Linux-mm Archive on lore.kernel.org
 help / color / Atom feed
From: Andrew Morton <akpm@linux-foundation.org>
To: Linus Torvalds <torvalds@linux-foundation.org>
Cc: Konstantin Ryabitsev <konstantin@linuxfoundation.org>,
	Linux-MM <linux-mm@kvack.org>,
	mm-commits@vger.kernel.org
Subject: Re: incoming
Date: Wed, 5 May 2021 10:44:01 -0700
Message-ID: <20210505104401.75fc14e7de7573c26c4c49d4@linux-foundation.org> (raw)
In-Reply-To: <CAHk-=wgOGM5u0Kcx0L0u58D9ms6vQ=LwtJNMNd4xmAjQ+jcQSw@mail.gmail.com>


[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]

On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to.  Hopefully they will
> > land in the correct place.
> 
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
> 
> So the list hates them for some odd reason.
> 
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
> 
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.

It's weird.  They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo.  They don't get through when sent with
either heirloom-mailx or with sylpheed.

Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out.  So perhaps a spam filter
triggered?

I'm seeing

https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/

which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series.  Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.

One of the emails (as sent my me) is attached, if that helps.



[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]

Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
	USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
	by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
	for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
	by localhost.localdomain with IMAP (fetchmail-6.3.26)
	for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
	 by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
	 Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
  by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
	by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
    by mx6.messagingengine.com (Authentication Milter) with ESMTP
    id 14870833D7F;
    Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
    1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
    yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
    djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
    Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
    RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
    tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
    messagingengine.com; h=date:from:to:subject:message-id
    :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
    uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
    gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
    Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
    YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
    zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
    7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
    smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
    header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
    header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
    policy.applied-disposition=none policy.evaluated-disposition=none
    (p=none,d=none,d.eval=none) policy.policy-from=p
    header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
    smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
    (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
    smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
    x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
    header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
    policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
    smtp.bits=256/256;
    x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
      smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
      header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
      header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
      policy.applied-disposition=none policy.evaluated-disposition=none
      (p=none,d=none,d.eval=none) policy.policy-from=p
      header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
      smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
      (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
      smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
      x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
      header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
      policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
      smtp.bits=256/256;
    x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
    fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
    rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
    hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
    peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
    honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
    geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
    enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
    uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
    iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
    ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
    epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
    (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
    receiver=mx6.messagingengine.com;
    identity=mailfrom;
    envelope-from="akpm@linux-foundation.org";
    helo=mail-pg1-f198.google.com;
    client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
	(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
	 key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
	(No client certificate requested)
	by mx6.messagingengine.com (Postfix) with ESMTPS
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
        for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=1e100.net; s=20161025;
        h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
         :in-reply-to:user-agent;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
         NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
         feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
         25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
         ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
         vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
	tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
	xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
        Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
        d=google.com; s=arc-20160816;
        b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
         /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
         50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
         8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
         DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
         pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
        h=user-agent:in-reply-to:message-id:subject:to:from:date
         :dkim-signature;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
         Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
         uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
         XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
         TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
         rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
        by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
        (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
	Wed,  5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
	s=korg; t=1620184587;
	bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
	h=Date:From:To:Subject:In-Reply-To:From;
	b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
	 D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
	 H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)

SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it.  Instead, just make it a generic option which can be
selected on applicable platforms.  Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead.  This reduces code duplication and makes
it cleaner.

Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com>	[riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au>		[powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm/Kconfig                       |    5 +----
 arch/arm64/Kconfig                     |    4 +---
 arch/mips/Kconfig                      |    6 +-----
 arch/parisc/Kconfig                    |    5 +----
 arch/powerpc/Kconfig                   |    3 ---
 arch/powerpc/platforms/Kconfig.cputype |    6 +++---
 arch/riscv/Kconfig                     |    5 +----
 arch/sh/Kconfig                        |    5 +----
 fs/Kconfig                             |    5 ++++-
 9 files changed, 13 insertions(+), 31 deletions(-)

--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
 	select ARCH_USE_QUEUED_SPINLOCKS
 	select ARCH_USE_SYM_ANNOTATIONS
 	select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
 	select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y
-
 config ARCH_HAS_FILTER_PGPROT
 	def_bool y
 
