 arch/powerpc/Kconfig                                     |   10 
 arch/powerpc/include/asm/book3s/64/pgtable.h             |    4 
 arch/powerpc/include/asm/hugetlb.h                       |    5 
 arch/powerpc/mm/hugetlbpage.c                            |   38 
 arch/powerpc/mm/mem.c                                    |    2 
 arch/riscv/Kconfig                                       |    2 
 arch/riscv/include/asm/hugetlb.h                         |   10 
 arch/riscv/include/asm/ptdump.h                          |   11 
 arch/riscv/mm/hugetlbpage.c                              |   44 
 arch/riscv/mm/init.c                                     |    5 
 arch/s390/Kconfig                                        |    1 
 arch/s390/include/asm/hugetlb.h                          |    8 
 arch/s390/mm/hugetlbpage.c                               |   34 
 arch/s390/mm/init.c                                      |    2 
 arch/sh/Kconfig                                          |    1 
 arch/sh/include/asm/hugetlb.h                            |    7 
 arch/sh/mm/init.c                                        |    2 
 arch/sparc/Kconfig                                       |   10 
 arch/sparc/include/asm/hugetlb.h                         |   10 
 arch/sparc/mm/init_32.c                                  |    1 
 arch/sparc/mm/init_64.c                                  |   67 
 arch/sparc/mm/srmmu.c                                    |   21 
 arch/um/kernel/mem.c                                     |   12 
 arch/unicore32/include/asm/memory.h                      |    2 
 arch/unicore32/include/mach/memory.h                     |    6 
 arch/unicore32/kernel/pci.c                              |   14 
 arch/unicore32/mm/init.c                                 |   43 
 arch/x86/Kconfig                                         |   11 
 arch/x86/Kconfig.debug                                   |   27 
 arch/x86/include/asm/hugetlb.h                           |   10 
 arch/x86/include/asm/pgtable.h                           |    2 
 arch/x86/mm/hugetlbpage.c                                |   35 
 arch/x86/mm/init.c                                       |    2 
 arch/x86/mm/init_64.c                                    |   12 
 arch/x86/mm/kmmio.c                                      |    2 
 arch/x86/mm/numa.c                                       |   11 
 arch/xtensa/mm/init.c                                    |    8 
 drivers/base/memory.c                                    |   44 
 drivers/gpu/drm/i915/gem/i915_gem_userptr.c              |   22 
 fs/cifs/file.c                                           |   10 
 fs/fuse/dev.c                                            |    2 
 fs/hugetlbfs/inode.c                                     |   67 
 include/asm-generic/hugetlb.h                            |    2 
 include/linux/compaction.h                               |    9 
 include/linux/gfp.h                                      |    7 
 include/linux/hugetlb.h                                  |   16 
 include/linux/memblock.h                                 |   15 
 include/linux/memcontrol.h                               |  102 -
 include/linux/mm.h                                       |   52 
 include/linux/mmzone.h                                   |   46 
 include/linux/padata.h                                   |   43 
 include/linux/string.h                                   |   60 
 include/linux/swap.h                                     |   17 
 include/linux/vm_event_item.h                            |    4 
 include/linux/vmstat.h                                   |    2 
 include/trace/events/compaction.h                        |   22 
 include/trace/events/huge_memory.h                       |    3 
 include/trace/events/vmscan.h                            |   14 
 init/Kconfig                                             |   17 
 init/main.c                                              |    2 
 kernel/events/uprobes.c                                  |   22 
 kernel/padata.c                                          |  293 +++-
 kernel/sysctl.c                                          |    3 
 lib/test_kasan.c                                         |   29 
 mm/Kconfig                                               |    9 
 mm/Kconfig.debug                                         |   32 
 mm/compaction.c                                          |   70 -
 mm/filemap.c                                             |   55 
 mm/gup.c                                                 |  237 ++-
 mm/huge_memory.c                                         |  282 ----
 mm/hugetlb.c                                             |  260 ++-
 mm/internal.h                                            |   25 
 mm/khugepaged.c                                          |  316 ++--
 mm/memblock.c                                            |   19 
 mm/memcontrol.c                                          |  642 +++------
 mm/memory.c                                              |  103 -
 mm/memory_hotplug.c                                      |   10 
 mm/mempolicy.c                                           |    5 
 mm/migrate.c                                             |   30 
 mm/oom_kill.c                                            |    4 
 mm/page_alloc.c                                          |  735 ++++------
 mm/page_owner.c                                          |    7 
 mm/pgtable-generic.c                                     |    2 
 mm/rmap.c                                                |   53 
 mm/shmem.c                                               |  156 --
 mm/slab.c                                                |    4 
 mm/slub.c                                                |    8 
 mm/swap.c                                                |  199 +-
 mm/swap_cgroup.c                                         |   10 
 mm/swap_state.c                                          |  110 -
 mm/swapfile.c                                            |   39 
 mm/userfaultfd.c                                         |   15 
 mm/vmscan.c                                              |  344 ++--
 mm/vmstat.c                                              |   16 
 mm/workingset.c                                          |   23 
 tools/testing/selftests/vm/.gitignore                    |    1 
 tools/testing/selftests/vm/Makefile                      |    1 
 tools/testing/selftests/vm/khugepaged.c                  | 1035 +++++++++++++++
 tools/vm/page_owner_sort.c                               |    5 
 147 files changed, 3876 insertions(+), 3108 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-02 21:38     ` incoming Andrew Morton
@ 2020-06-02 22:18       ` Linus Torvalds
  0 siblings, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2020-06-02 22:18 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Tue, Jun 2, 2020 at 2:38 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I have no issues with conflicts, and already took your previous series.
>
> Well that's odd.

I meant "I saw the conflicts and had no issue with them". Nothing odd.

And I actually much prefer seeing conflicts from your series (against
other pulls I've done) over having you delay your patch bombs because
of any fear for them.

              Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-02 20:45   ` incoming Linus Torvalds
@ 2020-06-02 21:38     ` Andrew Morton
  2020-06-02 22:18       ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2020-06-02 21:38 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, Linux-MM

On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The local_lock merge made rather a mess of all of this.  I'm
> > cooking up a full resend of the same material.
> 
> Hmm. I have no issues with conflicts, and already took your previous series.

Well that's odd.

> I've pushed it out now - does my tree match what you expect?

