* incoming @ 2020-10-13 23:46 Andrew Morton 2020-10-13 23:47 ` [patch 001/181] compiler-clang: add build check for clang 10.0.1 Andrew Morton ` (180 more replies) 0 siblings, 181 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c. Subsystems affected by this patch series: kbuild scripts ntfs ocfs2 vfs mm/slab mm/slub mm/kmemleak mm/dax mm/debug mm/pagecache mm/fadvise mm/gup mm/swap mm/memremap mm/memcg mm/selftests mm/pagemap mm/mincore mm/hmm mm/dma mm/memory-failure mm/vmalloc mm/documentation mm/kasan mm/pagealloc mm/hugetlb mm/vmscan mm/z3fold mm/zbud mm/compaction mm/mempolicy mm/mempool mm/memblock mm/oom-kill mm/migration Subsystem: kbuild Nick Desaulniers <ndesaulniers@google.com>: Patch series "set clang minimum version to 10.0.1", v3: compiler-clang: add build check for clang 10.0.1 Revert "kbuild: disable clang's default use of -fmerge-all-constants" Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support" Revert "arm64: vdso: Fix compilation with clang older than 8" Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer" Marco Elver <elver@google.com>: kasan: remove mentions of unsupported Clang versions Nick Desaulniers <ndesaulniers@google.com>: compiler-gcc: improve version error compiler.h: avoid escaped section names export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang Lukas Bulwahn <lukas.bulwahn@gmail.com>: kbuild: doc: describe proper script invocation Subsystem: scripts Wang Qing <wangqing@vivo.com>: scripts/spelling.txt: increase error-prone spell checking Naoki Hayama <naoki.hayama@lineo.co.jp>: scripts/spelling.txt: add "arbitrary" typo Borislav Petkov <bp@suse.de>: scripts/decodecode: add the capability to supply the program counter Subsystem: ntfs Rustam Kovhaev <rkovhaev@gmail.com>: ntfs: add check for mft record size in superblock Subsystem: ocfs2 Randy Dunlap <rdunlap@infradead.org>: ocfs2: delete repeated words in comments Gang He <ghe@suse.com>: ocfs2: fix potential soft lockup during fstrim Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr Luo Jiaxing <luojiaxing@huawei.com>: fs_parse: mark fs_param_bad_value() as static Subsystem: mm/slab Mateusz Nosek <mateusznosek0@gmail.com>: mm/slab.c: clean code by removing redundant if condition tangjianqiang <wyqt1985@gmail.com>: include/linux/slab.h: fix a typo error in comment Subsystem: mm/slub Abel Wu <wuyun.wu@huawei.com>: mm/slub.c: branch optimization in free slowpath mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc mm/slub: make add_full() condition more explicit Subsystem: mm/kmemleak Davidlohr Bueso <dave@stgolabs.net>: mm/kmemleak: rely on rcu for task stack scanning Hui Su <sh_def@163.com>: mm,kmemleak-test.c: move kmemleak-test.c to samples dir Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5: x86/numa: cleanup configuration dependent command-line options x86/numa: add 'nohmat' option efi/fake_mem: arrange for a resource entry per efi_fake_mem instance ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device resource: report parent to walk_iomem_res_desc() callback mm/memory_hotplug: introduce default phys_to_target_node() implementation ACPI: HMAT: attach a device for each soft-reserved range device-dax: drop the dax_region.pfn_flags attribute device-dax: move instance creation parameters to 'struct dev_dax_data' device-dax: make pgmap optional for instance creation device-dax/kmem: introduce dax_kmem_range() device-dax/kmem: move resource name tracking to drvdata device-dax/kmem: replace release_resource() with release_mem_region() device-dax: add an allocation interface for device-dax instances device-dax: introduce 'struct dev_dax' typed-driver operations device-dax: introduce 'seed' devices drivers/base: make device_find_child_by_name() compatible with sysfs inputs device-dax: add resize support mm/memremap_pages: convert to 'struct range' mm/memremap_pages: support multiple ranges per invocation device-dax: add dis-contiguous resource support device-dax: introduce 'mapping' devices Joao Martins <joao.m.martins@oracle.com>: device-dax: make align a per-device property Dan Williams <dan.j.williams@intel.com>: device-dax: add an 'align' attribute Joao Martins <joao.m.martins@oracle.com>: dax/hmem: introduce dax_hmem.region_idle parameter device-dax: add a range mapping allocation attribute Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug.c: do not dereference i_ino blindly John Hubbard <jhubbard@nvidia.com>: mm, dump_page: rename head_mapcount() --> head_compound_mapcount() Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Return head pages from find_*_entry", v2: mm: factor find_get_incore_page out of mincore_page mm: use find_get_incore_page in memcontrol mm: optimise madvise WILLNEED proc: optimise smaps for shmem entries i915: use find_lock_page instead of find_lock_entry mm: convert find_get_entry to return the head page mm/shmem: return head page from find_lock_entry mm: add find_lock_head mm/filemap: fix filemap_map_pages for THP Subsystem: mm/fadvise Yafang Shao <laoar.shao@gmail.com>: mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED Subsystem: mm/gup Barry Song <song.bao.hua@hisilicon.com>: mm/gup_benchmark: update the documentation in Kconfig mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM John Hubbard <jhubbard@nvidia.com>: mm/gup: protect unpin_user_pages() against npages==-ERRNO Subsystem: mm/swap Gao Xiang <hsiangkao@redhat.com>: swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity Yu Zhao <yuzhao@google.com>: mm: remove activate_page() from unuse_pte() mm: remove superfluous __ClearPageActive() Miaohe Lin <linmiaohe@huawei.com>: mm/swap.c: fix confusing comment in release_pages() mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache() mm/page_io.c: remove useless out label in __swap_writepage() mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable() mm/swapfile.c: remove unnecessary goto out in _swap_info_get() mm/swapfile.c: fix potential memory leak in sys_swapon Subsystem: mm/memremap Ira Weiny <ira.weiny@intel.com>: mm/memremap.c: convert devmap static branch to {inc,dec} Subsystem: mm/memcg "Gustavo A. R. Silva" <gustavoars@kernel.org>: mm: memcontrol: use flex_array_size() helper in memcpy() mm: memcontrol: use the preferred form for passing the size of a structure type Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj() Miaohe Lin <linmiaohe@huawei.com>: mm: memcontrol: correct the comment of mem_cgroup_iter() Waiman Long <longman@redhat.com>: Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2: mm/memcg: clean up obsolete enum charge_type mm/memcg: simplify mem_cgroup_get_max() mm/memcg: unify swap and memsw page counters Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: add the missing numa_stat interface for cgroup v2 Miaohe Lin <linmiaohe@huawei.com>: mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge() mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom() Bharata B Rao <bharata@linux.ibm.com>: mm: memcg/slab: uncharge during kmem_cache_free_bulk() Ralph Campbell <rcampbell@nvidia.com>: mm/memcg: fix device private memcg accounting Subsystem: mm/selftests John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: fix some minor aggravating factors in the Makefile": selftests/vm: fix false build success on the second and later attempts selftests/vm: fix incorrect gcc invocation in some cases Subsystem: mm/pagemap Matthew Wilcox <willy@infradead.org>: mm: account PMD tables like PTE tables Yanfei Xu <yanfei.xu@windriver.com>: mm/memory.c: fix typo in __do_fault() comment mm/memory.c: replace vmf->vma with variable vma Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: rename __vma_unlink_common() to __vma_unlink() mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase() Chinwen Chang <chinwen.chang@mediatek.com>: Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4: mmap locking API: add mmap_lock_is_contended() mm: smaps*: extend smap_gather_stats to support specified beginning mm: proc: smaps_rollup: do not stall write attempts on mmap_lock "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Fix PageDoubleMap": mm: move PageDoubleMap bit mm: simplify PageDoubleMap with PF_SECOND policy Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: leave adjust_next as virtual address instead of page frame number Randy Dunlap <rdunlap@infradead.org>: mm/memory.c: fix spello of "function" Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mmap: not necessary to check mapping separately mm/mmap: check on file instead of the rb_root_cached of its address_space Miaohe Lin <linmiaohe@huawei.com>: mm: use helper function mapping_allow_writable() mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct() Liao Pingfang <liao.pingfang@zte.com.cn>: mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct() Peter Xu <peterx@redhat.com>: mm: remove src/dst mm parameter in copy_page_range() Subsystem: mm/mincore yuleixzhang <yulei.kernel@gmail.com>: include/linux/huge_mm.h: remove mincore_huge_pmd declaration Subsystem: mm/hmm Ralph Campbell <rcampbell@nvidia.com>: tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro lib/test_hmm.c: remove unused dmirror_zero_page Subsystem: mm/dma Andy Shevchenko <andriy.shevchenko@linux.intel.com>: mm/dmapool.c: replace open-coded list_for_each_entry_safe() mm/dmapool.c: replace hard coded function name with __func__ Subsystem: mm/memory-failure Xianting Tian <tian.xianting@h3c.com>: mm/memory-failure: do pgoff calculation before for_each_process() Alex Shi <alex.shi@linux.alibaba.com>: mm/memory-failure.c: remove unused macro `writeback' Subsystem: mm/vmalloc Hui Su <sh_def@163.com>: mm/vmalloc.c: update the comment in __vmalloc_area_node() mm/vmalloc.c: fix the comment of find_vm_area Subsystem: mm/documentation Alexander Gordeev <agordeev@linux.ibm.com>: docs/vm: fix 'mm_count' vs 'mm_users' counter confusion Subsystem: mm/kasan Patricia Alfonso <trishalfonso@google.com>: Patch series "KASAN-KUnit Integration", v14: kasan/kunit: add KUnit Struct to Current Task KUnit: KASAN Integration KASAN: port KASAN Tests to KUnit KASAN: Testing Documentation David Gow <davidgow@google.com>: mm: kasan: do not panic if both panic_on_warn and