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
 	select ARCH_SUPPORTS_ATOMIC_RMW
+	select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
 	select ARCH_USE_BUILTIN_BSWAP
 	select ARCH_USE_CMPXCHG_LOCKREF
 	select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-       def_bool y
-       depends on ARM_LPAE
-
 config HAVE_ARCH_TRANSPARENT_HUGEPAGE
        def_bool y
        depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
 	select ARCH_USE_MEMTEST
 	select ARCH_USE_QUEUED_RWLOCKS
 	select ARCH_USE_QUEUED_SPINLOCKS
+	select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_IPC_PARSE_VERSION
 	select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
 config SYS_SUPPORTS_LITTLE_ENDIAN
 	bool
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-	depends on CPU_SUPPORTS_HUGEPAGES
-	default y
-
 config MIPS_HUGE_TLB_SUPPORT
 	def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
 
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
 	select ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_HAS_UBSAN_SANITIZE_ALL
 	select ARCH_NO_SG_CHAIN
+	select ARCH_SUPPORTS_HUGETLBFS if PA20
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select DMA_OPS
 	select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
 	default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
 	default 2
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y if PA20
-
-
 menu "Processor type and features"
 
 choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
 	def_bool y
 	depends on PPC_BOOK3S_64
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config ILLEGAL_POINTER_VALUE
 	hex
 	# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
 
 config PPC_8xx
 	bool "Freescale 8xx"
+	select ARCH_SUPPORTS_HUGETLBFS
 	select FSL_SOC
-	select SYS_SUPPORTS_HUGETLBFS
 	select PPC_HAVE_KUEP
 	select PPC_HAVE_KUAP
 	select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
 	bool "Server processors"
 	select PPC_FPU
 	select PPC_HAVE_PMU_SUPPORT
-	select SYS_SUPPORTS_HUGETLBFS
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
 	select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_NUMA_BALANCING
 	select IRQ_WORK
 	select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
 # this is for common code between PPC32 & PPC64 FSL BOOKE
 config PPC_FSL_BOOK3E
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select FSL_EMB_PERFMON
 	select PPC_SMP_MUXED_IPI
-	select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select PPC_DOORBELL
 	default y if FSL_BOOKE
 
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
 	select ARCH_HAS_STRICT_KERNEL_RWX if MMU
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_FRAME_POINTERS
 	select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
 config ARCH_SUPPORTS_UPROBES
 	def_bool y
 
-config SYS_SUPPORTS_HUGETLBFS
-	depends on MMU
-	def_bool y
-
 config STACKTRACE_SUPPORT
 	def_bool y
 
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
 	bool
 	select ARCH_SUSPEND_POSSIBLE
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config SYS_SUPPORTS_SMP
 	bool
 
@@ -175,12 +172,12 @@ config CPU_SH3
 
 config CPU_SH4
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select CPU_HAS_INTEVT
 	select CPU_HAS_SR_RB
 	select CPU_HAS_FPU if !CPU_SH4AL_DSP
 	select SH_INTC
 	select SYS_SUPPORTS_SH_TMU
-	select SYS_SUPPORTS_HUGETLBFS if MMU
 
 config CPU_SH4A
 	bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
 
 	  If unsure, say N.
 
+config ARCH_SUPPORTS_HUGETLBFS
+	def_bool n
+
 config HUGETLBFS
 	bool "HugeTLB file system support"
 	depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
-		   SYS_SUPPORTS_HUGETLBFS || BROKEN
+		   ARCH_SUPPORTS_HUGETLBFS || BROKEN
 	help
 	  hugetlbfs is a filesystem backing for HugeTLB pages, based on
 	  ramfs. For architectures that support it, say Y here and read
_