Yup, thanks.


^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-02 20:08 ` incoming Andrew Morton
@ 2020-06-02 20:45   ` Linus Torvalds
  2020-06-02 21:38     ` incoming Andrew Morton
  0 siblings, 1 reply; 188+ messages in thread
From: Linus Torvalds @ 2020-06-02 20:45 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> The local_lock merge made rather a mess of all of this.  I'm
> cooking up a full resend of the same material.

Hmm. I have no issues with conflicts, and already took your previous series.

I've pushed it out now - does my tree match what you expect?

            Linus


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-02 20:09 Andrew Morton
  0 siblings, 0 replies; 188+ messages in thread
From: Andrew Morton @ 2020-06-02 20:09 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


A few little subsystems and a start of a lot of MM patches.

128 patches, based on f359287765c04711ff54fbd11645271d8e5ff763:


Subsystems affected by this patch series:

  squashfs
  ocfs2
  parisc
  vfs
  mm/slab-generic
  mm/slub
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/memory-failure
  mm/vmalloc
  mm/kasan

Subsystem: squashfs

    Philippe Liard <pliard@google.com>:
      squashfs: migrate from ll_rw_block usage to BIO

Subsystem: ocfs2

    Jules Irenge <jbi.octave@gmail.com>:
      ocfs2: add missing annotation for dlm_empty_lockres()

    Gang He <ghe@suse.com>:
      ocfs2: mount shared volume without ha stack

Subsystem: parisc

    Andrew Morton <akpm@linux-foundation.org>:
      arch/parisc/include/asm/pgtable.h: remove unused `old_pte'

Subsystem: vfs

    Jeff Layton <jlayton@redhat.com>:
    Patch series "vfs: have syncfs() return error when there are writeback:
      vfs: track per-sb writeback errors and report them to syncfs
      fs/buffer.c: record blockdev write errors in super_block that it backs

Subsystem: mm/slab-generic

    Vlastimil Babka <vbabka@suse.cz>:
      usercopy: mark dma-kmalloc caches as usercopy caches

Subsystem: mm/slub

    Dongli Zhang <dongli.zhang@oracle.com>:
      mm/slub.c: fix corrupted freechain in deactivate_slab()

    Christoph Lameter <cl@linux.com>:
      slub: Remove userspace notifier for cache add/remove

    Christopher Lameter <cl@linux.com>:
      slub: remove kmalloc under list_lock from list_slab_objects() V2

    Qian Cai <cai@lca.pw>:
      mm/slub: fix stack overruns with SLUB_STATS

    Andrew Morton <akpm@linux-foundation.org>:
      Documentation/vm/slub.rst: s/Toggle/Enable/

Subsystem: mm/debug

    Vlastimil Babka <vbabka@suse.cz>:
      mm, dump_page(): do not crash with invalid mapping pointer

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Change readahead API", v11:
      mm: move readahead prototypes from mm.h
      mm: return void from various readahead functions
      mm: ignore return value of ->readpages
      mm: move readahead nr_pages check into read_pages
      mm: add new readahead_control API
      mm: use readahead_control to pass arguments
      mm: rename various 'offset' parameters to 'index'
      mm: rename readahead loop variable to 'i'
      mm: remove 'page_offset' from readahead loop
      mm: put readahead pages in cache earlier
      mm: add readahead address space operation
      mm: move end_index check out of readahead loop
      mm: add page_cache_readahead_unbounded
      mm: document why we don't set PageReadahead
      mm: use memalloc_nofs_save in readahead path
      fs: convert mpage_readpages to mpage_readahead
      btrfs: convert from readpages to readahead
      erofs: convert uncompressed files from readpages to readahead
      erofs: convert compressed files from readpages to readahead
      ext4: convert from readpages to readahead
      ext4: pass the inode to ext4_mpage_readpages
      f2fs: convert from readpages to readahead
      f2fs: pass the inode to f2fs_mpage_readpages
      fuse: convert from readpages to readahead
      iomap: convert from readpages to readahead

    Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
    Patch series "Introduce attach/detach_page_private to cleanup code":
      include/linux/pagemap.h: introduce attach/detach_page_private
      md: remove __clear_page_buffers and use attach/detach_page_private
      btrfs: use attach/detach_page_private
      fs/buffer.c: use attach/detach_page_private
      f2fs: use attach/detach_page_private
      iomap: use attach/detach_page_private
      ntfs: replace attach_page_buffers with attach_page_private
      orangefs: use attach/detach_page_private
      buffer_head.h: remove attach_page_buffers
      mm/migrate.c: call detach_page_private to cleanup code
      mm_types.h: change set_page_private to inline function

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap.c: remove misleading comment

    Chao Yu <yuchao0@huawei.com>:
      mm/page-writeback.c: remove unused variable

    NeilBrown <neilb@suse.de>:
      mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
      mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead

Subsystem: mm/gup

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm/gup.c: update the documentation

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: introduce pin_user_pages_unlocked
      ivtv: convert get_user_pages() --> pin_user_pages()

    Miles Chen <miles.chen@mediatek.com>:
      mm/gup.c: further document vma_permits_fault()

Subsystem: mm/swap

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/swapfile: use list_{prev,next}_entry() instead of open-coding

    Qian Cai <cai@lca.pw>:
      mm/swap_state: fix a data race in swapin_nr_pages

    Andrea Righi <andrea.righi@canonical.com>:
      mm: swap: properly update readahead statistics in unuse_pte_range()

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swapfile.c: offset is only used when there is more slots
      mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
      mm/swapfile.c: remove the unnecessary goto for SSD case
      mm/swapfile.c: simplify the calculation of n_goal
      mm/swapfile.c: remove the extra check in scan_swap_map_slots()
      mm/swapfile.c: found_free could be represented by (tmp < max)
      mm/swapfile.c: tmp is always smaller than max
      mm/swapfile.c: omit a duplicate code by compare tmp and max first

    Huang Ying <ying.huang@intel.com>:
      swap: try to scan more free slots even when fragmented

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
      mm/swapfile.c: __swap_entry_free() always free 1 entry

    Huang Ying <ying.huang@intel.com>:
      mm/swapfile.c: use prandom_u32_max()
      swap: reduce lock contention on swap cache from swap slots allocation

    Randy Dunlap <rdunlap@infradead.org>:
      mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment

    Miaohe Lin <linmiaohe@huawei.com>:
      include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration

Subsystem: mm/memcg

    Yafang Shao <laoar.shao@gmail.com>:
      mm, memcg: add workingset_restore in memory.stat

    Kaixu Xia <kaixuxia@tencent.com>:
      mm: memcontrol: simplify value comparison between count and limit

    Shakeel Butt <shakeelb@google.com>:
      memcg: expose root cgroup's memory.stat

    Jakub Kicinski <kuba@kernel.org>:
    Patch series "memcg: Slow down swap allocation as the available space gets:
      mm/memcg: prepare for swap over-high accounting and penalty calculation
      mm/memcg: move penalty delay clamping out of calculate_high_delay()
      mm/memcg: move cgroup high memory limit setting into struct page_counter
      mm/memcg: automatically penalize tasks with high swap use

    Zefan Li <lizefan@huawei.com>:
      memcg: fix memcg_kmem_bypass() for remote memcg charging

Subsystem: mm/pagemap

    Steven Price <steven.price@arm.com>:
    Patch series "Fix W+X debug feature on x86":
      x86: mm: ptdump: calculate effective permissions correctly
      mm: ptdump: expand type of 'val' in note_page()

    Huang Ying <ying.huang@intel.com>:
      /proc/PID/smaps: Add PMD migration entry parsing

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/memory: remove unnecessary pte_devmap case in copy_one_pte()

Subsystem: mm/memory-failure

    Wetp Zhang <wetp.zy@linux.alibaba.com>:
      mm, memory_failure: don't send BUS_MCEERR_AO for action required error

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
    Patch series "decruft the vmalloc API", v2:
      x86/hyperv: use vmalloc_exec for the hypercall page
      x86: fix vmap arguments in map_irq_stack
      staging: android: ion: use vmap instead of vm_map_ram
      staging: media: ipu3: use vmap instead of reimplementing it
      dma-mapping: use vmap insted of reimplementing it
      powerpc: add an ioremap_phb helper
      powerpc: remove __ioremap_at and __iounmap_at
      mm: remove __get_vm_area
      mm: unexport unmap_kernel_range_noflush
      mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
      mm: only allow page table mappings for built-in zsmalloc
      mm: pass addr as unsigned long to vb_free
      mm: remove vmap_page_range_noflush and vunmap_page_range
      mm: rename vmap_page_range to map_kernel_range
      mm: don't return the number of pages from map_kernel_range{,_noflush}
      mm: remove map_vm_range
      mm: remove unmap_vmap_area
      mm: remove the prot argument from vm_map_ram
      mm: enforce that vmap can't map pages executable
      gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
      mm: remove the pgprot argument to __vmalloc
      mm: remove the prot argument to __vmalloc_node
      mm: remove both instances of __vmalloc_node_flags
      mm: remove __vmalloc_node_flags_caller
      mm: switch the test_vmalloc module to use __vmalloc_node
      mm: remove vmalloc_user_node_flags
      arm64: use __vmalloc_node in arch_alloc_vmap_stack
      powerpc: use __vmalloc_node in alloc_vm_stack
      s390: use __vmalloc_node in stack_alloc

    Joerg Roedel <jroedel@suse.de>:
    Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
      mm: add functions to track page directory modifications
      mm/vmalloc: track which page-table levels were modified
      mm/ioremap: track which page-table levels were modified
      x86/mm/64: implement arch_sync_kernel_mappings()
      x86/mm/32: implement arch_sync_kernel_mappings()
      mm: remove vmalloc_sync_(un)mappings()
      x86/mm: remove vmalloc faulting

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix clang compilation warning due to stack protector

    Kees Cook <keescook@chromium.org>:
      ubsan: entirely disable alignment checks under UBSAN_TRAP

    Jing Xia <jing.xia@unisoc.com>:
      mm/mm_init.c: report kasan-tag information stored in page->flags

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: move kasan_report() into report.c