kasan_multishot set Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5: mm/page_alloc: tweak comments in has_unmovable_pages() mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate() mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate() mm/page_isolation: cleanup set_migratetype_isolate() virtio-mem: don't special-case ZONE_MOVABLE mm: document semantics of ZONE_MOVABLE Li Xinhai <lixinhai.lxh@gmail.com>: mm, isolation: avoid checking unmovable pages across pageblock boundary Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_alloc.c: clean code by removing unnecessary initialization mm/page_alloc.c: micro-optimization remove unnecessary branch mm/page_alloc.c: fix early params garbage value accesses mm/page_alloc.c: clean code by merging two functions Yanfei Xu <yanfei.xu@windriver.com>: mm/page_alloc.c: __perform_reclaim should return 'unsigned long' Mateusz Nosek <mateusznosek0@gmail.com>: mmzone: clean code by removing unused macro parameter Ralph Campbell <rcampbell@nvidia.com>: mm: move call to compound_head() in release_pages() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/page_alloc.c: fix freeing non-compound pages Michal Hocko <mhocko@suse.com>: include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts Subsystem: mm/hugetlb Baoquan He <bhe@redhat.com>: Patch series "mm/hugetlb: Small cleanup and improvement", v2: mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool mm/hugetlb.c: remove the unnecessary non_swap_entry() doc/vm: fix typo in the hugetlb admin documentation Wei Yang <richard.weiyang@linux.alibaba.com>: Patch series "mm/hugetlb: code refine and simplification", v4: mm/hugetlb: not necessary to coalesce regions recursively mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache() mm/hugetlb: use list_splice to merge two list at once mm/hugetlb: count file_region to be added when regions_needed != NULL mm/hugetlb: a page from buddy is not on any list mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page mm/hugetlb: take the free hpage during the iteration directly Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share Subsystem: mm/vmscan Chunxin Zang <zangchunxin@bytedance.com>: mm/vmscan: fix infinite loop in drop_slab_node Hui Su <sh_def@163.com>: mm/vmscan: fix comments for isolate_lru_page() Subsystem: mm/z3fold Hui Su <sh_def@163.com>: mm/z3fold.c: use xx_zalloc instead xx_alloc and memset Subsystem: mm/zbud Xiang Chen <chenxiang66@hisilicon.com>: mm/zbud: remove redundant initialization Subsystem: mm/compaction Mateusz Nosek <mateusznosek0@gmail.com>: mm/compaction.c: micro-optimization remove unnecessary branch include/linux/compaction.h: clean code by removing unused enum value John Hubbard <jhubbard@nvidia.com>: selftests/vm: 8x compaction_test speedup Subsystem: mm/mempolicy Wei Yang <richard.weiyang@linux.alibaba.com>: mm/mempolicy: remove or narrow the lock on current mm: remove unused alloc_page_vma_node() Subsystem: mm/mempool Miaohe Lin <linmiaohe@huawei.com>: mm/mempool: add 'else' to split mutually exclusive case Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "memblock: seasonal cleaning^w cleanup", v3: KVM: PPC: Book3S HV: simplify kvm_cma_reserve() dma-contiguous: simplify cma_early_percent_memory() arm, xtensa: simplify initialization of high memory pages arm64: numa: simplify dummy_numa_init() h8300, nds32, openrisc: simplify detection of memory extents riscv: drop unneeded node initialization mircoblaze: drop unneeded NUMA and sparsemem initializations memblock: make for_each_memblock_type() iterator private memblock: make memblock_debug and related functionality private memblock: reduce number of parameters in for_each_mem_range() arch, mm: replace for_each_memblock() with for_each_mem_pfn_range() arch, drivers: replace for_each_membock() with for_each_mem_range() x86/setup: simplify initrd relocation and reservation x86/setup: simplify reserve_crashkernel() memblock: remove unused memblock_mem_size() memblock: implement for_each_reserved_mem_region() using __next_mem_region() memblock: use separate iterators for memory and reserved regions Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: remove cpages-- in migrate_vma_finalize() mm/migrate: remove obsolete comment about device public .clang-format | 7 Documentation/admin-guide/cgroup-v2.rst | 69 + Documentation/admin-guide/mm/hugetlbpage.rst | 2 Documentation/dev-tools/kasan.rst | 74 + Documentation/dev-tools/kmemleak.rst | 2 Documentation/kbuild/makefiles.rst | 20 Documentation/vm/active_mm.rst | 2 Documentation/x86/x86_64/boot-options.rst | 4 MAINTAINERS | 2 Makefile | 9 arch/arm/Kconfig | 2 arch/arm/include/asm/tlb.h | 1 arch/arm/kernel/setup.c | 18 arch/arm/mm/init.c | 59 - arch/arm/mm/mmu.c | 39 arch/arm/mm/pmsa-v7.c | 23 arch/arm/mm/pmsa-v8.c | 17 arch/arm/xen/mm.c | 7 arch/arm64/Kconfig | 2 arch/arm64/kernel/machine_kexec_file.c | 6 arch/arm64/kernel/setup.c | 4 arch/arm64/kernel/vdso/Makefile | 7 arch/arm64/mm/init.c | 11 arch/arm64/mm/kasan_init.c | 10 arch/arm64/mm/mmu.c | 11 arch/arm64/mm/numa.c | 15 arch/c6x/kernel/setup.c | 9 arch/h8300/kernel/setup.c | 8 arch/microblaze/mm/init.c | 23 arch/mips/cavium-octeon/dma-octeon.c | 14 arch/mips/kernel/setup.c | 31 arch/mips/netlogic/xlp/setup.c | 2 arch/nds32/kernel/setup.c | 8 arch/openrisc/kernel/setup.c | 9 arch/openrisc/mm/init.c | 8 arch/powerpc/kernel/fadump.c | 61 - arch/powerpc/kexec/file_load_64.c | 16 arch/powerpc/kvm/book3s_hv_builtin.c | 12 arch/powerpc/kvm/book3s_hv_uvmem.c | 14 arch/powerpc/mm/book3s64/hash_utils.c | 16 arch/powerpc/mm/book3s64/radix_pgtable.c | 10 arch/powerpc/mm/kasan/kasan_init_32.c | 8 arch/powerpc/mm/mem.c | 31 arch/powerpc/mm/numa.c | 7 arch/powerpc/mm/pgtable_32.c | 8 arch/riscv/mm/init.c | 36 arch/riscv/mm/kasan_init.c | 10 arch/s390/kernel/setup.c | 27 arch/s390/mm/page-states.c | 6 arch/s390/mm/vmem.c | 7 arch/sh/mm/init.c | 9 arch/sparc/mm/init_64.c | 12 arch/x86/include/asm/numa.h | 8 arch/x86/kernel/e820.c | 16 arch/x86/kernel/setup.c | 56 - arch/x86/mm/numa.c | 13 arch/x86/mm/numa_emulation.c | 3 arch/x86/xen/enlighten_pv.c | 2 arch/xtensa/mm/init.c | 55 - drivers/acpi/numa/hmat.c | 76 - drivers/acpi/numa/srat.c | 9 drivers/base/core.c | 2 drivers/bus/mvebu-mbus.c | 12 drivers/dax/Kconfig | 6 drivers/dax/Makefile | 3 drivers/dax/bus.c | 1237 +++++++++++++++++++++++---- drivers/dax/bus.h | 34 drivers/dax/dax-private.h | 74 + drivers/dax/device.c | 164 +-- drivers/dax/hmem.c | 56 - drivers/dax/hmem/Makefile | 8 drivers/dax/hmem/device.c | 100 ++ drivers/dax/hmem/hmem.c | 93 +- drivers/dax/kmem.c | 236 ++--- drivers/dax/pmem/compat.c | 2 drivers/dax/pmem/core.c | 36 drivers/firmware/efi/x86_fake_mem.c | 12 drivers/gpu/drm/i915/gem/i915_gem_shmem.c | 4 drivers/gpu/drm/nouveau/nouveau_dmem.c | 15 drivers/irqchip/irq-gic-v3-its.c | 2 drivers/nvdimm/badrange.c | 26 drivers/nvdimm/claim.c | 13 drivers/nvdimm/nd.h | 3 drivers/nvdimm/pfn_devs.c | 13 drivers/nvdimm/pmem.c | 27 drivers/nvdimm/region.c | 21 drivers/pci/p2pdma.c | 12 drivers/virtio/virtio_mem.c | 47 - drivers/xen/unpopulated-alloc.c | 45 fs/fs_parser.c | 2 fs/ntfs/inode.c | 6 fs/ocfs2/alloc.c | 6 fs/ocfs2/localalloc.c | 2 fs/proc/base.c | 3 fs/proc/task_mmu.c | 104 +- fs/xattr.c | 22 include/acpi/acpi_numa.h | 14 include/kunit/test.h | 5 include/linux/acpi.h | 2 include/linux/compaction.h | 3 include/linux/compiler-clang.h | 8 include/linux/compiler-gcc.h | 2 include/linux/compiler.h | 2 include/linux/dax.h | 8 include/linux/export.h | 2 include/linux/fs.h | 4 include/linux/gfp.h | 6 include/linux/huge_mm.h | 3 include/linux/kasan.h | 6 include/linux/memblock.h | 90 + include/linux/memcontrol.h | 13 include/linux/memory_hotplug.h | 23 include/linux/memremap.h | 15 include/linux/mm.h | 36 include/linux/mmap_lock.h | 5 include/linux/mmzone.h | 37 include/linux/numa.h | 11 include/linux/oom.h | 1 include/linux/page-flags.h | 42 include/linux/pagemap.h | 43 include/linux/range.h | 6 include/linux/sched.h | 4 include/linux/sched/coredump.h | 1 include/linux/slab.h | 2 include/linux/swap.h | 10 include/linux/swap_slots.h | 2 kernel/dma/contiguous.c | 11 kernel/fork.c | 25 kernel/resource.c | 11 lib/Kconfig.debug | 9 lib/Kconfig.kasan | 31 lib/Makefile | 5 lib/kunit/test.c | 13 lib/test_free_pages.c | 42 lib/test_hmm.c | 65 - lib/test_kasan.c | 732 ++++++--------- lib/test_kasan_module.c | 111 ++ mm/Kconfig | 4 mm/Makefile | 1 mm/compaction.c | 5 mm/debug.c | 18 mm/dmapool.c | 46 - mm/fadvise.c | 9 mm/filemap.c | 78 - mm/gup.c | 44 mm/gup_benchmark.c | 23 mm/huge_memory.c | 4 mm/hugetlb.c | 100 +- mm/internal.h | 3 mm/kasan/report.c | 34 mm/kmemleak-test.c | 99 -- mm/kmemleak.c | 8 mm/madvise.c | 21 mm/memblock.c | 102 -- mm/memcontrol.c | 262 +++-- mm/memory-failure.c | 5 mm/memory.c | 147 +-- mm/memory_hotplug.c | 10 mm/mempolicy.c | 8 mm/mempool.c | 18 mm/memremap.c | 344 ++++--- mm/migrate.c | 3 mm/mincore.c | 28 mm/mmap.c | 45 mm/oom_kill.c | 2 mm/page_alloc.c | 82 - mm/page_counter.c | 2 mm/page_io.c | 14 mm/page_isolation.c | 41 mm/shmem.c | 19 mm/slab.c | 4 mm/slab.h | 50 - mm/slub.c | 33 mm/sparse.c | 10 mm/swap.c | 14 mm/swap_slots.c | 3 mm/swap_state.c | 38 mm/swapfile.c | 12 mm/truncate.c | 58 - mm/vmalloc.c | 6 mm/vmscan.c | 5 mm/z3fold.c | 3 mm/zbud.c | 1 samples/Makefile | 1 samples/kmemleak/Makefile | 3 samples/kmemleak/kmemleak-test.c | 99 ++ scripts/decodecode | 29 scripts/spelling.txt | 4 tools/testing/nvdimm/dax-dev.c | 28 tools/testing/nvdimm/test/iomap.c | 2 tools/testing/selftests/vm/Makefile | 17 tools/testing/selftests/vm/compaction_test.c | 11 tools/testing/selftests/vm/gup_benchmark.c | 14 tools/testing/selftests/vm/hmm-tests.c | 4 194 files changed, 4273 insertions(+), 2777 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 001/181] compiler-clang: add build check for clang 10.0.1 2020-10-13 23:46 incoming Andrew Morton @ 2020-10-13 23:47 ` Andrew Morton 2020-10-13 23:47 ` [patch 002/181] Revert "kbuild: disable clang's default use of -fmerge-all-constants" Andrew Morton ` (179 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:47 UTC (permalink / raw) To: akpm, andreyknvl, ast, daniel, elver, keescook, linux-mm, masahiroy, maskray, miguel.ojeda.sandonis, mm-commits, natechancellor, ndesaulniers, sedat.dilek, torvalds, vincenzo.frascino, will