  reply index

Thread overview: 301+ messages / expand[flat|nested]  mbox.gz  Atom feed  top
2021-05-05  1:32 incoming Andrew Morton
2021-05-05  1:32 ` [patch 001/143] mm: introduce and use mapping_empty() Andrew Morton
2021-05-05  1:32 ` [patch 002/143] mm: stop accounting shadow entries Andrew Morton
2021-05-05  1:32 ` [patch 003/143] dax: account DAX entries as nrpages Andrew Morton
2021-05-05  1:32 ` [patch 004/143] mm: remove nrexceptional from inode Andrew Morton
2021-05-05  1:32 ` [patch 005/143] mm: remove nrexceptional from inode: remove BUG_ON Andrew Morton
2021-05-05  1:33 ` [patch 006/143] hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() Andrew Morton
2021-05-05  1:33 ` [patch 007/143] hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled Andrew Morton
2021-05-05  1:33 ` [patch 008/143] mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h Andrew Morton
2021-05-05  1:33 ` [patch 009/143] hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Andrew Morton
2021-05-05  1:33 ` [patch 010/143] mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Andrew Morton
2021-05-05  1:33 ` [patch 011/143] mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Andrew Morton
2021-05-05  1:33 ` [patch 012/143] mm/hugetlb: use some helper functions to cleanup code Andrew Morton
2021-05-05  1:33 ` [patch 013/143] mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() Andrew Morton
2021-05-05  1:33 ` [patch 014/143] mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() Andrew Morton
2021-05-05  1:33 ` [patch 015/143] mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() Andrew Morton
2021-05-05  1:33 ` [patch 016/143] mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Andrew Morton
2021-05-05  1:33 ` [patch 017/143] khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() Andrew Morton
2021-05-05  1:33 ` [patch 018/143] khugepaged: reuse the smp_wmb() inside __SetPageUptodate() Andrew Morton
2021-05-05  1:33 ` [patch 019/143] khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() Andrew Morton
2021-05-05  1:33 ` [patch 020/143] khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() Andrew Morton
2021-05-05  1:33 ` [patch 021/143] mm/huge_memory.c: remove unnecessary local variable ret2 Andrew Morton
2021-05-05  1:33 ` [patch 022/143] mm/huge_memory.c: rework the function vma_adjust_trans_huge() Andrew Morton
2021-05-05  1:33 ` [patch 023/143] mm/huge_memory.c: make get_huge_zero_page() return bool Andrew Morton
2021-05-05  1:33 ` [patch 024/143] mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly Andrew Morton
2021-05-05  1:34 ` [patch 025/143] mm/huge_memory.c: remove redundant PageCompound() check Andrew Morton
2021-05-05  1:34 ` [patch 026/143] mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG Andrew Morton
2021-05-05  1:34 ` [patch 027/143] mm/huge_memory.c: use helper function migration_entry_to_page() Andrew Morton
2021-05-05  1:34 ` [patch 028/143] mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Andrew Morton
2021-05-05  1:34 ` [patch 029/143] khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() Andrew Morton
2021-05-05  1:34 ` [patch 030/143] khugepaged: remove unnecessary out label in collapse_huge_page() Andrew Morton
2021-05-05  1:34 ` [patch 031/143] khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Andrew Morton
2021-05-05  1:34 ` [patch 032/143] mm: huge_memory: a new debugfs interface for splitting THP tests Andrew Morton
2021-05-05  1:34 ` [patch 033/143] mm: huge_memory: debugfs for file-backed THP split Andrew Morton
2021-05-05  1:34 ` [patch 034/143] mm/hugeltb: remove redundant VM_BUG_ON() in region_add() Andrew Morton
2021-05-05  1:34 ` [patch 035/143] mm/hugeltb: simplify the return code of __vma_reservation_common() Andrew Morton
2021-05-05  1:34 ` [patch 036/143] mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() Andrew Morton
2021-05-05  1:34 ` [patch 037/143] mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() Andrew Morton
2021-05-05  1:34 ` [patch 038/143] mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Andrew Morton
2021-05-05  1:34 ` [patch 039/143] mm/cma: change cma mutex to irq safe spinlock Andrew Morton
2021-05-05  1:34 ` [patch 040/143] hugetlb: no need to drop hugetlb_lock to call cma_release Andrew Morton