 Documentation/admin-guide/cgroup-v2.rst            |   24 +
 Documentation/core-api/cachetlb.rst                |    2 
 Documentation/filesystems/locking.rst              |    6 
 Documentation/filesystems/proc.rst                 |    4 
 Documentation/filesystems/vfs.rst                  |   15 
 Documentation/vm/slub.rst                          |    2 
 arch/arm/configs/omap2plus_defconfig               |    2 
 arch/arm64/include/asm/pgtable.h                   |    3 
 arch/arm64/include/asm/vmap_stack.h                |    6 
 arch/arm64/mm/dump.c                               |    2 
 arch/parisc/include/asm/pgtable.h                  |    2 
 arch/powerpc/include/asm/io.h                      |   10 
 arch/powerpc/include/asm/pci-bridge.h              |    2 
 arch/powerpc/kernel/irq.c                          |    5 
 arch/powerpc/kernel/isa-bridge.c                   |   28 +
 arch/powerpc/kernel/pci_64.c                       |   56 +-
 arch/powerpc/mm/ioremap_64.c                       |   50 --
 arch/riscv/include/asm/pgtable.h                   |    4 
 arch/riscv/mm/ptdump.c                             |    2 
 arch/s390/kernel/setup.c                           |    9 
 arch/sh/kernel/cpu/sh4/sq.c                        |    3 
 arch/x86/hyperv/hv_init.c                          |    5 
 arch/x86/include/asm/kvm_host.h                    |    3 
 arch/x86/include/asm/pgtable-2level_types.h        |    2 
 arch/x86/include/asm/pgtable-3level_types.h        |    2 
 arch/x86/include/asm/pgtable_64_types.h            |    2 
 arch/x86/include/asm/pgtable_types.h               |    8 
 arch/x86/include/asm/switch_to.h                   |   23 -
 arch/x86/kernel/irq_64.c                           |    2 
 arch/x86/kernel/setup_percpu.c                     |    6 
 arch/x86/kvm/svm/sev.c                             |    3 
 arch/x86/mm/dump_pagetables.c                      |   35 +
 arch/x86/mm/fault.c                                |  196 ----------
 arch/x86/mm/init_64.c                              |    5 
 arch/x86/mm/pti.c                                  |    8 
 arch/x86/mm/tlb.c                                  |   37 -
 block/blk-core.c                                   |    1 
 drivers/acpi/apei/ghes.c                           |    6 
 drivers/base/node.c                                |    2 
 drivers/block/drbd/drbd_bitmap.c                   |    4 
 drivers/block/loop.c                               |    2 
 drivers/dax/device.c                               |    1 
 drivers/gpu/drm/drm_scatter.c                      |   11 
 drivers/gpu/drm/etnaviv/etnaviv_dump.c             |    4 
 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c   |    2 
 drivers/lightnvm/pblk-init.c                       |    5 
 drivers/md/dm-bufio.c                              |    4 
 drivers/md/md-bitmap.c                             |   12 
 drivers/media/common/videobuf2/videobuf2-dma-sg.c  |    3 
 drivers/media/common/videobuf2/videobuf2-vmalloc.c |    3 
 drivers/media/pci/ivtv/ivtv-udma.c                 |   19 -
 drivers/media/pci/ivtv/ivtv-yuv.c                  |   17 
 drivers/media/pci/ivtv/ivtvfb.c                    |    4 
 drivers/mtd/ubi/io.c                               |    4 
 drivers/pcmcia/electra_cf.c                        |   45 --
 drivers/scsi/sd_zbc.c                              |    3 
 drivers/staging/android/ion/ion_heap.c             |    4 
 drivers/staging/media/ipu3/ipu3-css-pool.h         |    4 
 drivers/staging/media/ipu3/ipu3-dmamap.c           |   30 -
 fs/block_dev.c                                     |    7 
 fs/btrfs/disk-io.c                                 |    4 
 fs/btrfs/extent_io.c                               |   64 ---
 fs/btrfs/extent_io.h                               |    3 
 fs/btrfs/inode.c                                   |   39 --
 fs/buffer.c                                        |   23 -
 fs/erofs/data.c                                    |   41 --
 fs/erofs/decompressor.c                            |    2 
 fs/erofs/zdata.c                                   |   31 -
 fs/exfat/inode.c                                   |    7 
 fs/ext2/inode.c                                    |   10 
 fs/ext4/ext4.h                                     |    5 
 fs/ext4/inode.c                                    |   25 -
 fs/ext4/readpage.c                                 |   25 -
 fs/ext4/verity.c                                   |   35 -
 fs/f2fs/data.c                                     |   56 +-
 fs/f2fs/f2fs.h                                     |   14 
 fs/f2fs/verity.c                                   |   35 -
 fs/fat/inode.c                                     |    7 
 fs/file_table.c                                    |    1 
 fs/fs-writeback.c                                  |    1 
 fs/fuse/file.c                                     |  100 +----
 fs/gfs2/aops.c                                     |   23 -
 fs/gfs2/dir.c                                      |    9 
 fs/gfs2/quota.c                                    |    2 
 fs/hpfs/file.c                                     |    7 
 fs/iomap/buffered-io.c                             |  113 +----
 fs/iomap/trace.h                                   |    2 
 fs/isofs/inode.c                                   |    7 
 fs/jfs/inode.c                                     |    7 
 fs/mpage.c                                         |   38 --
 fs/nfs/blocklayout/extent_tree.c                   |    2 
 fs/nfs/internal.h                                  |   10 
 fs/nfs/write.c                                     |    4 
 fs/nfsd/vfs.c                                      |    9 
 fs/nilfs2/inode.c                                  |   15 
 fs/ntfs/aops.c                                     |    2 
 fs/ntfs/malloc.h                                   |    2 
 fs/ntfs/mft.c                                      |    2 
 fs/ocfs2/aops.c                                    |   34 -
 fs/ocfs2/dlm/dlmmaster.c                           |    1 
 fs/ocfs2/ocfs2.h                                   |    4 
 fs/ocfs2/slot_map.c                                |   46 +-
 fs/ocfs2/super.c                                   |   21 +
 fs/omfs/file.c                                     |    7 
 fs/open.c                                          |    3 
 fs/orangefs/inode.c                                |   32 -
 fs/proc/meminfo.c                                  |    3 
 fs/proc/task_mmu.c                                 |   16 
 fs/qnx6/inode.c                                    |    7 
 fs/reiserfs/inode.c                                |    8 
 fs/squashfs/block.c                                |  273 +++++++-------
 fs/squashfs/decompressor.h                         |    5 
 fs/squashfs/decompressor_multi.c                   |    9 
 fs/squashfs/decompressor_multi_percpu.c            |   17 
 fs/squashfs/decompressor_single.c                  |    9 
 fs/squashfs/lz4_wrapper.c                          |   17 
 fs/squashfs/lzo_wrapper.c                          |   17 
 fs/squashfs/squashfs.h                             |    4 
 fs/squashfs/xz_wrapper.c                           |   51 +-
 fs/squashfs/zlib_wrapper.c                         |   63 +--
 fs/squashfs/zstd_wrapper.c                         |   62 +--
 fs/sync.c                                          |    6 
 fs/ubifs/debug.c                                   |    2 
 fs/ubifs/lprops.c                                  |    2 
 fs/ubifs/lpt_commit.c                              |    4 
 fs/ubifs/orphan.c                                  |    2 
 fs/udf/inode.c                                     |    7 
 fs/xfs/kmem.c                                      |    2 
 fs/xfs/xfs_aops.c                                  |   13 
 fs/xfs/xfs_buf.c                                   |    2 
 fs/zonefs/super.c                                  |    7 
 include/asm-generic/5level-fixup.h                 |    5 
 include/asm-generic/pgtable.h                      |   27 +
 include/linux/buffer_head.h                        |    8 
 include/linux/fs.h                                 |   18 
 include/linux/iomap.h                              |    3 
 include/linux/memcontrol.h                         |    4 
 include/linux/mm.h                                 |   67 ++-
 include/linux/mm_types.h                           |    6 
 include/linux/mmzone.h                             |    1 
 include/linux/mpage.h                              |    4 
 include/linux/page_counter.h                       |    8 
 include/linux/pagemap.h                            |  193 ++++++++++
 include/linux/ptdump.h                             |    3 
 include/linux/sched.h                              |    3 
 include/linux/swap.h                               |   17 
 include/linux/vmalloc.h                            |   49 +-
 include/linux/zsmalloc.h                           |    2 
 include/trace/events/erofs.h                       |    6 
 include/trace/events/f2fs.h                        |    6 
 include/trace/events/writeback.h                   |    5 
 kernel/bpf/core.c                                  |    6 
 kernel/bpf/syscall.c                               |   29 -
 kernel/dma/remap.c                                 |   48 --
 kernel/groups.c                                    |    2 
 kernel/module.c                                    |    3 
 kernel/notifier.c                                  |    1 
 kernel/sys.c                                       |    2 
 kernel/trace/trace.c                               |   12 
 lib/Kconfig.ubsan                                  |    2 
 lib/ioremap.c                                      |   46 +-
 lib/test_vmalloc.c                                 |   26 -
 mm/Kconfig                                         |    4 
 mm/debug.c                                         |   56 ++
 mm/fadvise.c                                       |    6 
 mm/filemap.c                                       |    1 
 mm/gup.c                                           |   77 +++-
 mm/internal.h                                      |   14 
 mm/kasan/Makefile                                  |   21 -
 mm/kasan/common.c                                  |   19 -
 mm/kasan/report.c                                  |   22 +
 mm/memcontrol.c                                    |  198 +++++++---
 mm/memory-failure.c                                |   15 
 mm/memory.c                                        |    2 
 mm/migrate.c                                       |    9 
 mm/mm_init.c                                       |   16 
 mm/nommu.c                                         |   52 +-
 mm/page-writeback.c                                |   62 ++-
 mm/page_alloc.c                                    |    7 
 mm/percpu.c                                        |    2 
 mm/ptdump.c                                        |   17 
 mm/readahead.c                                     |  349 ++++++++++--------
 mm/slab_common.c                                   |    3 
 mm/slub.c                                          |   67 ++-
 mm/swap_state.c                                    |    5 
 mm/swapfile.c                                      |  194 ++++++----
 mm/util.c                                          |    2 
 mm/vmalloc.c                                       |  399 ++++++++-------------
 mm/vmscan.c                                        |    4 
 mm/vmstat.c                                        |   11 
 mm/zsmalloc.c                                      |   12 
 net/bridge/netfilter/ebtables.c                    |    6 
 net/ceph/ceph_common.c                             |    3 
 sound/core/memalloc.c                              |    2 
 sound/core/pcm_memory.c                            |    2 
 195 files changed, 2292 insertions(+), 2288 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-06-02  4:44 incoming Andrew Morton
@ 2020-06-02 20:08 ` Andrew Morton
  2020-06-02 20:45   ` incoming Linus Torvalds
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2020-06-02 20:08 UTC (permalink / raw)
  To: Linus Torvalds, mm-commits, linux-mm