From: Nick Desaulniers <ndesaulniers@google.com> Subject: compiler-clang: add build check for clang 10.0.1 Patch series "set clang minimum version to 10.0.1", v3. Adds a compile time #error to compiler-clang.h setting the effective minimum supported version to clang 10.0.1. A separate patch has already been picked up into the Documentation/ tree also confirming the version. Next are a series of reverts. One for 32b arm is a partial revert. Then Marco suggested fixes to KASAN docs. Finally, improve the warning for GCC too as per Kees. This patch (of 7): During Plumbers 2020, we voted to just support the latest release of Clang for now. Add a compile time check for this. We plan to remove workarounds for older versions now, which will break in subtle and not so subtle ways. Link: https://lkml.kernel.org/r/20200902225911.209899-1-ndesaulniers@google.com Link: https://lkml.kernel.org/r/20200902225911.209899-2-ndesaulniers@google.com Link: https://github.com/ClangBuiltLinux/linux/issues/9 Link: https://github.com/ClangBuiltLinux/linux/issues/941 Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Suggested-by: Sedat Dilek <sedat.dilek@gmail.com> Suggested-by: Nathan Chancellor <natechancellor@gmail.com> Suggested-by: Kees Cook <keescook@chromium.org> Tested-by: Sedat Dilek <sedat.dilek@gmail.com> Reviewed-by: Kees Cook <keescook@chromium.org> Reviewed-by: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Reviewed-by: Sedat Dilek <sedat.dilek@gmail.com> Acked-by: Marco Elver <elver@google.com> Acked-by: Nathan Chancellor <natechancellor@gmail.com> Acked-by: Sedat Dilek <sedat.dilek@gmail.com> Cc: Andrey Konovalov <andreyknvl@google.com> Cc: Fangrui Song <maskray@google.com> Cc: Masahiro Yamada <masahiroy@kernel.org> Cc: Daniel Borkmann <daniel@iogearbox.net> Cc: Alexei Starovoitov <ast@kernel.org> Cc: Will Deacon <will@kernel.org> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/compiler-clang.h | 8 ++++++++ 1 file changed, 8 insertions(+) --- a/include/linux/compiler-clang.h~compiler-clang-add-build-check-for-clang-1001 +++ a/include/linux/compiler-clang.h @@ -3,6 +3,14 @@ #error "Please don't include <linux/compiler-clang.h> directly, include <linux/compiler.h> instead." #endif +#define CLANG_VERSION (__clang_major__ * 10000 \ + + __clang_minor__ * 100 \ + + __clang_patchlevel__) + +#if CLANG_VERSION < 100001 +# error Sorry, your version of Clang is too old - please use 10.0.1 or newer. +#endif + /* Compiler specific definitions for Clang compiler */ /* same as gcc, this was present in clang-2.6 so we can assume it works _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 002/181] Revert "kbuild: disable clang's default use of -fmerge-all-constants" 2020-10-13 23:46 incoming Andrew Morton 2020-10-13 23:47 ` [patch 001/181] compiler-clang: add build check for clang 10.0.1 Andrew Morton @ 2020-10-13 23:47 ` Andrew Morton 2020-10-13 23:47 ` [patch 003/181] Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support" Andrew Morton ` (178 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:47 UTC (permalink / raw) To: akpm, andreyknvl, ast, daniel, elver, keescook, linux-mm, masahiroy, maskray, miguel.ojeda.sandonis, mm-commits, natechancellor, ndesaulniers, sedat.dilek, torvalds, vincenzo.frascino, will From: Nick Desaulniers <ndesaulniers@google.com> Subject: Revert "kbuild: disable clang's default use of -fmerge-all-constants" This reverts commit 87e0d4f0f37fb0c8c4aeeac46fff5e957738df79. -fno-merge-all-constants has been the default since clang-6; the minimum supported version of clang in the kernel is clang-10 (10.0.1). Link: https://lkml.kernel.org/r/20200902225911.209899-3-ndesaulniers@google.com Link: https://reviews.llvm.org/rL329300. Link: https://github.com/ClangBuiltLinux/linux/issues/9 Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Suggested-by: Nathan Chancellor <natechancellor@gmail.com> Tested-by: Sedat Dilek <sedat.dilek@gmail.com> Reviewed-by: Fangrui Song <maskray@google.com> Reviewed-by: Nathan Chancellor <natechancellor@gmail.com> Reviewed-by: Sedat Dilek <sedat.dilek@gmail.com> Reviewed-by: Kees Cook <keescook@chromium.org> Cc: Andrey Konovalov <andreyknvl@google.com> Cc: Marco Elver <elver@google.com> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Alexei Starovoitov <ast@kernel.org> Cc: Daniel Borkmann <daniel@iogearbox.net> Cc: Masahiro Yamada <masahiroy@kernel.org> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Makefile | 9 --------- 1 file changed, 9 deletions(-) --- a/Makefile~revert-kbuild-disable-clangs-default-use-of-fmerge-all-constants +++ a/Makefile @@ -921,15 +921,6 @@ KBUILD_CFLAGS += $(call cc-disable-warni # disable invalid "can't wrap" optimizations for signed / pointers KBUILD_CFLAGS += $(call cc-option,-fno-strict-overflow) -# clang sets -fmerge-all-constants by default as optimization, but this -# is non-conforming behavior for C and in fact breaks the kernel, so we -# need to disable it here generally. -KBUILD_CFLAGS += $(call cc-option,-fno-merge-all-constants) - -# for gcc -fno-merge-all-constants disables everything, but it is fine -# to have actual conforming behavior enabled. -KBUILD_CFLAGS += $(call cc-option,-fmerge-constants) - # Make sure -fstack-check isn't enabled (like gentoo apparently did) KBUILD_CFLAGS += $(call cc-option,-fno-stack-check,) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 003/181] Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support" 2020-10-13 23:46 incoming Andrew Morton 2020-10-13 23:47 ` [patch 001/181] compiler-clang: add build check for clang 10.0.1 Andrew Morton 2020-10-13 23:47 ` [patch 002/181] Revert "kbuild: disable clang's default use of -fmerge-all-constants" Andrew Morton @ 2020-10-13 23:47 ` Andrew Morton 2020-10-13 23:47 ` [patch 004/181] Revert "arm64: vdso: Fix compilation with clang older than 8" Andrew Morton ` (177 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:47 UTC (permalink / raw) To: akpm, andreyknvl, ast, daniel, elver, keescook, linux-mm, masahiroy, maskray, miguel.ojeda.sandonis, mm-commits, natechancellor, ndesaulniers, sedat.dilek, torvalds, vincenzo.frascino, will From: Nick Desaulniers <ndesaulniers@google.com> Subject: Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support" This reverts commit b9249cba25a5dce5de87e5404503a5e11832c2dd. The minimum supported version of clang is now 10.0.1. Link: https://lkml.kernel.org/r/20200902225911.209899-4-ndesaulniers@google.com Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Suggested-by: Nathan Chancellor <natechancellor@gmail.com> Reviewed-by: Kees Cook <keescook@chromium.org> Reviewed-by: Nathan Chancellor <natechancellor@gmail.com> Cc: Andrey Konovalov <andreyknvl@google.com> Cc: Fangrui Song <maskray@google.com> Cc: Marco Elver <elver@google.com> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Sedat Dilek <sedat.dilek@gmail.com> Cc: Alexei Starovoitov <ast@kernel.org> Cc: Daniel Borkmann <daniel@iogearbox.net> Cc: Masahiro Yamada <masahiroy@kernel.org> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/Kconfig | 2 -- 1 file changed, 2 deletions(-) --- a/arch/arm64/Kconfig~revert-arm64-bti-require-clang-=-1001-for-in-kernel-bti-support +++ a/arch/arm64/Kconfig @@ -1612,8 +1612,6 @@ config ARM64_BTI_KERNEL depends on CC_HAS_BRANCH_PROT_PAC_RET_BTI # https://gcc.gnu.org/bugzilla/show_bug.cgi?id=94697 depends on !CC_IS_GCC || GCC_VERSION >= 100100 - # https://reviews.llvm.org/rGb8ae3fdfa579dbf366b1bb1cbfdbf8c51db7fa55 - depends on !CC_IS_CLANG || CLANG_VERSION >= 100001 depends on !(CC_IS_CLANG && GCOV_KERNEL) depends on (!FUNCTION_GRAPH_TRACER || DYNAMIC_FTRACE_WITH_REGS) help _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 004/181] Revert "arm64: vdso: Fix compilation with clang older than 8" 2020-10-13 23:46 incoming Andrew Morton ` (2 preceding siblings ...) 2020-10-13 23:47 ` [patch 003/181] Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support" Andrew Morton @ 2020-10-13 23:47 ` Andrew Morton 2020-10-13 23:47 ` [patch 005/181] Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer" Andrew Morton ` (176 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:47 UTC (permalink / raw) To: akpm, andreyknvl, ast, daniel, elver, keescook, linux-mm, masahiroy, maskray, miguel.ojeda.sandonis, mm-commits, natechancellor, ndesaulniers, sedat.dilek, torvalds, vincenzo.frascino, will From: Nick Desaulniers <ndesaulniers@google.com> Subject: Revert "arm64: vdso: Fix compilation with clang older than 8" This reverts commit 3acf4be235280f14d838581a750532219d67facc. The minimum supported version of clang is clang 10.0.1. Link: https://lkml.kernel.org/r/20200902225911.209899-5-ndesaulniers@google.com Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Suggested-by: Nathan Chancellor <natechancellor@gmail.com> Reviewed-by: Kees Cook <keescook@chromium.org> Reviewed-by: Nathan Chancellor <natechancellor@gmail.com> Cc: Andrey Konovalov <andreyknvl@google.com> Cc: Fangrui Song <maskray@google.com> Cc: Marco Elver <elver@google.com> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Sedat Dilek <sedat.dilek@gmail.com> Cc: Alexei Starovoitov <ast@kernel.org> Cc: Daniel Borkmann <daniel@iogearbox.net> Cc: Masahiro Yamada <masahiroy@kernel.org> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/kernel/vdso/Makefile | 7 ------- 1 file changed, 7 deletions(-) --- a/arch/arm64/kernel/vdso/Makefile~revert-arm64-vdso-fix-compilation-with-clang-older-than-8 +++ a/arch/arm64/kernel/vdso/Makefile @@ -43,13 +43,6 @@ ifneq ($(c-gettimeofday-y),) CFLAGS_vgettimeofday.o += -include $(c-gettimeofday-y) endif -# Clang versions less than 8 do not support -mcmodel=tiny -ifeq ($(CONFIG_CC_IS_CLANG), y) - ifeq ($(shell test $(CONFIG_CLANG_VERSION) -lt 80000; echo $$?),0) - CFLAGS_REMOVE_vgettimeofday.o += -mcmodel=tiny - endif -endif - # Disable gcov profiling for VDSO code GCOV_PROFILE := n _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 005/181] Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer" 2020-10-13 23:46 incoming Andrew Morton ` (3 preceding siblings ...) 