2021-05-05  1:34 ` [patch 041/143] hugetlb: add per-hstate mutex to synchronize user adjustments Andrew Morton
2021-05-05  1:34 ` [patch 042/143] hugetlb: create remove_hugetlb_page() to separate functionality Andrew Morton
2021-05-05  1:34 ` [patch 043/143] hugetlb: call update_and_free_page without hugetlb_lock Andrew Morton
2021-05-05  1:35 ` [patch 044/143] hugetlb: change free_pool_huge_page to remove_pool_huge_page Andrew Morton
2021-05-05  1:35 ` [patch 045/143] hugetlb: make free_huge_page irq safe Andrew Morton
2021-05-05  1:35 ` [patch 046/143] hugetlb: add lockdep_assert_held() calls for hugetlb_lock Andrew Morton
2021-05-05  1:35 ` [patch 047/143] mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range Andrew Morton
2021-05-05  1:35 ` [patch 048/143] mm,compaction: let isolate_migratepages_{range,block} return error codes Andrew Morton
2021-05-05  1:35 ` [patch 049/143] mm,hugetlb: drop clearing of flag from prep_new_huge_page Andrew Morton
2021-05-05  1:35 ` [patch 050/143] mm,hugetlb: split prep_new_huge_page functionality Andrew Morton
2021-05-05  1:35 ` [patch 051/143] mm: make alloc_contig_range handle free hugetlb pages Andrew Morton
2021-05-05  1:35 ` [patch 052/143] mm: make alloc_contig_range handle in-use " Andrew Morton
2021-05-05  1:35 ` [patch 053/143] mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Andrew Morton
2021-05-05  1:35 ` [patch 054/143] userfaultfd: add minor fault registration mode Andrew Morton
2021-05-05  1:35 ` [patch 055/143] userfaultfd: disable huge PMD sharing for MINOR registered VMAs Andrew Morton
2021-05-05  1:35 ` [patch 056/143] userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled Andrew Morton
2021-05-05  1:35 ` [patch 057/143] userfaultfd: add UFFDIO_CONTINUE ioctl Andrew Morton
2021-05-05  1:35 ` [patch 058/143] userfaultfd: update documentation to describe minor fault handling Andrew Morton
2021-05-05  1:35 ` [patch 059/143] userfaultfd/selftests: add test exercising " Andrew Morton
2021-05-05  1:36 ` [patch 060/143] mm/vmscan: move RECLAIM* bits to uapi header Andrew Morton
2021-05-05  1:36 ` [patch 061/143] mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Andrew Morton
2021-05-05  1:36 ` [patch 062/143] mm: vmscan: use nid from shrink_control for tracepoint Andrew Morton
2021-05-05  1:36 ` [patch 063/143] mm: vmscan: consolidate shrinker_maps handling code Andrew Morton
2021-05-05  1:36 ` [patch 064/143] mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation Andrew Morton
2021-05-05  1:36 ` [patch 065/143] mm: vmscan: remove memcg_shrinker_map_size Andrew Morton
2021-05-05  1:36 ` [patch 066/143] mm: vmscan: use kvfree_rcu instead of call_rcu Andrew Morton
2021-05-05  1:36 ` [patch 067/143] mm: memcontrol: rename shrinker_map to shrinker_info Andrew Morton
2021-05-05  1:36 ` [patch 068/143] mm: vmscan: add shrinker_info_protected() helper Andrew Morton
2021-05-05  1:36 ` [patch 069/143] mm: vmscan: use a new flag to indicate shrinker is registered Andrew Morton
2021-05-05  1:36 ` [patch 070/143] mm: vmscan: add per memcg shrinker nr_deferred Andrew Morton
2021-05-05  1:36 ` [patch 071/143] mm: vmscan: use per memcg nr_deferred of shrinker Andrew Morton
2021-05-05  1:36 ` [patch 072/143] mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers Andrew Morton
2021-05-05  1:36 ` [patch 073/143] mm: memcontrol: reparent nr_deferred when memcg offline Andrew Morton
2021-05-05  1:36 ` [patch 074/143] mm: vmscan: shrink deferred objects proportional to priority Andrew Morton
2021-05-05  1:36 ` [patch 075/143] mm/compaction: remove unused variable sysctl_compact_memory Andrew Morton
2021-05-05  1:36 ` [patch 076/143] mm: compaction: update the COMPACT[STALL|FAIL] events properly Andrew Morton
2021-05-05  1:36 ` [patch 077/143] mm: disable LRU pagevec during the migration temporarily Andrew Morton
2021-05-05  1:36 ` [patch 078/143] mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] Andrew Morton
2021-05-05  1:37 ` [patch 079/143] mm: fs: invalidate BH LRU during page migration Andrew Morton
2021-05-05  1:37 ` [patch 080/143] mm/migrate.c: make putback_movable_page() static Andrew Morton
2021-05-05  1:37 ` [patch 081/143] mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case Andrew Morton