The local_lock merge made rather a mess of all of this.  I'm 
cooking up a full resend of the same material.


^ permalink raw reply	[flat|nested] 188+ messages in thread

* incoming
@ 2020-06-02  4:44 Andrew Morton
  2020-06-02 20:08 ` incoming Andrew Morton
  0 siblings, 1 reply; 188+ messages in thread
From: Andrew Morton @ 2020-06-02  4:44 UTC (permalink / raw)
  To: Linus Torvalds; +Cc: mm-commits, linux-mm


A few little subsystems and a start of a lot of MM patches.

128 patches, based on 9bf9511e3d9f328c03f6f79bfb741c3d18f2f2c0:

Subsystems affected by this patch series:

  squashfs
  ocfs2
  parisc
  vfs
  mm/slab-generic
  mm/slub
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/memory-failure
  mm/vmalloc
  mm/kasan

Subsystem: squashfs

    Philippe Liard <pliard@google.com>:
      squashfs: migrate from ll_rw_block usage to BIO

Subsystem: ocfs2

    Jules Irenge <jbi.octave@gmail.com>:
      ocfs2: add missing annotation for dlm_empty_lockres()

    Gang He <ghe@suse.com>:
      ocfs2: mount shared volume without ha stack

Subsystem: parisc

    Andrew Morton <akpm@linux-foundation.org>:
      arch/parisc/include/asm/pgtable.h: remove unused `old_pte'

Subsystem: vfs

    Jeff Layton <jlayton@redhat.com>:
    Patch series "vfs: have syncfs() return error when there are writeback:
      vfs: track per-sb writeback errors and report them to syncfs
      fs/buffer.c: record blockdev write errors in super_block that it backs

Subsystem: mm/slab-generic

    Vlastimil Babka <vbabka@suse.cz>:
      usercopy: mark dma-kmalloc caches as usercopy caches

Subsystem: mm/slub

    Dongli Zhang <dongli.zhang@oracle.com>:
      mm/slub.c: fix corrupted freechain in deactivate_slab()

    Christoph Lameter <cl@linux.com>:
      slub: Remove userspace notifier for cache add/remove

    Christopher Lameter <cl@linux.com>:
      slub: remove kmalloc under list_lock from list_slab_objects() V2

    Qian Cai <cai@lca.pw>:
      mm/slub: fix stack overruns with SLUB_STATS

    Andrew Morton <akpm@linux-foundation.org>:
      Documentation/vm/slub.rst: s/Toggle/Enable/

Subsystem: mm/debug

    Vlastimil Babka <vbabka@suse.cz>:
      mm, dump_page(): do not crash with invalid mapping pointer

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Change readahead API", v11:
      mm: move readahead prototypes from mm.h
      mm: return void from various readahead functions
      mm: ignore return value of ->readpages
      mm: move readahead nr_pages check into read_pages
      mm: add new readahead_control API
      mm: use readahead_control to pass arguments
      mm: rename various 'offset' parameters to 'index'
      mm: rename readahead loop variable to 'i'
      mm: remove 'page_offset' from readahead loop
      mm: put readahead pages in cache earlier
      mm: add readahead address space operation
      mm: move end_index check out of readahead loop
      mm: add page_cache_readahead_unbounded
      mm: document why we don't set PageReadahead
      mm: use memalloc_nofs_save in readahead path
      fs: convert mpage_readpages to mpage_readahead
      btrfs: convert from readpages to readahead
      erofs: convert uncompressed files from readpages to readahead
      erofs: convert compressed files from readpages to readahead
      ext4: convert from readpages to readahead
      ext4: pass the inode to ext4_mpage_readpages
      f2fs: convert from readpages to readahead
      f2fs: pass the inode to f2fs_mpage_readpages
      fuse: convert from readpages to readahead
      iomap: convert from readpages to readahead

    Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
    Patch series "Introduce attach/detach_page_private to cleanup code":
      include/linux/pagemap.h: introduce attach/detach_page_private
      md: remove __clear_page_buffers and use attach/detach_page_private
      btrfs: use attach/detach_page_private
      fs/buffer.c: use attach/detach_page_private
      f2fs: use attach/detach_page_private
      iomap: use attach/detach_page_private
      ntfs: replace attach_page_buffers with attach_page_private
      orangefs: use attach/detach_page_private
      buffer_head.h: remove attach_page_buffers
      mm/migrate.c: call detach_page_private to cleanup code
      mm_types.h: change set_page_private to inline function

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap.c: remove misleading comment

    Chao Yu <yuchao0@huawei.com>:
      mm/page-writeback.c: remove unused variable

    NeilBrown <neilb@suse.de>:
      mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
      mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead

Subsystem: mm/gup

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm/gup.c: update the documentation

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: introduce pin_user_pages_unlocked
      ivtv: convert get_user_pages() --> pin_user_pages()

    Miles Chen <miles.chen@mediatek.com>:
      mm/gup.c: further document vma_permits_fault()

Subsystem: mm/swap

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/swapfile: use list_{prev,next}_entry() instead of open-coding

    Qian Cai <cai@lca.pw>:
      mm/swap_state: fix a data race in swapin_nr_pages

    Andrea Righi <andrea.righi@canonical.com>:
      mm: swap: properly update readahead statistics in unuse_pte_range()

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swapfile.c: offset is only used when there is more slots
      mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
      mm/swapfile.c: remove the unnecessary goto for SSD case
      mm/swapfile.c: simplify the calculation of n_goal
      mm/swapfile.c: remove the extra check in scan_swap_map_slots()
      mm/swapfile.c: found_free could be represented by (tmp < max)
      mm/swapfile.c: tmp is always smaller than max
      mm/swapfile.c: omit a duplicate code by compare tmp and max first

    Huang Ying <ying.huang@intel.com>:
      swap: try to scan more free slots even when fragmented

    Wei Yang <richard.weiyang@gmail.com>:
      mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
      mm/swapfile.c: __swap_entry_free() always free 1 entry

    Huang Ying <ying.huang@intel.com>:
      mm/swapfile.c: use prandom_u32_max()
      swap: reduce lock contention on swap cache from swap slots allocation

    Randy Dunlap <rdunlap@infradead.org>:
      mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment

    Miaohe Lin <linmiaohe@huawei.com>:
      include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration

Subsystem: mm/memcg

    Yafang Shao <laoar.shao@gmail.com>:
      mm, memcg: add workingset_restore in memory.stat

    Kaixu Xia <kaixuxia@tencent.com>:
      mm: memcontrol: simplify value comparison between count and limit

    Shakeel Butt <shakeelb@google.com>:
      memcg: expose root cgroup's memory.stat

    Jakub Kicinski <kuba@kernel.org>:
    Patch series "memcg: Slow down swap allocation as the available space gets:
      mm/memcg: prepare for swap over-high accounting and penalty calculation
      mm/memcg: move penalty delay clamping out of calculate_high_delay()
      mm/memcg: move cgroup high memory limit setting into struct page_counter
      mm/memcg: automatically penalize tasks with high swap use

    Zefan Li <lizefan@huawei.com>:
      memcg: fix memcg_kmem_bypass() for remote memcg charging

Subsystem: mm/pagemap

    Steven Price <steven.price@arm.com>:
    Patch series "Fix W+X debug feature on x86":
      x86: mm: ptdump: calculate effective permissions correctly
      mm: ptdump: expand type of 'val' in note_page()

    Huang Ying <ying.huang@intel.com>:
      /proc/PID/smaps: Add PMD migration entry parsing

    chenqiwu <chenqiwu@xiaomi.com>:
      mm/memory: remove unnecessary pte_devmap case in copy_one_pte()

Subsystem: mm/memory-failure

    Wetp Zhang <wetp.zy@linux.alibaba.com>:
      mm, memory_failure: don't send BUS_MCEERR_AO for action required error

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
    Patch series "decruft the vmalloc API", v2:
      x86/hyperv: use vmalloc_exec for the hypercall page
      x86: fix vmap arguments in map_irq_stack
      staging: android: ion: use vmap instead of vm_map_ram
      staging: media: ipu3: use vmap instead of reimplementing it
      dma-mapping: use vmap insted of reimplementing it
      powerpc: add an ioremap_phb helper
      powerpc: remove __ioremap_at and __iounmap_at
      mm: remove __get_vm_area
      mm: unexport unmap_kernel_range_noflush
      mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
      mm: only allow page table mappings for built-in zsmalloc
      mm: pass addr as unsigned long to vb_free
      mm: remove vmap_page_range_noflush and vunmap_page_range
      mm: rename vmap_page_range to map_kernel_range
      mm: don't return the number of pages from map_kernel_range{,_noflush}
      mm: remove map_vm_range
      mm: remove unmap_vmap_area
      mm: remove the prot argument from vm_map_ram
      mm: enforce that vmap can't map pages executable
      gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
      mm: remove the pgprot argument to __vmalloc
      mm: remove the prot argument to __vmalloc_node
      mm: remove both instances of __vmalloc_node_flags
      mm: remove __vmalloc_node_flags_caller
      mm: switch the test_vmalloc module to use __vmalloc_node
      mm: remove vmalloc_user_node_flags
      arm64: use __vmalloc_node in arch_alloc_vmap_stack
      powerpc: use __vmalloc_node in alloc_vm_stack
      s390: use __vmalloc_node in stack_alloc

    Joerg Roedel <jroedel@suse.de>:
    Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
      mm: add functions to track page directory modifications
      mm/vmalloc: track which page-table levels were modified
      mm/ioremap: track which page-table levels were modified
      x86/mm/64: implement arch_sync_kernel_mappings()
      x86/mm/32: implement arch_sync_kernel_mappings()
      mm: remove vmalloc_sync_(un)mappings()
      x86/mm: remove vmalloc faulting

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix clang compilation warning due to stack protector

    Kees Cook <keescook@chromium.org>:
      ubsan: entirely disable alignment checks under UBSAN_TRAP

    Jing Xia <jing.xia@unisoc.com>:
      mm/mm_init.c: report kasan-tag information stored in page->flags

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: move kasan_report() into report.c