2020-10-13 23:47 ` [patch 004/181] Revert "arm64: vdso: Fix compilation with clang older than 8" Andrew Morton @ 2020-10-13 23:47 ` Andrew Morton 2020-10-13 23:47 ` [patch 006/181] kasan: remove mentions of unsupported Clang versions Andrew Morton ` (175 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:47 UTC (permalink / raw) To: akpm, andreyknvl, ast, daniel, elver, keescook, linux-mm, masahiroy, maskray, miguel.ojeda.sandonis, mm-commits, natechancellor, ndesaulniers, sedat.dilek, torvalds, vincenzo.frascino, will From: Nick Desaulniers <ndesaulniers@google.com> Subject: Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer" This partially reverts commit b0fe66cf095016e0b238374c10ae366e1f087d11. The minimum supported version of clang is now clang 10.0.1. We still want to pass -meabi=gnu. Link: https://lkml.kernel.org/r/20200902225911.209899-6-ndesaulniers@google.com Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Suggested-by: Nathan Chancellor <natechancellor@gmail.com> Reviewed-by: Kees Cook <keescook@chromium.org> Reviewed-by: Nathan Chancellor <natechancellor@gmail.com> Cc: Andrey Konovalov <andreyknvl@google.com> Cc: Fangrui Song <maskray@google.com> Cc: Marco Elver <elver@google.com> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Sedat Dilek <sedat.dilek@gmail.com> Cc: Alexei Starovoitov <ast@kernel.org> Cc: Daniel Borkmann <daniel@iogearbox.net> Cc: Masahiro Yamada <masahiroy@kernel.org> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm/Kconfig | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/arch/arm/Kconfig~partially-revert-arm-8905-1-emit-__gnu_mcount_nc-when-using-clang-1000-or-newer +++ a/arch/arm/Kconfig @@ -84,7 +84,7 @@ config ARM select HAVE_FAST_GUP if ARM_LPAE select HAVE_FTRACE_MCOUNT_RECORD if !XIP_KERNEL select HAVE_FUNCTION_GRAPH_TRACER if !THUMB2_KERNEL && !CC_IS_CLANG - select HAVE_FUNCTION_TRACER if !XIP_KERNEL && (CC_IS_GCC || CLANG_VERSION >= 100000) + select HAVE_FUNCTION_TRACER if !XIP_KERNEL select HAVE_GCC_PLUGINS select HAVE_HW_BREAKPOINT if PERF_EVENTS && (CPU_V6 || CPU_V6K || CPU_V7) select HAVE_IDE if PCI || ISA || PCMCIA _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 006/181] kasan: remove mentions of unsupported Clang versions 2020-10-13 23:46 incoming Andrew Morton ` (4 preceding siblings ...) 2020-10-13 23:47 ` [patch 005/181] Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer" Andrew Morton @ 2020-10-13 23:47 ` Andrew Morton 2020-10-13 23:47 ` [patch 007/181] compiler-gcc: improve version error Andrew Morton ` (174 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:47 UTC (permalink / raw) To: akpm, andreyknvl, ast, daniel, elver, keescook, linux-mm, masahiroy, maskray, miguel.ojeda.sandonis, mm-commits, natechancellor, ndesaulniers, sedat.dilek, torvalds, vincenzo.frascino, will From: Marco Elver <elver@google.com> Subject: kasan: remove mentions of unsupported Clang versions Since the kernel now requires at least Clang 10.0.1, remove any mention of old Clang versions and simplify the documentation. Link: https://lkml.kernel.org/r/20200902225911.209899-7-ndesaulniers@google.com Signed-off-by: Marco Elver <elver@google.com> Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Reviewed-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Kees Cook <keescook@chromium.org> Reviewed-by: Nathan Chancellor <natechancellor@gmail.com> Cc: Fangrui Song <maskray@google.com> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Sedat Dilek <sedat.dilek@gmail.com> Cc: Alexei Starovoitov <ast@kernel.org> Cc: Daniel Borkmann <daniel@iogearbox.net> Cc: Masahiro Yamada <masahiroy@kernel.org> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/dev-tools/kasan.rst | 4 ++-- lib/Kconfig.kasan | 9 ++++----- 2 files changed, 6 insertions(+), 7 deletions(-) --- a/Documentation/dev-tools/kasan.rst~kasan-remove-mentions-of-unsupported-clang-versions +++ a/Documentation/dev-tools/kasan.rst @@ -13,10 +13,10 @@ KASAN uses compile-time instrumentation memory access, and therefore requires a compiler version that supports that. Generic KASAN is supported in both GCC and Clang. With GCC it requires version -8.3.0 or later. With Clang it requires version 7.0.0 or later, but detection of +8.3.0 or later. Any supported Clang version is compatible, but detection of out-of-bounds accesses for global variables is only supported since Clang 11. -Tag-based KASAN is only supported in Clang and requires version 7.0.0 or later. +Tag-based KASAN is only supported in Clang. Currently generic KASAN is supported for the x86_64, arm64, xtensa, s390 and riscv architectures, and tag-based KASAN is supported only for arm64. --- a/lib/Kconfig.kasan~kasan-remove-mentions-of-unsupported-clang-versions +++ a/lib/Kconfig.kasan @@ -54,9 +54,9 @@ config KASAN_GENERIC Enables generic KASAN mode. This mode is supported in both GCC and Clang. With GCC it requires - version 8.3.0 or later. With Clang it requires version 7.0.0 or - later, but detection of out-of-bounds accesses for global variables - is supported only since Clang 11. + version 8.3.0 or later. Any supported Clang version is compatible, + but detection of out-of-bounds accesses for global variables is + supported only since Clang 11. This mode consumes about 1/8th of available memory at kernel start and introduces an overhead of ~x1.5 for the rest of the allocations. @@ -78,8 +78,7 @@ config KASAN_SW_TAGS Enables software tag-based KASAN mode. This mode requires Top Byte Ignore support by the CPU and therefore - is only supported for arm64. This mode requires Clang version 7.0.0 - or later. + is only supported for arm64. This mode requires Clang. This mode consumes about 1/16th of available memory at kernel start and introduces an overhead of ~20% for the rest of the allocations. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 007/181] compiler-gcc: improve version error 2020-10-13 23:46 incoming Andrew Morton ` (5 preceding siblings ...) 2020-10-13 23:47 ` [patch 006/181] kasan: remove mentions of unsupported Clang versions Andrew Morton @ 2020-10-13 23:47 ` Andrew Morton 2020-10-13 23:47 ` [patch 008/181] compiler.h: avoid escaped section names Andrew Morton ` (173 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:47 UTC (permalink / raw) To: akpm, andreyknvl, ast, daniel, elver, keescook, linux-mm, masahiroy, maskray, miguel.ojeda.sandonis, mm-commits, natechancellor, ndesaulniers, sedat.dilek, torvalds, vincenzo.frascino, will From: Nick Desaulniers <ndesaulniers@google.com> Subject: compiler-gcc: improve version error As Kees suggests, doing so provides developers with two useful pieces of information: - The kernel build was attempting to use GCC. (Maybe they accidentally poked the wrong configs in a CI.) - They need 4.9 or better. ("Upgrade to what version?" doesn't need to be dug out of documentation, headers, etc.) Link: https://lkml.kernel.org/r/20200902225911.209899-8-ndesaulniers@google.com Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Reviewed-by: Kees Cook <keescook@chromium.org> Reviewed-by: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Reviewed-by: Nathan Chancellor <natechancellor@gmail.com> Reviewed-by: Sedat Dilek <sedat.dilek@gmail.com> Suggested-by: Kees Cook <keescook@chromium.org> Tested-by: Sedat Dilek <sedat.dilek@gmail.com> Cc: Andrey Konovalov <andreyknvl@google.com> Cc: Fangrui Song <maskray@google.com> Cc: Marco Elver <elver@google.com> Cc: Alexei Starovoitov <ast@kernel.org> Cc: Daniel Borkmann <daniel@iogearbox.net> Cc: Masahiro Yamada <masahiroy@kernel.org> Cc: Vincenzo Frascino <vincenzo.frascino@arm.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/compiler-gcc.h | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/include/linux/compiler-gcc.h~compiler-gcc-improve-version-error +++ a/include/linux/compiler-gcc.h @@ -12,7 +12,7 @@ /* https://gcc.gnu.org/bugzilla/show_bug.cgi?id=58145 */ #if GCC_VERSION < 40900 -# error Sorry, your compiler is too old - please upgrade it. +# error Sorry, your version of GCC is too old - please use 4.9 or newer. #endif /* Optimization barrier */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 008/181] compiler.h: avoid escaped section names 2020-10-13 23:46 incoming Andrew Morton ` (6 preceding siblings ...) 2020-10-13 23:47 ` [patch 007/181] compiler-gcc: improve version error Andrew Morton @ 2020-10-13 23:47 ` Andrew Morton 2020-10-13 23:48 ` [patch 009/181] export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang Andrew Morton ` (172 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:47 UTC (permalink / raw) To: akpm, linux-mm, luc.vanoostenryck, miguel.ojeda.sandonis, mm-commits, natechancellor, ndesaulniers, nivedita, torvalds From: Nick Desaulniers <ndesaulniers@google.com> Subject: compiler.h: avoid escaped section names The stringification operator, `#`, in the preprocessor escapes strings. For example, `# "foo"` becomes `"\"foo\""`. GCC and Clang differ in how they treat section names that contain \". The portable solution is to not use a string literal with the preprocessor stringification operator. In this case, since __section unconditionally uses the stringification operator, we actually want the more verbose __attribute__((__section__())). Link: https://bugs.llvm.org/show_bug.cgi?id=42950 Link: https://lkml.kernel.org/r/20200929194318.548707-1-ndesaulniers@google.com Fixes: commit e04462fb82f8 ("Compiler Attributes: remove uses of __attribute__ from compiler.h") Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Luc Van Oostenryck <luc.vanoostenryck@gmail.com> Cc: Nathan Chancellor <natechancellor@gmail.com> Cc: Arvind Sankar <nivedita@alum.mit.edu> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/compiler.h | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/include/linux/compiler.h~compilerh-avoid-escaped-section-names +++ a/include/linux/compiler.h @@ -155,7 +155,7 @@ void ftrace_likely_update(struct ftrace_ extern typeof(sym) sym; \ static const unsigned long __kentry_##sym \ __used \ - __section("___kentry" "+" #sym ) \ + __attribute__((__section__("___kentry+" #sym))) \ = (unsigned long)&sym; #endif _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 009/181] export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang 2020-10-13 23:46 incoming Andrew Morton ` (7 preceding siblings ...) 