2021-05-05  1:37 ` [patch 082/143] mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() Andrew Morton
2021-05-05  1:37 ` [patch 083/143] mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Andrew Morton
2021-05-05  1:37 ` [patch 084/143] Revert "mm: migrate: skip shared exec THP for NUMA balancing" Andrew Morton
2021-05-05  1:37 ` [patch 085/143] mm: vmstat: add cma statistics Andrew Morton
2021-05-05  1:37 ` [patch 086/143] mm: cma: use pr_err_ratelimited for CMA warning Andrew Morton
2021-05-05  1:37 ` [patch 087/143] mm: cma: add trace events for CMA alloc perf testing Andrew Morton
2021-05-05  1:37 ` [patch 088/143] mm: cma: support sysfs Andrew Morton
2021-05-05  1:37 ` [patch 089/143] mm: cma: add the CMA instance name to cma trace events Andrew Morton
2021-05-05  1:37 ` [patch 090/143] mm: use proper type for cma_[alloc|release] Andrew Morton
2021-05-05  1:37 ` [patch 091/143] ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() Andrew Morton
2021-05-05  1:37 ` [patch 092/143] ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() Andrew Morton
2021-05-05  1:37 ` [patch 093/143] ksm: remove dedicated macro KSM_FLAG_MASK Andrew Morton
2021-05-05  1:37 ` [patch 094/143] ksm: fix potential missing rmap_item for stable_node Andrew Morton
2021-05-05  1:37 ` [patch 095/143] mm/ksm: remove unused parameter from remove_trailing_rmap_items() Andrew Morton
2021-05-05  1:37 ` [patch 096/143] mm: restore node stat checking in /proc/sys/vm/stat_refresh Andrew Morton
2021-05-05  1:37 ` [patch 097/143] mm: no more EINVAL from /proc/sys/vm/stat_refresh Andrew Morton
2021-05-05  1:37 ` [patch 098/143] mm: /proc/sys/vm/stat_refresh skip checking known negative stats Andrew Morton
2021-05-05  1:38 ` [patch 099/143] mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Andrew Morton
2021-05-05  1:38 ` [patch 100/143] x86/mm: track linear mapping split events Andrew Morton
2021-05-05  1:38 ` [patch 101/143] mm/mmap.c: don't unlock VMAs in remap_file_pages() Andrew Morton
2021-05-05  1:38 ` [patch 102/143] mm: generalize ARCH_HAS_CACHE_LINE_SIZE Andrew Morton
2021-05-05  1:38 ` [patch 104/143] mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] Andrew Morton
2021-05-05  1:38 ` [patch 105/143] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION Andrew Morton
2021-05-05  1:38 ` [patch 108/143] mm/util.c: reduce mem_dump_obj() object size Andrew Morton
2021-05-05  1:38 ` [patch 109/143] mm/util.c: fix typo Andrew Morton
2021-05-05  1:38 ` [patch 110/143] mm/gup: don't pin migrated cma pages in movable zone Andrew Morton
2021-05-05  1:38 ` [patch 111/143] mm/gup: check every subpage of a compound page during isolation Andrew Morton
2021-05-05  1:38 ` [patch 112/143] mm/gup: return an error on migration failure Andrew Morton
2021-05-05  1:38 ` [patch 113/143] mm/gup: check for isolation errors Andrew Morton
2021-05-05  1:38 ` [patch 114/143] mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN Andrew Morton
2021-05-05  1:38 ` [patch 115/143] mm: apply per-task gfp constraints in fast path Andrew Morton
2021-05-05  1:39 ` [patch 116/143] mm: honor PF_MEMALLOC_PIN for all movable pages Andrew Morton
2021-05-05  1:39 ` [patch 117/143] mm/gup: do not migrate zero page Andrew Morton
2021-05-05  1:39 ` [patch 118/143] mm/gup: migrate pinned pages out of movable zone Andrew Morton
2021-05-05  1:39 ` [patch 119/143] memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning Andrew Morton
2021-05-05  1:39 ` [patch 120/143] mm/gup: change index type to long as it counts pages Andrew Morton
2021-05-05  1:39 ` [patch 121/143] mm/gup: longterm pin migration cleanup Andrew Morton
2021-05-05  1:39 ` [patch 122/143] selftests/vm: gup_test: fix test flag Andrew Morton
2021-05-05  1:39 ` [patch 123/143] selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Andrew Morton
2021-05-05  1:39 ` [patch 124/143] mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Andrew Morton
2021-05-05  1:39 ` [patch 125/143] drivers/base/memory: introduce memory_block_{online,offline} Andrew Morton
2021-05-05  1:39 ` [patch 126/143] mm,memory_hotplug: relax fully spanned sections check Andrew Morton
2021-05-05  1:39 ` [patch 127/143] mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Andrew Morton