 Documentation/admin-guide/cgroup-v2.rst            |   24 +
 Documentation/core-api/cachetlb.rst                |    2 
 Documentation/filesystems/locking.rst              |    6 
 Documentation/filesystems/proc.rst                 |    4 
 Documentation/filesystems/vfs.rst                  |   15 
 Documentation/vm/slub.rst                          |    2 
 arch/arm/configs/omap2plus_defconfig               |    2 
 arch/arm64/include/asm/pgtable.h                   |    3 
 arch/arm64/include/asm/vmap_stack.h                |    6 
 arch/arm64/mm/dump.c                               |    2 
 arch/parisc/include/asm/pgtable.h                  |    2 
 arch/powerpc/include/asm/io.h                      |   10 
 arch/powerpc/include/asm/pci-bridge.h              |    2 
 arch/powerpc/kernel/irq.c                          |    5 
 arch/powerpc/kernel/isa-bridge.c                   |   28 +
 arch/powerpc/kernel/pci_64.c                       |   56 +-
 arch/powerpc/mm/ioremap_64.c                       |   50 --
 arch/riscv/include/asm/pgtable.h                   |    4 
 arch/riscv/mm/ptdump.c                             |    2 
 arch/s390/kernel/setup.c                           |    9 
 arch/sh/kernel/cpu/sh4/sq.c                        |    3 
 arch/x86/hyperv/hv_init.c                          |    5 
 arch/x86/include/asm/kvm_host.h                    |    3 
 arch/x86/include/asm/pgtable-2level_types.h        |    2 
 arch/x86/include/asm/pgtable-3level_types.h        |    2 
 arch/x86/include/asm/pgtable_64_types.h            |    2 
 arch/x86/include/asm/pgtable_types.h               |    8 
 arch/x86/include/asm/switch_to.h                   |   23 -
 arch/x86/kernel/irq_64.c                           |    2 
 arch/x86/kernel/setup_percpu.c                     |    6 
 arch/x86/kvm/svm/sev.c                             |    3 
 arch/x86/mm/dump_pagetables.c                      |   35 +
 arch/x86/mm/fault.c                                |  196 ----------
 arch/x86/mm/init_64.c                              |    5 
 arch/x86/mm/pti.c                                  |    8 
 arch/x86/mm/tlb.c                                  |   37 -
 block/blk-core.c                                   |    1 
 drivers/acpi/apei/ghes.c                           |    6 
 drivers/base/node.c                                |    2 
 drivers/block/drbd/drbd_bitmap.c                   |    4 
 drivers/block/loop.c                               |    2 
 drivers/dax/device.c                               |    1 
 drivers/gpu/drm/drm_scatter.c                      |   11 
 drivers/gpu/drm/etnaviv/etnaviv_dump.c             |    4 
 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c   |    2 
 drivers/lightnvm/pblk-init.c                       |    5 
 drivers/md/dm-bufio.c                              |    4 
 drivers/md/md-bitmap.c                             |   12 
 drivers/media/common/videobuf2/videobuf2-dma-sg.c  |    3 
 drivers/media/common/videobuf2/videobuf2-vmalloc.c |    3 
 drivers/media/pci/ivtv/ivtv-udma.c                 |   19 -
 drivers/media/pci/ivtv/ivtv-yuv.c                  |   17 
 drivers/media/pci/ivtv/ivtvfb.c                    |    4 
 drivers/mtd/ubi/io.c                               |    4 
 drivers/pcmcia/electra_cf.c                        |   45 --
 drivers/scsi/sd_zbc.c                              |    3 
 drivers/staging/android/ion/ion_heap.c             |    4 
 drivers/staging/media/ipu3/ipu3-css-pool.h         |    4 
 drivers/staging/media/ipu3/ipu3-dmamap.c           |   30 -
 fs/block_dev.c                                     |    7 
 fs/btrfs/disk-io.c                                 |    4 
 fs/btrfs/extent_io.c                               |   64 ---
 fs/btrfs/extent_io.h                               |    3 
 fs/btrfs/inode.c                                   |   39 --
 fs/buffer.c                                        |   23 -
 fs/erofs/data.c                                    |   41 --
 fs/erofs/decompressor.c                            |    2 
 fs/erofs/zdata.c                                   |   31 -
 fs/exfat/inode.c                                   |    7 
 fs/ext2/inode.c                                    |   10 
 fs/ext4/ext4.h                                     |    5 
 fs/ext4/inode.c                                    |   25 -
 fs/ext4/readpage.c                                 |   25 -
 fs/ext4/verity.c                                   |   35 -
 fs/f2fs/data.c                                     |   56 +-
 fs/f2fs/f2fs.h                                     |   14 
 fs/f2fs/verity.c                                   |   35 -
 fs/fat/inode.c                                     |    7 
 fs/file_table.c                                    |    1 
 fs/fs-writeback.c                                  |    1 
 fs/fuse/file.c                                     |  100 +----
 fs/gfs2/aops.c                                     |   23 -
 fs/gfs2/dir.c                                      |    9 
 fs/gfs2/quota.c                                    |    2 
 fs/hpfs/file.c                                     |    7 
 fs/iomap/buffered-io.c                             |  113 +----
 fs/iomap/trace.h                                   |    2 
 fs/isofs/inode.c                                   |    7 
 fs/jfs/inode.c                                     |    7 
 fs/mpage.c                                         |   38 --
 fs/nfs/blocklayout/extent_tree.c                   |    2 
 fs/nfs/internal.h                                  |   10 
 fs/nfs/write.c                                     |    4 
 fs/nfsd/vfs.c                                      |    9 
 fs/nilfs2/inode.c                                  |   15 
 fs/ntfs/aops.c                                     |    2 
 fs/ntfs/malloc.h                                   |    2 
 fs/ntfs/mft.c                                      |    2 
 fs/ocfs2/aops.c                                    |   34 -
 fs/ocfs2/dlm/dlmmaster.c                           |    1 
 fs/ocfs2/ocfs2.h                                   |    4 
 fs/ocfs2/slot_map.c                                |   46 +-
 fs/ocfs2/super.c                                   |   21 +
 fs/omfs/file.c                                     |    7 
 fs/open.c                                          |    3 
 fs/orangefs/inode.c                                |   32 -
 fs/proc/meminfo.c                                  |    3 
 fs/proc/task_mmu.c                                 |   16 
 fs/qnx6/inode.c                                    |    7 
 fs/reiserfs/inode.c                                |    8 
 fs/squashfs/block.c                                |  273 +++++++-------
 fs/squashfs/decompressor.h                         |    5 
 fs/squashfs/decompressor_multi.c                   |    9 
 fs/squashfs/decompressor_multi_percpu.c            |   17 
 fs/squashfs/decompressor_single.c                  |    9 
 fs/squashfs/lz4_wrapper.c                          |   17 
 fs/squashfs/lzo_wrapper.c                          |   17 
 fs/squashfs/squashfs.h                             |    4 
 fs/squashfs/xz_wrapper.c                           |   51 +-
 fs/squashfs/zlib_wrapper.c                         |   63 +--
 fs/squashfs/zstd_wrapper.c                         |   62 +--
 fs/sync.c                                          |    6 
 fs/ubifs/debug.c                                   |    2 
 fs/ubifs/lprops.c                                  |    2 
 fs/ubifs/lpt_commit.c                              |    4 
 fs/ubifs/orphan.c                                  |    2 
 fs/udf/inode.c                                     |    7 
 fs/xfs/kmem.c                                      |    2 
 fs/xfs/xfs_aops.c                                  |   13 
 fs/xfs/xfs_buf.c                                   |    2 
 fs/zonefs/super.c                                  |    7 
 include/asm-generic/5level-fixup.h                 |    5 
 include/asm-generic/pgtable.h                      |   27 +
 include/linux/buffer_head.h                        |    8 
 include/linux/fs.h                                 |   18 
 include/linux/iomap.h                              |    3 
 include/linux/memcontrol.h                         |    4 
 include/linux/mm.h                                 |   67 ++-
 include/linux/mm_types.h                           |    6 
 include/linux/mmzone.h                             |    1 
 include/linux/mpage.h                              |    4 
 include/linux/page_counter.h                       |    8 
 include/linux/pagemap.h                            |  193 ++++++++++
 include/linux/ptdump.h                             |    3 
 include/linux/sched.h                              |    3 
 include/linux/swap.h                               |   17 
 include/linux/vmalloc.h                            |   49 +-
 include/linux/zsmalloc.h                           |    2 
 include/trace/events/erofs.h                       |    6 
 include/trace/events/f2fs.h                        |    6 
 include/trace/events/writeback.h                   |    5 
 kernel/bpf/core.c                                  |    6 
 kernel/bpf/syscall.c                               |   29 -
 kernel/dma/remap.c                                 |   48 --
 kernel/groups.c                                    |    2 
 kernel/module.c                                    |    3 
 kernel/notifier.c                                  |    1 
 kernel/sys.c                                       |    2 
 kernel/trace/trace.c                               |   12 
 lib/Kconfig.ubsan                                  |    2 
 lib/ioremap.c                                      |   46 +-
 lib/test_vmalloc.c                                 |   26 -
 mm/Kconfig                                         |    4 
 mm/debug.c                                         |   56 ++
 mm/fadvise.c                                       |    6 
 mm/filemap.c                                       |    1 
 mm/gup.c                                           |   77 +++-
 mm/internal.h                                      |   14 
 mm/kasan/Makefile                                  |   21 -
 mm/kasan/common.c                                  |   19 -
 mm/kasan/report.c                                  |   22 +
 mm/memcontrol.c                                    |  198 +++++++---
 mm/memory-failure.c                                |   15 
 mm/memory.c                                        |    2 
 mm/migrate.c                                       |    9 
 mm/mm_init.c                                       |   16 
 mm/nommu.c                                         |   52 +-
 mm/page-writeback.c                                |   62 ++-
 mm/page_alloc.c                                    |    7 
 mm/percpu.c                                        |    2 
 mm/ptdump.c                                        |   17 
 mm/readahead.c                                     |  349 ++++++++++--------
 mm/slab_common.c                                   |    3 
 mm/slub.c                                          |   67 ++-
 mm/swap_state.c                                    |    5 
 mm/swapfile.c                                      |  194 ++++++----
 mm/util.c                                          |    2 
 mm/vmalloc.c                                       |  399 ++++++++-------------
 mm/vmscan.c                                        |    4 
 mm/vmstat.c                                        |   11 
 mm/zsmalloc.c                                      |   12 
 net/bridge/netfilter/ebtables.c                    |    6 
 net/ceph/ceph_common.c                             |    3 
 sound/core/memalloc.c                              |    2 
 sound/core/pcm_memory.c                            |    2 
 195 files changed, 2292 insertions(+), 2288 deletions(-)