2020-10-13 23:47 ` [patch 008/181] compiler.h: avoid escaped section names Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 010/181] kbuild: doc: describe proper script invocation Andrew Morton ` (171 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, gregkh, jeyu, keescook, linux-mm, lkp, maennich, mm-commits, natechancellor, ndesaulniers, torvalds, will, yamada.masahiro From: Nick Desaulniers <ndesaulniers@google.com> Subject: export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang When enabling CONFIG_TRIM_UNUSED_KSYMS, the linker will warn about the orphan sections: (".discard.ksym") is being placed in '".discard.ksym"' repeatedly when linking vmlinux. This is because the stringification operator, `#`, in the preprocessor escapes strings. GCC and Clang differ in how they treat section names that contain \". The portable solution is to not use a string literal with the preprocessor stringification operator. Link: https://bugs.llvm.org/show_bug.cgi?id=42950 Link: https://github.com/ClangBuiltLinux/linux/issues/1166 Link: https://lkml.kernel.org/r/20200929190701.398762-1-ndesaulniers@google.com Fixes: commit bbda5ec671d3 ("kbuild: simplify dependency generation for CONFIG_TRIM_UNUSED_KSYMS") Signed-off-by: Nick Desaulniers <ndesaulniers@google.com> Reported-by: kbuild test robot <lkp@intel.com> Suggested-by: Kees Cook <keescook@chromium.org> Reviewed-by: Kees Cook <keescook@chromium.org> Cc: Nathan Chancellor <natechancellor@gmail.com> Cc: Masahiro Yamada <yamada.masahiro@socionext.com> Cc: Matthias Maennich <maennich@google.com> Cc: Jessica Yu <jeyu@kernel.org> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/export.h | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/include/linux/export.h~exporth-fix-section-name-for-config_trim_unused_ksyms-for-clang +++ a/include/linux/export.h @@ -130,7 +130,7 @@ struct kernel_symbol { * discarded in the final link stage. */ #define __ksym_marker(sym) \ - static int __ksym_marker_##sym[0] __section(".discard.ksym") __used + static int __ksym_marker_##sym[0] __section(.discard.ksym) __used #define __EXPORT_SYMBOL(sym, sec, ns) \ __ksym_marker(sym); \ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 010/181] kbuild: doc: describe proper script invocation 2020-10-13 23:46 incoming Andrew Morton ` (8 preceding siblings ...) 2020-10-13 23:48 ` [patch 009/181] export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 011/181] scripts/spelling.txt: increase error-prone spell checking Andrew Morton ` (170 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, corbet, keescook, linux-mm, lukas.bulwahn, masahiroy, michal.lkml, mm-commits, torvalds, ujjwalkumar0501 From: Lukas Bulwahn <lukas.bulwahn@gmail.com> Subject: kbuild: doc: describe proper script invocation During an investigation to fix up the execute bits of scripts in the kernel repository, Andrew Morton and Kees Cook pointed out that the execute bit should not matter, and that build scripts cannot rely on that. Kees could not point to any documentation, though. Masahiro Yamada explained the convention of setting execute bits to make it easier for manual script invocation. Provide some basic documentation how the build shall invoke scripts, such that the execute bits do not matter, and acknowledge that execute bits are useful nonetheless. This serves as reference for further clean-up patches in the future. Link: https://lore.kernel.org/lkml/20200830174409.c24c3f67addcce0cea9a9d4c@linux-foundation.org/ Link: https://lore.kernel.org/lkml/202008271102.FEB906C88@keescook/ Link: https://lore.kernel.org/linux-kbuild/CAK7LNAQdrvMkDA6ApDJCGr+5db8SiPo=G+p8EiOvnnGvEN80gA@mail.gmail.com/ Link: https://lkml.kernel.org/r/20201001075723.24246-1-lukas.bulwahn@gmail.com Signed-off-by: Lukas Bulwahn <lukas.bulwahn@gmail.com> Suggested-by: Andrew Morton <akpm@linux-foundation.org> Suggested-by: Kees Cook <keescook@chromium.org> Cc: Masahiro Yamada <masahiroy@kernel.org> Cc: Michal Marek <michal.lkml@markovi.net> Cc: Jonathan Corbet <corbet@lwn.net> Cc: Ujjwal Kumar <ujjwalkumar0501@gmail.com> Cc: Lukas Bulwahn <lukas.bulwahn@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/kbuild/makefiles.rst | 20 ++++++++++++++++++++ 1 file changed, 20 insertions(+) --- a/Documentation/kbuild/makefiles.rst~kbuild-doc-describe-proper-script-invocation +++ a/Documentation/kbuild/makefiles.rst @@ -21,6 +21,7 @@ This document describes the Linux kernel --- 3.10 Special Rules --- 3.11 $(CC) support functions --- 3.12 $(LD) support functions + --- 3.13 Script Invocation === 4 Host Program support --- 4.1 Simple Host Program @@ -605,6 +606,25 @@ more details, with real examples. #Makefile LDFLAGS_vmlinux += $(call ld-option, -X) +3.13 Script invocation +---------------------- + + Make rules may invoke scripts to build the kernel. The rules shall + always provide the appropriate interpreter to execute the script. They + shall not rely on the execute bits being set, and shall not invoke the + script directly. For the convenience of manual script invocation, such + as invoking ./scripts/checkpatch.pl, it is recommended to set execute + bits on the scripts nonetheless. + + Kbuild provides variables $(CONFIG_SHELL), $(AWK), $(PERL), + $(PYTHON) and $(PYTHON3) to refer to interpreters for the respective + scripts. + + Example:: + + #Makefile + cmd_depmod = $(CONFIG_SHELL) $(srctree)/scripts/depmod.sh $(DEPMOD) \ + $(KERNELRELEASE) 4 Host Program support ====================== _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 011/181] scripts/spelling.txt: increase error-prone spell checking 2020-10-13 23:46 incoming Andrew Morton ` (9 preceding siblings ...) 2020-10-13 23:48 ` [patch 010/181] kbuild: doc: describe proper script invocation Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 012/181] scripts/spelling.txt: add "arbitrary" typo Andrew Morton ` (169 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, colin.king, j.neuschaefer, joe, linux-mm, luca, mm-commits, sjpark, torvalds, wangqing, xndchn From: Wang Qing <wangqing@vivo.com> Subject: scripts/spelling.txt: increase error-prone spell checking Increase direcly,ununsed,manger spelling error check Link: https://lkml.kernel.org/r/1601085397-27586-1-git-send-email-wangqing@vivo.com Signed-off-by: Wang Qing <wangqing@vivo.com> Cc: Colin Ian King <colin.king@canonical.com> Cc: Wang Qing <wangqing@vivo.com> Cc: Xiong <xndchn@gmail.com> Cc: SeongJae Park <sjpark@amazon.de> Cc: Jonathan Neuschfer <j.neuschaefer@gmx.net> Cc: Luca Ceresoli <luca@lucaceresoli.net> Cc: Joe Perches <joe@perches.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- scripts/spelling.txt | 3 +++ 1 file changed, 3 insertions(+) --- a/scripts/spelling.txt~increase-error-prone-spell-checking +++ a/scripts/spelling.txt @@ -482,6 +482,7 @@ disgest||digest dispalying||displaying diplay||display directon||direction +direcly||directly direectly||directly diregard||disregard disassocation||disassociation @@ -871,6 +872,7 @@ malplace||misplace managable||manageable managment||management mangement||management +manger||manager manoeuvering||maneuvering manufaucturing||manufacturing mappping||mapping @@ -1478,6 +1480,7 @@ unsolicitied||unsolicited unsuccessfull||unsuccessful unsuported||unsupported untill||until +ununsed||unused unuseful||useless unvalid||invalid upate||update _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 012/181] scripts/spelling.txt: add "arbitrary" typo 2020-10-13 23:46 incoming Andrew Morton ` (10 preceding siblings ...) 2020-10-13 23:48 ` [patch 011/181] scripts/spelling.txt: increase error-prone spell checking Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 013/181] scripts/decodecode: add the capability to supply the program counter Andrew Morton ` (168 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, apw, colin.king, joe, linux-mm, mm-commits, naoki.hayama, torvalds From: Naoki Hayama <naoki.hayama@lineo.co.jp> Subject: scripts/spelling.txt: add "arbitrary" typo Add "abitrary||arbitrary". Link: https://lkml.kernel.org/r/6bf6520d-787d-5749-09b5-ff92185f501f@lineo.co.jp Signed-off-by: Naoki Hayama <naoki.hayama@lineo.co.jp> Cc: Colin Ian King <colin.king@canonical.com> Cc: Andy Whitcroft <apw@canonical.com> Cc: Joe Perches <joe@perches.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- scripts/spelling.txt | 1 + 1 file changed, 1 insertion(+) --- a/scripts/spelling.txt~scripts-spellingtxt-add-arbitrary-typo +++ a/scripts/spelling.txt @@ -9,6 +9,7 @@ # abandonning||abandoning abigious||ambiguous +abitrary||arbitrary abitrate||arbitrate abnornally||abnormally abnrormal||abnormal _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 013/181] scripts/decodecode: add the capability to supply the program counter 2020-10-13 23:46 incoming Andrew Morton ` (11 preceding siblings ...) 