2021-05-05  1:39 ` [patch 128/143] mm,memory_hotplug: allocate memmap from the added memory range Andrew Morton
2021-05-05  1:39 ` [patch 129/143] acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported Andrew Morton
2021-05-05  1:39 ` [patch 130/143] mm,memory_hotplug: add kernel boot option to enable memmap_on_memory Andrew Morton
2021-05-05  1:39 ` [patch 131/143] x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Andrew Morton
2021-05-05  1:39 ` [patch 132/143] arm64/Kconfig: " Andrew Morton
2021-05-05  1:39 ` [patch 133/143] mm/zswap.c: switch from strlcpy to strscpy Andrew Morton
2021-05-05  1:40 ` [patch 134/143] mm/zsmalloc: use BUG_ON instead of if condition followed by BUG Andrew Morton
2021-05-05  1:40 ` [patch 135/143] iov_iter: lift memzero_page() to highmem.h Andrew Morton
2021-05-05  1:40 ` [patch 136/143] btrfs: use memzero_page() instead of open coded kmap pattern Andrew Morton
2021-05-05  1:40 ` [patch 137/143] mm/highmem.c: fix coding style issue Andrew Morton
2021-05-05  1:40 ` [patch 138/143] mm/mempool: minor coding style tweaks Andrew Morton
2021-05-05  1:40 ` [patch 139/143] mm/process_vm_access.c: remove duplicate include Andrew Morton
2021-05-05  1:40 ` [patch 140/143] kfence: zero guard page after out-of-bounds access Andrew Morton
2021-05-05  1:40 ` [patch 141/143] kfence: await for allocation using wait_event Andrew Morton
2021-05-05  1:40 ` [patch 142/143] kfence: maximize allocation wait timeout duration Andrew Morton
2021-05-05  1:40 ` [patch 143/143] kfence: use power-efficient work queue to run delayed work Andrew Morton
2021-05-05  1:47 ` incoming Linus Torvalds
2021-05-05  3:16   ` incoming Andrew Morton
2021-05-05 17:10     ` incoming Linus Torvalds
2021-05-05 17:44       ` Andrew Morton [this message]
2021-05-06  3:19         ` incoming Anshuman Khandual
  -- strict thread matches above, loose matches on Subject: below --
2021-07-23 22:49 incoming Andrew Morton
2021-07-15  4:26 incoming Andrew Morton
2021-07-08  0:59 incoming Andrew Morton
2021-07-01  1:46 incoming Andrew Morton
2021-07-03  0:28 ` incoming Linus Torvalds
2021-07-03  1:06   ` incoming Linus Torvalds
2021-06-29  2:32 incoming Andrew Morton
2021-06-25  1:38 incoming Andrew Morton
2021-06-16  1:22 incoming Andrew Morton
2021-06-05  3:00 incoming Andrew Morton
2021-05-23  0:41 incoming Andrew Morton
2021-05-15  0:26 incoming Andrew Morton
2021-05-07  1:01 incoming Andrew Morton
2021-05-07  7:12 ` incoming Linus Torvalds
2021-04-30  5:52 incoming Andrew Morton
2021-04-23 21:28 incoming Andrew Morton
2021-04-16 22:45 incoming Andrew Morton
2021-04-09 20:26 incoming Andrew Morton
2021-03-25  4:36 incoming Andrew Morton
2021-03-13  5:06 incoming Andrew Morton
2021-02-26  1:14 incoming Andrew Morton
2021-02-26 17:55 ` incoming Linus Torvalds
2021-02-26 19:16   ` incoming Andrew Morton
2021-02-24 19:58 incoming Andrew Morton
2021-02-24 21:30 ` incoming Linus Torvalds
2021-02-24 21:37   ` incoming Linus Torvalds
2021-02-25  8:53     ` incoming Arnd Bergmann
2021-02-25  9:12       ` incoming Andrey Ryabinin
2021-02-25 11:07         ` incoming Walter Wu
2021-02-13  4:52 incoming Andrew Morton
2021-02-09 21:41 incoming Andrew Morton
2021-02-10 19:30 ` incoming Linus Torvalds
2021-02-05  2:31 incoming Andrew Morton
2021-01-24  5:00 incoming Andrew Morton
2021-01-12 23:48 incoming Andrew Morton
2021-01-15 23:32 ` incoming Linus Torvalds
2020-12-29 23:13 incoming Andrew Morton
2020-12-22 19:58 incoming Andrew Morton
2020-12-22 21:43 ` incoming Linus Torvalds
2020-12-18 22:00 incoming Andrew Morton
2020-12-16  4:41 incoming Andrew Morton
2020-12-15 20:32 incoming Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
2020-12-15 22:49   ` incoming Linus Torvalds
2020-12-15 22:55     ` incoming Andrew Morton
2020-12-15  3:02 incoming Andrew Morton
2020-12-15  3:25 ` incoming Linus Torvalds
2020-12-15  3:30   ` incoming Linus Torvalds
2020-12-15 14:04     ` incoming Konstantin Ryabitsev
2020-12-11 21:35 incoming Andrew Morton
2020-12-06  6:14 incoming Andrew Morton
2020-11-22  6:16 incoming Andrew Morton
2020-11-14  6:51 incoming Andrew Morton
2020-11-02  1:06 incoming Andrew Morton
2020-10-17 23:13 incoming Andrew Morton
2020-10-16  2:40 incoming Andrew Morton