^ permalink raw reply	[flat|nested] 188+ messages in thread

* Re: incoming
  2020-05-29 21:12       ` incoming Andrew Morton
@ 2020-05-29 21:20         ` Linus Torvalds
  0 siblings, 0 replies; 188+ messages in thread
From: Linus Torvalds @ 2020-05-29 21:20 UTC (permalink / raw)
  To: Andrew Morton; +Cc: mm-commits, Linux-MM

On Fri, May 29, 2020 at 2:12 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Stupid diffstat.  Means that basically all my diffstats are very wrong.

I'm actually used to diffstats not matching 100%/

Usually it's not due to this issue - a "git diff --stat" *will* give
the stat from the actual combined diff result - but with git diffstats
the issue is that I might have gotten a patch from another source.

So the diffstat I see after-the-merge is possibly different from the
pre-merge diffstat simply due to merge issues.

So then I usually take a look at "ok, why did that diffstat differ"
and go "Ahh".

In your case, when I looked at the diffstat, I couldn't for the life
of me see how you would have gotten the diffstat you did, since I only
saw a single patch with no merge issues.

> Thanks for spotting it.
>
> I can fix that...

I can also just live with it, knowing what your workflow is. The
diffstat matching exactly just isn't that important - in fact,
different versions of "diff" can give slightly different output anyway
depending on diff algorithms even when they are looking at the exact
same before/after state. There's not necessarily always only one way
to generate a valid diff.

So to me, the diffstat is more of a guide than a hard thing, and I
want to see the rough outline,

In fact, one reason I want to see it in pull requests is actually just
that I want to get a feel for what changes even before I do the pull
or merge, so it's not just a "match against what I get" thing.

                      Linus


^ permalink raw reply	[flat