2020-10-13 23:48 ` [patch 012/181] scripts/spelling.txt: add "arbitrary" typo Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 014/181] ntfs: add check for mft record size in superblock Andrew Morton ` (167 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, bp, linux-mm, maz, mm-commits, rabin, torvalds, will From: Borislav Petkov <bp@suse.de> Subject: scripts/decodecode: add the capability to supply the program counter So that comparing with objdump output from vmlinux can ease pinpointing where the trapping instruction actually is. An example is better than a thousand words: $ PC=0xffffffff8329a927 ./scripts/decodecode < ~/tmp/syz/gfs2.splat [ 477.379104][T23917] Code: 48 83 ec 28 48 89 3c 24 48 89 54 24 08 e8 c1 b4 4a fe 48 8d bb 00 01 00 00 48 b8 00 00 00 00 00 fc ff df 48 89 fa 48 c1 ea 03 <80> 3c 02 00 0f 85 97 05 00 00 48 8b 9b 00 01 00 00 48 85 db 0f 84 All code ======== ffffffff8329a8fd: 48 83 ec 28 sub $0x28,%rsp ffffffff8329a901: 48 89 3c 24 mov %rdi,(%rsp) ffffffff8329a905: 48 89 54 24 08 mov %rdx,0x8(%rsp) ffffffff8329a90a: e8 c1 b4 4a fe callq 0xffffffff81745dd0 ffffffff8329a90f: 48 8d bb 00 01 00 00 lea 0x100(%rbx),%rdi ffffffff8329a916: 48 b8 00 00 00 00 00 movabs $0xdffffc0000000000,%rax ffffffff8329a91d: fc ff df ffffffff8329a920: 48 89 fa mov %rdi,%rdx ffffffff8329a923: 48 c1 ea 03 shr $0x3,%rdx ffffffff8329a927:* 80 3c 02 00 cmpb $0x0,(%rdx,%rax,1) <-- trapping instruction ffffffff8329a92b: 0f 85 97 05 00 00 jne 0xffffffff8329aec8 ffffffff8329a931: 48 8b 9b 00 01 00 00 mov 0x100(%rbx),%rbx ffffffff8329a938: 48 85 db test %rbx,%rbx ffffffff8329a93b: 0f .byte 0xf ffffffff8329a93c: 84 .byte 0x84 Link: https://lkml.kernel.org/r/20200930111416.GF6810@zn.tnic Link: https://lkml.kernel.org/r/20200929113238.GC21110@zn.tnic Signed-off-by: Borislav Petkov <bp@suse.de> Cc: Marc Zyngier <maz@misterjones.org> Cc: Will Deacon <will@kernel.org> Cc: Rabin Vincent <rabin@rab.in> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- scripts/decodecode | 29 ++++++++++++++++++++++------- 1 file changed, 22 insertions(+), 7 deletions(-) --- a/scripts/decodecode~scripts-decodecode-add-the-capability-to-supply-the-program-counter +++ a/scripts/decodecode @@ -6,6 +6,7 @@ # options: set env. variable AFLAGS=options to pass options to "as"; # e.g., to decode an i386 oops on an x86_64 system, use: # AFLAGS=--32 decodecode < 386.oops +# PC=hex - the PC (program counter) the oops points to cleanup() { rm -f $T $T.s $T.o $T.oo $T.aa $T.dis @@ -67,15 +68,19 @@ if [ -z "$ARCH" ]; then esac fi +# Params: (tmp_file, pc_sub) disas() { - ${CROSS_COMPILE}as $AFLAGS -o $1.o $1.s > /dev/null 2>&1 + t=$1 + pc_sub=$2 + + ${CROSS_COMPILE}as $AFLAGS -o $t.o $t.s > /dev/null 2>&1 if [ "$ARCH" = "arm" ]; then if [ $width -eq 2 ]; then OBJDUMPFLAGS="-M force-thumb" fi - ${CROSS_COMPILE}strip $1.o + ${CROSS_COMPILE}strip $t.o fi if [ "$ARCH" = "arm64" ]; then @@ -83,11 +88,18 @@ disas() { type=inst fi - ${CROSS_COMPILE}strip $1.o + ${CROSS_COMPILE}strip $t.o fi - ${CROSS_COMPILE}objdump $OBJDUMPFLAGS -S $1.o | \ - grep -v "/tmp\|Disassembly\|\.text\|^$" > $1.dis 2>&1 + if [ $pc_sub -ne 0 ]; then + if [ $PC ]; then + adj_vma=$(( $PC - $pc_sub )) + OBJDUMPFLAGS="$OBJDUMPFLAGS --adjust-vma=$adj_vma" + fi + fi + + ${CROSS_COMPILE}objdump $OBJDUMPFLAGS -S $t.o | \ + grep -v "/tmp\|Disassembly\|\.text\|^$" > $t.dis 2>&1 } marker=`expr index "$code" "\<"` @@ -95,14 +107,17 @@ if [ $marker -eq 0 ]; then marker=`expr index "$code" "\("` fi + touch $T.oo if [ $marker -ne 0 ]; then + # 2 opcode bytes and a single space + pc_sub=$(( $marker / 3 )) echo All code >> $T.oo echo ======== >> $T.oo beforemark=`echo "$code"` echo -n " .$type 0x" > $T.s echo $beforemark | sed -e 's/ /,0x/g; s/[<>()]//g' >> $T.s - disas $T + disas $T $pc_sub cat $T.dis >> $T.oo rm -f $T.o $T.s $T.dis @@ -114,7 +129,7 @@ echo =================================== code=`echo $code | sed -e 's/ [<(]/ /;s/[>)] / /;s/ /,0x/g; s/[>)]$//'` echo -n " .$type 0x" > $T.s echo $code >> $T.s -disas $T +disas $T 0 cat $T.dis >> $T.aa # (lines of whole $T.oo) - (lines of $T.aa, i.e. "Code starting") + 3, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 014/181] ntfs: add check for mft record size in superblock 2020-10-13 23:46 incoming Andrew Morton ` (12 preceding siblings ...) 2020-10-13 23:48 ` [patch 013/181] scripts/decodecode: add the capability to supply the program counter Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 015/181] ocfs2: delete repeated words in comments Andrew Morton ` (166 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, anton, linux-mm, mm-commits, rkovhaev, torvalds From: Rustam Kovhaev <rkovhaev@gmail.com> Subject: ntfs: add check for mft record size in superblock Number of bytes allocated for mft record should be equal to the mft record size stored in ntfs superblock as reported by syzbot, userspace might trigger out-of-bounds read by dereferencing ctx->attr in ntfs_attr_find() Link: https://syzkaller.appspot.com/bug?extid=aed06913f36eff9b544e Link: https://lkml.kernel.org/r/20200824022804.226242-1-rkovhaev@gmail.com Reported-by: syzbot+aed06913f36eff9b544e@syzkaller.appspotmail.com Tested-by: syzbot+aed06913f36eff9b544e@syzkaller.appspotmail.com Signed-off-by: Rustam Kovhaev <rkovhaev@gmail.com> Acked-by: Anton Altaparmakov <anton@tuxera.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/ntfs/inode.c | 6 ++++++ 1 file changed, 6 insertions(+) --- a/fs/ntfs/inode.c~ntfs-add-check-for-mft-record-size-in-superblock +++ a/fs/ntfs/inode.c @@ -1810,6 +1810,12 @@ int ntfs_read_inode_mount(struct inode * brelse(bh); } + if (le32_to_cpu(m->bytes_allocated) != vol->mft_record_size) { + ntfs_error(sb, "Incorrect mft record size %u in superblock, should be %u.", + le32_to_cpu(m->bytes_allocated), vol->mft_record_size); + goto err_out; + } + /* Apply the mst fixups. */ if (post_read_mst_fixup((NTFS_RECORD*)m, vol->mft_record_size)) { /* FIXME: Try to use the $MFTMirr now. */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 015/181] ocfs2: delete repeated words in comments 2020-10-13 23:46 incoming Andrew Morton ` (13 preceding siblings ...) 2020-10-13 23:48 ` [patch 014/181] ntfs: add check for mft record size in superblock Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 016/181] ocfs2: fix potential soft lockup during fstrim Andrew Morton ` (165 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, jlbec, joseph.qi, linux-mm, mark, mm-commits, rdunlap, torvalds From: Randy Dunlap <rdunlap@infradead.org> Subject: ocfs2: delete repeated words in comments Drop duplicated words {the, and} in comments. Link: https://lkml.kernel.org/r/20200811021845.25134-1-rdunlap@infradead.org Signed-off-by: Randy Dunlap <rdunlap@infradead.org> Acked-by: Joseph Qi <joseph.qi@linux.alibaba.com> Cc: Mark Fasheh <mark@fasheh.com> Cc: Joel Becker <jlbec@evilplan.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/ocfs2/alloc.c | 2 +- fs/ocfs2/localalloc.c | 2 +- 2 files changed, 2 insertions(+), 2 deletions(-) --- a/fs/ocfs2/alloc.c~fs-ocfs2-delete-repeated-words-in-comments +++ a/fs/ocfs2/alloc.c @@ -6013,7 +6013,7 @@ int __ocfs2_flush_truncate_log(struct oc goto out; } - /* Appending truncate log(TA) and and flushing truncate log(TF) are + /* Appending truncate log(TA) and flushing truncate log(TF) are * two separated transactions. They can be both committed but not * checkpointed. If crash occurs then, both two transaction will be * replayed with several already released to global bitmap clusters. --- a/fs/ocfs2/localalloc.c~fs-ocfs2-delete-repeated-words-in-comments +++ a/fs/ocfs2/localalloc.c @@ -677,7 +677,7 @@ int ocfs2_reserve_local_alloc_bits(struc /* * Under certain conditions, the window slide code * might have reduced the number of bits available or - * disabled the the local alloc entirely. Re-check + * disabled the local alloc entirely. Re-check * here and return -ENOSPC if necessary. */ status = -ENOSPC; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 016/181] ocfs2: fix potential soft lockup during fstrim 2020-10-13 23:46 incoming Andrew Morton ` (14 preceding siblings ...) 2020-10-13 23:48 ` [patch 015/181] ocfs2: delete repeated words in comments Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 017/181] fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr Andrew Morton ` (164 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, gechangwei, ghe, jlbec, joseph.qi, junxiao.bi, linux-mm, mark, mm-commits, piaojun, torvalds From: Gang He <ghe@suse.com> Subject: ocfs2: fix potential soft lockup during fstrim When we discard unused blocks on a mounted ocfs2 filesystem, fstrim handles each block goup with locking/unlocking global bitmap meta-file repeatedly. we should let fstrim thread take a break(if need) between unlock and lock, this will avoid the potential soft lockup problem, and also gives the upper applications more IO opportunities, these applications are not blocked for too long at writing files. Link: https://lkml.kernel.org/r/20200927015815.14904-1-ghe@suse.com Signed-off-by: Gang He <ghe@suse.com> Reviewed-by: Joseph Qi <joseph.qi@linux.alibaba.com> Cc: Mark Fasheh <mark@fasheh.com> Cc: Joel Becker <jlbec@evilplan.org> Cc: Junxiao Bi <junxiao.bi@oracle.com> Cc: Changwei Ge <gechangwei@live.cn> Cc: Jun Piao <piaojun@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/ocfs2/alloc.c | 4 +++- 1 file changed, 3 insertions(+), 1 deletion(-) --- a/fs/ocfs2/alloc.c~ocfs2-fix-potential-soft-lockup-during-fstrim +++ a/fs/ocfs2/alloc.c @@ -7654,8 +7654,10 @@ out_mutex: * main_bm related locks for avoiding the current IO starve, then go to * trim the next group */ - if (ret >= 0 && group <= last_group) + if (ret >= 0 && group <= last_group) { + cond_resched(); goto next_group; + } out: range->len = trimmed * sb->s_blocksize; return ret; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 017/181] fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr 2020-10-13 23:46 incoming Andrew Morton ` (15 preceding siblings ...) 