2020-10-16  3:03 ` incoming Andrew Morton
2020-10-13 23:46 incoming Andrew Morton
2020-10-11  6:15 incoming Andrew Morton
2020-10-03  5:20 incoming Andrew Morton
2020-09-26  4:17 incoming Andrew Morton
2020-09-19  4:19 incoming Andrew Morton
2020-09-04 23:34 incoming Andrew Morton
2020-08-21  0:41 incoming Andrew Morton
2020-08-15  0:29 incoming Andrew Morton
2020-08-12  1:29 incoming Andrew Morton
2020-08-07  6:16 incoming Andrew Morton
2020-07-24  4:14 incoming Andrew Morton
2020-07-03 22:14 incoming Andrew Morton
2020-06-26  3:28 incoming Andrew Morton
2020-06-26  6:51 ` incoming Linus Torvalds
2020-06-26  7:31   ` incoming Linus Torvalds
2020-06-26 17:39   ` incoming Konstantin Ryabitsev
2020-06-26 17:40     ` incoming Konstantin Ryabitsev
2020-06-12  0:30 incoming Andrew Morton
2020-06-11  1:40 incoming Andrew Morton
2020-06-09  4:29 incoming Andrew Morton
2020-06-09 16:58 ` incoming Linus Torvalds
2020-06-08  4:35 incoming Andrew Morton
2020-06-04 23:45 incoming Andrew Morton
2020-06-03 22:55 incoming Andrew Morton
2020-06-02 20:09 incoming Andrew Morton
2020-06-02  4:44 incoming Andrew Morton
2020-06-02 20:08 ` incoming Andrew Morton
2020-06-02 20:45   ` incoming Linus Torvalds
2020-06-02 21:38     ` incoming Andrew Morton
2020-06-02 22:18       ` incoming Linus Torvalds
2020-05-28  5:20 incoming Andrew Morton
2020-05-28 20:10 ` incoming Linus Torvalds
2020-05-29 20:31   ` incoming Andrew Morton
2020-05-29 20:38     ` incoming Linus Torvalds
2020-05-29 21:12       ` incoming Andrew Morton
2020-05-29 21:20         ` incoming Linus Torvalds
2020-05-23  5:22 incoming Andrew Morton
2020-05-14  0:50 incoming Andrew Morton
2020-05-08  1:35 incoming Andrew Morton
2020-04-21  1:13 incoming Andrew Morton
2020-04-12  7:41 incoming Andrew Morton
2020-04-10 21:30 incoming Andrew Morton
2020-04-07  3:02 incoming Andrew Morton
2020-04-02  4:01 incoming Andrew Morton
2020-03-29  2:14 incoming Andrew Morton
2020-03-22  1:19 incoming Andrew Morton
2020-03-06  6:27 incoming Andrew Morton
2020-02-21  4:00 incoming Andrew Morton
2020-02-21  4:03 ` incoming Andrew Morton
2020-02-21 18:21 ` incoming Linus Torvalds
2020-02-21 18:32   ` incoming Konstantin Ryabitsev
2020-02-27  9:59     ` incoming Vlastimil Babka
2020-02-21 19:33   ` incoming Linus Torvalds
2020-02-04  1:33 incoming Andrew Morton
2020-02-04  2:27 ` incoming Linus Torvalds
2020-02-04  2:46   ` incoming Andrew Morton
2020-02-04  3:11     ` incoming Linus Torvalds
2020-01-31  6:10 incoming Andrew Morton
2020-01-14  0:28 incoming Andrew Morton
2020-01-04 20:55 incoming Andrew Morton
2019-12-18  4:50 incoming Andrew Morton
2019-12-05  0:48 incoming Andrew Morton
2019-12-01  1:47 incoming Andrew Morton
2019-12-01  5:17 ` incoming James Bottomley
2019-12-01 21:07 ` incoming Linus Torvalds
2019-12-02  8:21   ` incoming Steven Price
2019-11-22  1:53 incoming Andrew Morton
2019-11-16  1:34 incoming Andrew Morton
2019-11-06  5:16 incoming Andrew Morton
2019-10-19  3:19 incoming Andrew Morton
2019-10-14 21:11 incoming Andrew Morton
2019-10-07  0:57 incoming Andrew Morton
2019-09-25 23:45 incoming Andrew Morton
2019-09-23 22:31 incoming Andrew Morton
2019-09-24  0:55 ` incoming Linus Torvalds
2019-09-24  4:31   ` incoming Andrew Morton
2019-09-24  7:48     ` incoming Michal Hocko
2019-09-24 15:34       ` incoming Linus Torvalds
2019-09-25  6:36         ` incoming Michal Hocko
2019-09-24 19:55       ` incoming Vlastimil Babka
2019-08-30 23:04 incoming Andrew Morton
2019-08-25  0:54 incoming Andrew Morton
     [not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org>
2019-07-17  8:47 ` incoming Vlastimil Babka
2019-07-17  8:57   ` incoming Bhaskar Chowdhury
2019-07-17 16:13   ` incoming Linus Torvalds
2019-07-17 17:09     ` incoming Christian Brauner
2019-07-17 18:13     ` incoming Vlastimil Babka
2007-05-02 22:02 incoming Andrew Morton
2007-05-02 22:31 ` incoming Benjamin Herrenschmidt
2007-05-03  7:55 ` incoming Russell King
2007-05-03  8:05   ` incoming Andrew Morton
2007-05-04 13:37 ` incoming Greg KH
2007-05-04 16:14   ` incoming Andrew Morton
2007-05-04 17:02     ` incoming Greg KH
2007-05-04 18:57     ` incoming Roland McGrath
2007-05-04 19:24       ` incoming Greg KH
2007-05-04 19:29         ` incoming Roland McGrath