2020-10-13 23:48 ` [patch 016/181] ocfs2: fix potential soft lockup during fstrim Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 018/181] fs_parse: mark fs_param_bad_value() as static Andrew Morton ` (163 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, chuck.lever, fllinden, linux-mm, mm-commits, rdunlap, torvalds, viro From: Randy Dunlap <rdunlap@infradead.org> Subject: fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr Fix kernel-doc warnings in fs/xattr.c: ../fs/xattr.c:251: warning: Function parameter or member 'dentry' not described in '__vfs_setxattr_locked' ../fs/xattr.c:251: warning: Function parameter or member 'name' not described in '__vfs_setxattr_locked' ../fs/xattr.c:251: warning: Function parameter or member 'value' not described in '__vfs_setxattr_locked' ../fs/xattr.c:251: warning: Function parameter or member 'size' not described in '__vfs_setxattr_locked' ../fs/xattr.c:251: warning: Function parameter or member 'flags' not described in '__vfs_setxattr_locked' ../fs/xattr.c:251: warning: Function parameter or member 'delegated_inode' not described in '__vfs_setxattr_locked' ../fs/xattr.c:458: warning: Function parameter or member 'dentry' not described in '__vfs_removexattr_locked' ../fs/xattr.c:458: warning: Function parameter or member 'name' not described in '__vfs_removexattr_locked' ../fs/xattr.c:458: warning: Function parameter or member 'delegated_inode' not described in '__vfs_removexattr_locked' Link: http://lkml.kernel.org/r/7a3dd5a2-5787-adf3-d525-c203f9910ec4@infradead.org Fixes: 08b5d5014a27 ("xattr: break delegations in {set,remove}xattr") Signed-off-by: Randy Dunlap <rdunlap@infradead.org> Cc: Al Viro <viro@zeniv.linux.org.uk> Cc: Frank van der Linden <fllinden@amazon.com> Cc: Chuck Lever <chuck.lever@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/xattr.c | 22 +++++++++++----------- 1 file changed, 11 insertions(+), 11 deletions(-) --- a/fs/xattr.c~fs-xattrc-fix-kernel-doc-warnings-for-setxattr-removexattr +++ a/fs/xattr.c @@ -232,15 +232,15 @@ int __vfs_setxattr_noperm(struct dentry } /** - * __vfs_setxattr_locked: set an extended attribute while holding the inode + * __vfs_setxattr_locked - set an extended attribute while holding the inode * lock * - * @dentry - object to perform setxattr on - * @name - xattr name to set - * @value - value to set @name to - * @size - size of @value - * @flags - flags to pass into filesystem operations - * @delegated_inode - on return, will contain an inode pointer that + * @dentry: object to perform setxattr on + * @name: xattr name to set + * @value: value to set @name to + * @size: size of @value + * @flags: flags to pass into filesystem operations + * @delegated_inode: on return, will contain an inode pointer that * a delegation was broken on, NULL if none. */ int @@ -443,12 +443,12 @@ __vfs_removexattr(struct dentry *dentry, EXPORT_SYMBOL(__vfs_removexattr); /** - * __vfs_removexattr_locked: set an extended attribute while holding the inode + * __vfs_removexattr_locked - set an extended attribute while holding the inode * lock * - * @dentry - object to perform setxattr on - * @name - name of xattr to remove - * @delegated_inode - on return, will contain an inode pointer that + * @dentry: object to perform setxattr on + * @name: name of xattr to remove + * @delegated_inode: on return, will contain an inode pointer that * a delegation was broken on, NULL if none. */ int _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 018/181] fs_parse: mark fs_param_bad_value() as static 2020-10-13 23:46 incoming Andrew Morton ` (16 preceding siblings ...) 2020-10-13 23:48 ` [patch 017/181] fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 019/181] mm/slab.c: clean code by removing redundant if condition Andrew Morton ` (162 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, linux-mm, luojiaxing, mm-commits, torvalds From: Luo Jiaxing <luojiaxing@huawei.com> Subject: fs_parse: mark fs_param_bad_value() as static We found the following warning when build kernel with W=1: fs/fs_parser.c:192:5: warning: no previous prototype for `fs_param_bad_value' [-Wmissing-prototypes] int fs_param_bad_value(struct p_log *log, struct fs_parameter *param) ^ CC drivers/usb/gadget/udc/snps_udc_core.o And no header file define a prototype for this function, so we should mark it as static. Link: https://lkml.kernel.org/r/1601293463-25763-1-git-send-email-luojiaxing@huawei.com Signed-off-by: Luo Jiaxing <luojiaxing@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/fs_parser.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/fs/fs_parser.c~fs_parse-mark-fs_param_bad_value-as-static +++ a/fs/fs_parser.c @@ -189,7 +189,7 @@ out: } EXPORT_SYMBOL(fs_lookup_param); -int fs_param_bad_value(struct p_log *log, struct fs_parameter *param) +static int fs_param_bad_value(struct p_log *log, struct fs_parameter *param) { return inval_plog(log, "Bad value for '%s'", param->key); } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 019/181] mm/slab.c: clean code by removing redundant if condition 2020-10-13 23:46 incoming Andrew Morton ` (17 preceding siblings ...) 2020-10-13 23:48 ` [patch 018/181] fs_parse: mark fs_param_bad_value() as static Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 020/181] include/linux/slab.h: fix a typo error in comment Andrew Morton ` (161 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, cl, iamjoonsoo.kim, linux-mm, mateusznosek0, mm-commits, penberg, rientjes, torvalds From: Mateusz Nosek <mateusznosek0@gmail.com> Subject: mm/slab.c: clean code by removing redundant if condition The removed code was unnecessary and changed nothing in the flow, since in case of returning NULL by 'kmem_cache_alloc_node' returning 'freelist' from the function in question is the same as returning NULL. Link: https://lkml.kernel.org/r/20200915230329.13002-1-mateusznosek0@gmail.com Signed-off-by: Mateusz Nosek <mateusznosek0@gmail.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Cc: Christoph Lameter <cl@linux.com> Cc: Pekka Enberg <penberg@kernel.org> Cc: David Rientjes <rientjes@google.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/slab.c | 2 -- 1 file changed, 2 deletions(-) --- a/mm/slab.c~mm-slabc-clean-code-by-removing-redundant-if-condition +++ a/mm/slab.c @@ -2305,8 +2305,6 @@ static void *alloc_slabmgmt(struct kmem_ /* Slab management obj is off-slab. */ freelist = kmem_cache_alloc_node(cachep->freelist_cache, local_flags, nodeid); - if (!freelist) - return NULL; } else { /* We will use last bytes at the slab for freelist */ freelist = addr + (PAGE_SIZE << cachep->gfporder) - _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 020/181] include/linux/slab.h: fix a typo error in comment 2020-10-13 23:46 incoming Andrew Morton ` (18 preceding siblings ...) 2020-10-13 23:48 ` [patch 019/181] mm/slab.c: clean code by removing redundant if condition Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 021/181] mm/slub.c: branch optimization in free slowpath Andrew Morton ` (160 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, jrdr.linux, linux-mm, mm-commits, tangjianqiang, torvalds, wyqt1985 From: tangjianqiang <wyqt1985@gmail.com> Subject: include/linux/slab.h: fix a typo error in comment fix a typo error in slab.h "allocagtor" -> "allocator" Link: https://lkml.kernel.org/r/1600230053-24303-1-git-send-email-tangjianqiang@xiaomi.com Signed-off-by: tangjianqiang <tangjianqiang@xiaomi.com> Acked-by: Souptick Joarder <jrdr.linux@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/slab.h | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/include/linux/slab.h~include-linux-slabh-fix-a-typo-error-in-comment +++ a/include/linux/slab.h @@ -279,7 +279,7 @@ static inline void __check_heap_object(c #define KMALLOC_MAX_SIZE (1UL << KMALLOC_SHIFT_MAX) /* Maximum size for which we actually use a slab cache */ #define KMALLOC_MAX_CACHE_SIZE (1UL << KMALLOC_SHIFT_HIGH) -/* Maximum order allocatable via the slab allocagtor */ +/* Maximum order allocatable via the slab allocator */ #define KMALLOC_MAX_ORDER (KMALLOC_SHIFT_MAX - PAGE_SHIFT) /* _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 021/181] mm/slub.c: branch optimization in free slowpath 2020-10-13 23:46 incoming Andrew Morton ` (19 preceding siblings ...) 2020-10-13 23:48 ` [patch 020/181] include/linux/slab.h: fix a typo error in comment Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 022/181] mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc Andrew Morton ` (159 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, cl, hewenliang4, hushiyuan, iamjoonsoo.kim, linux-mm, mm-commits, penberg, rientjes, torvalds, wuyun.wu From: Abel Wu <wuyun.wu@huawei.com> Subject: mm/slub.c: branch optimization in free slowpath The two conditions are mutually exclusive and gcc compiler will optimise this into if-else-like pattern. Given that the majority of free_slowpath is free_frozen, let's provide some hint to the compilers. Tests (perf bench sched messaging -g 20 -l 400000, executed 10x after reboot) are done and the summarized result: un-patched patched max. 192.316 189.851 min. 187.267 186.252 avg. 189.154 188.086 stdev. 1.37 0.99 Link: http://lkml.kernel.org/r/20200813101812.1617-1-wuyun.wu@huawei.com Signed-off-by: Abel Wu <wuyun.wu@huawei.com> Acked-by: Christoph Lameter <cl@linux.com> Cc: Pekka Enberg <penberg@kernel.org> Cc: David Rientjes <rientjes@google.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Hewenliang <hewenliang4@huawei.com> Cc: Hu Shiyuan <hushiyuan@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/slub.c | 23 ++++++++++++----------- 1 file changed, 12 insertions(+), 11 deletions(-) --- a/mm/slub.c~mm-slub-branch-optimization-in-free-slowpath +++ a/mm/slub.c @@ -3019,20 +3019,21 @@ static void __slab_free(struct kmem_cach if (likely(!n)) { - /* - * If we just froze the page then put it onto the - * per cpu partial list. - */ - if (new.frozen && !was_frozen) { + if (likely(was_frozen)) { + /* + * The list lock was not taken therefore no list + * activity can be necessary. + */ + stat(s, FREE_FROZEN); + } else if (new.frozen) { + /* + * If we just froze the page then put it onto the + * per cpu partial list. + */ put_cpu_partial(s, page, 1); stat(s, CPU_PARTIAL_FREE); } - /* - * The list lock was not taken therefore no list - * activity can be necessary. - */ - if (was_frozen) - stat(s, FREE_FROZEN); + return; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 022/181] mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc 2020-10-13 23:46 incoming Andrew Morton ` (20 preceding siblings ...) 2020-10-13 23:48 ` [patch 021/181] mm/slub.c: branch optimization in free slowpath Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 023/181] mm/slub: make add_full() condition more explicit Andrew Morton ` (158 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, cl, hewenliang4, hushiyuan, iamjoonsoo.kim, linux-mm, mm-commits, penberg, rientjes, torvalds, wuyun.wu From: Abel Wu <wuyun.wu@huawei.com> Subject: mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc The ALLOC_SLOWPATH statistics is missing in bulk allocation now. Fix it by doing statistics in alloc slow path. Link: http://lkml.kernel.org/r/20200811022427.1363-1-wuyun.wu@huawei.com Signed-off-by: Abel Wu <wuyun.wu@huawei.com> Reviewed-by: Pekka Enberg <penberg@kernel.org> Acked-by: David Rientjes <rientjes@google.com> Cc: Christoph Lameter <cl@linux.