Reply instructions:

You may reply publicly to this message via plain-text email
using any one of the following methods:

* Save the following mbox file, import it into your mail client,
  and reply-to-all from there: mbox

  Avoid top-posting and favor interleaved quoting:
  https://en.wikipedia.org/wiki/Posting_style#Interleaved_style

* Reply using the --to, --cc, and --in-reply-to
  switches of git-send-email(1):

  git send-email \
    --in-reply-to=20210505104401.75fc14e7de7573c26c4c49d4@linux-foundation.org \
    --to=akpm@linux-foundation.org \
    --cc=konstantin@linuxfoundation.org \
    --cc=linux-mm@kvack.org \
    --cc=mm-commits@vger.kernel.org \
    --cc=torvalds@linux-foundation.org \
    /path/to/YOUR_REPLY

  https://kernel.org/pub/software/scm/git/docs/git-send-email.html

* If your mail client supports setting the In-Reply-To header
  via mailto: links, try the mailto: link

Linux-mm Archive on lore.kernel.org

Archives are clonable:
	git clone --mirror https://lore.kernel.org/linux-mm/0 linux-mm/git/0.git

	# If you have public-inbox 1.1+ installed, you may
	# initialize and index your mirror using the following commands:
	public-inbox-init -V2 linux-mm linux-mm/ https://lore.kernel.org/linux-mm \
		linux-mm@kvack.org
	public-inbox-index linux-mm

Example config snippet for mirrors

Newsgroup available over NNTP:
	nntp://nntp.lore.kernel.org/org.kvack.linux-mm


AGPL code for this site: git clone https://public-inbox.org/public-inbox.git