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Hewenliang <hewenliang4@huawei.com> Cc: Hu Shiyuan <hushiyuan@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/slub.c | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) --- a/mm/slub.c~mm-slub-fix-missing-alloc_slowpath-stat-when-bulk-alloc +++ a/mm/slub.c @@ -2661,6 +2661,8 @@ static void *___slab_alloc(struct kmem_c void *freelist; struct page *page; + stat(s, ALLOC_SLOWPATH); + page = c->page; if (!page) { /* @@ -2850,7 +2852,6 @@ redo: page = c->page; if (unlikely(!object || !node_match(page, node))) { object = __slab_alloc(s, gfpflags, node, addr, c); - stat(s, ALLOC_SLOWPATH); } else { void *next_object = get_freepointer_safe(s, object); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 023/181] mm/slub: make add_full() condition more explicit 2020-10-13 23:46 incoming Andrew Morton ` (21 preceding siblings ...) 2020-10-13 23:48 ` [patch 022/181] mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 024/181] mm/kmemleak: rely on rcu for task stack scanning Andrew Morton ` (157 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, cl, iamjoonsoo.kim, linux-mm, liu.xiang6, mm-commits, penberg, rientjes, torvalds, wuyun.wu From: Abel Wu <wuyun.wu@huawei.com> Subject: mm/slub: make add_full() condition more explicit The commit below is incomplete, as it didn't handle the add_full() part. commit a4d3f8916c65 ("slub: remove useless kmem_cache_debug() before remove_full()") This patch checks for SLAB_STORE_USER instead of kmem_cache_debug(), since that should be the only context in which we need the list_lock for add_full(). Link: https://lkml.kernel.org/r/20200811020240.1231-1-wuyun.wu@huawei.com Signed-off-by: Abel Wu <wuyun.wu@huawei.com> Cc: Christoph Lameter <cl@linux.com> Cc: Pekka Enberg <penberg@kernel.org> Cc: David Rientjes <rientjes@google.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Liu Xiang <liu.xiang6@zte.com.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/slub.c | 4 +++- 1 file changed, 3 insertions(+), 1 deletion(-) --- a/mm/slub.c~mm-slub-make-add_full-condition-more-explicit +++ a/mm/slub.c @@ -2245,7 +2245,8 @@ redo: } } else { m = M_FULL; - if (kmem_cache_debug(s) && !lock) { +#ifdef CONFIG_SLUB_DEBUG + if ((s->flags & SLAB_STORE_USER) && !lock) { lock = 1; /* * This also ensures that the scanning of full @@ -2254,6 +2255,7 @@ redo: */ spin_lock(&n->list_lock); } +#endif } if (l != m) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 024/181] mm/kmemleak: rely on rcu for task stack scanning 2020-10-13 23:46 incoming Andrew Morton ` (22 preceding siblings ...) 2020-10-13 23:48 ` [patch 023/181] mm/slub: make add_full() condition more explicit Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 025/181] mm,kmemleak-test.c: move kmemleak-test.c to samples dir Andrew Morton ` (156 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, cai, catalin.marinas, dave, dbueso, linux-mm, mm-commits, oleg, torvalds From: Davidlohr Bueso <dave@stgolabs.net> Subject: mm/kmemleak: rely on rcu for task stack scanning kmemleak_scan() currently relies on the big tasklist_lock hammer to stabilize iterating through the tasklist. Instead, this patch proposes simply using rcu along with the rcu-safe for_each_process_thread flavor (without changing scan semantics), which doesn't make use of next_thread/p->thread_group and thus cannot race with exit. Furthermore, any races with fork() and not seeing the new child should be benign as it's not running yet and can also be detected by the next scan. Avoiding the tasklist_lock could prove beneficial for performance considering the scan operation is done periodically. I have seen improvements of 30%-ish when doing similar replacements on very pathological microbenchmarks (ie stressing get/setpriority(2)). However my main motivation is that it's one less user of the global lock, something that Linus has long time wanted to see gone eventually (if ever) even if the traditional fairness issues has been dealt with now with qrwlocks. Of course this is a very long ways ahead. This patch also kills another user of the deprecated tsk->thread_group. Link: https://lkml.kernel.org/r/20200820203902.11308-1-dave@stgolabs.net Signed-off-by: Davidlohr Bueso <dbueso@suse.de> Acked-by: Catalin Marinas <catalin.marinas@arm.com> Acked-by: Oleg Nesterov <oleg@redhat.com> Reviewed-by: Qian Cai <cai@lca.pw> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kmemleak.c | 8 ++++---- 1 file changed, 4 insertions(+), 4 deletions(-) --- a/mm/kmemleak.c~mm-kmemleak-rely-on-rcu-for-task-stack-scanning +++ a/mm/kmemleak.c @@ -1471,15 +1471,15 @@ static void kmemleak_scan(void) if (kmemleak_stack_scan) { struct task_struct *p, *g; - read_lock(&tasklist_lock); - do_each_thread(g, p) { + rcu_read_lock(); + for_each_process_thread(g, p) { void *stack = try_get_task_stack(p); if (stack) { scan_block(stack, stack + THREAD_SIZE, NULL); put_task_stack(p); } - } while_each_thread(g, p); - read_unlock(&tasklist_lock); + } + rcu_read_unlock(); } /* _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 025/181] mm,kmemleak-test.c: move kmemleak-test.c to samples dir 2020-10-13 23:46 incoming Andrew Morton ` (23 preceding siblings ...) 2020-10-13 23:48 ` [patch 024/181] mm/kmemleak: rely on rcu for task stack scanning Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:48 ` [patch 026/181] x86/numa: cleanup configuration dependent command-line options Andrew Morton ` (155 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: akpm, catalin.marinas, corbet, davem, dhowells, divya.indi, jpoimboe, linux-mm, mchehab+huawei, miguel.ojeda.sandonis, mm-commits, robh, rostedt, sam, sh_def, tomas.winkler, torvalds, yamada.masahiro From: Hui Su <sh_def@163.com> Subject: mm,kmemleak-test.c: move kmemleak-test.c to samples dir kmemleak-test.c is just a kmemleak test module, which also can not be used as a built-in kernel module. Thus, i think it may should not be in mm dir, and move the kmemleak-test.c to samples/kmemleak/kmemleak-test.c. Fix the spelling of built-in by the way. Link: https://lkml.kernel.org/r/20200925183729.GA172837@rlk Signed-off-by: Hui Su <sh_def@163.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Jonathan Corbet <corbet@lwn.net> Cc: Mauro Carvalho Chehab <mchehab+huawei@kernel.org> Cc: David S. Miller <davem@davemloft.net> Cc: Rob Herring <robh@kernel.org> Cc: Masahiro Yamada <yamada.masahiro@socionext.com> Cc: Sam Ravnborg <sam@ravnborg.org> Cc: Josh Poimboeuf <jpoimboe@redhat.com> Cc: Steven Rostedt (VMware) <rostedt@goodmis.org> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Divya Indi <divya.indi@oracle.com> Cc: Tomas Winkler <tomas.winkler@intel.com> Cc: David Howells <dhowells@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/dev-tools/kmemleak.rst | 2 MAINTAINERS | 2 mm/Makefile | 1 mm/kmemleak-test.c | 99 ------------------------- samples/Makefile | 1 samples/kmemleak/Makefile | 3 samples/kmemleak/kmemleak-test.c | 99 +++++++++++++++++++++++++ 7 files changed, 105 insertions(+), 102 deletions(-) --- a/Documentation/dev-tools/kmemleak.rst~mmkmemleak-testc-move-kmemleak-testc-to-samples-dir +++ a/Documentation/dev-tools/kmemleak.rst @@ -229,7 +229,7 @@ Testing with kmemleak-test To check if you have all set up to use kmemleak, you can use the kmemleak-test module, a module that deliberately leaks memory. Set CONFIG_DEBUG_KMEMLEAK_TEST -as module (it can't be used as bult-in) and boot the kernel with kmemleak +as module (it can't be used as built-in) and boot the kernel with kmemleak enabled. Load the module and perform a scan with:: # modprobe kmemleak-test --- a/MAINTAINERS~mmkmemleak-testc-move-kmemleak-testc-to-samples-dir +++ a/MAINTAINERS @@ -9727,8 +9727,8 @@ M: Catalin Marinas <catalin.marinas@arm. S: Maintained F: Documentation/dev-tools/kmemleak.rst F: include/linux/kmemleak.h -F: mm/kmemleak-test.c F: mm/kmemleak.c +F: samples/kmemleak/kmemleak-test.c KMOD KERNEL MODULE LOADER - USERMODE HELPER M: Luis Chamberlain <mcgrof@kernel.org> --- a/mm/kmemleak-test.c +++ /dev/null @@ -1,99 +0,0 @@ -// SPDX-License-Identifier: GPL-2.0-only -/* - * mm/kmemleak-test.c - * - * Copyright (C) 2008 ARM Limited - * Written by Catalin Marinas <catalin.marinas@arm.com> - */ - -#define pr_fmt(fmt) "kmemleak: " fmt - -#include <linux/init.h> -#include <linux/kernel.h> -#include <linux/module.h> -#include <linux/slab.h> -#include <linux/vmalloc.h> -#include <linux/list.h> -#include <linux/percpu.h> -#include <linux/fdtable.h> - -#include <linux/kmemleak.h> - -struct test_node { - long header[25]; - struct list_head list; - long footer[25]; -}; - -static LIST_HEAD(test_list); -static DEFINE_PER_CPU(void *, kmemleak_test_pointer); - -/* - * Some very simple testing. This function needs to be extended for - * proper testing. - */ -static int __init kmemleak_test_init(void) -{ - struct test_node *elem; - int i; - - pr_info("Kmemleak testing\n"); - - /* make some orphan objects */ - pr_info("kmalloc(32) = %p\n", kmalloc(32, GFP_KERNEL)); - pr_info("kmalloc(32) = %p\n", kmalloc(32, GFP_KERNEL)); - pr_info("kmalloc(1024) = %p\n", kmalloc(1024, GFP_KERNEL)); - pr_info("kmalloc(1024) = %p\n", kmalloc(1024, GFP_KERNEL)); - pr_info("kmalloc(2048) = %p\n", kmalloc(2048, GFP_KERNEL)); - pr_info("kmalloc(2048) = %p\n", kmalloc(2048, GFP_KERNEL)); - pr_info("kmalloc(4096) = %p\n", kmalloc(4096, GFP_KERNEL)); - pr_info("kmalloc(4096) = %p\n", kmalloc(4096, GFP_KERNEL)); -#ifndef CONFIG_MODULES - pr_info("kmem_cache_alloc(files_cachep) = %p\n", - kmem_cache_alloc(files_cachep, GFP_KERNEL)); - pr_info("kmem_cache_alloc(files_cachep) = %p\n", - kmem_cache_alloc(files_cachep, GFP_KERNEL)); -#endif - pr_info("vmalloc(64) = %p\n", vmalloc(64)); - pr_info("vmalloc(64) = %p\n", vmalloc(64)); - pr_info("vmalloc(64) = %p\n", vmalloc(64)); - pr_info("vmalloc(64) = %p\n", vmalloc(64)); - pr_info("vmalloc(64) = %p\n", vmalloc(64)); - - /* - * Add elements to a list. They should only appear as orphan - * after the module is removed. - */ - for (i = 0; i < 10; i++) { - elem = kzalloc(sizeof(*elem), GFP_KERNEL); - pr_info("kzalloc(sizeof(*elem)) = %p\n", elem); - if (!elem) - return -ENOMEM; - INIT_LIST_HEAD(&elem->list); - list_add_tail(&elem->list, &test_list); - } - - for_each_possible_cpu(i) { - per_cpu(kmemleak_test_pointer, i) = kmalloc(129, GFP_KERNEL); - pr_info("kmalloc(129) = %p\n", - per_cpu(kmemleak_test_pointer, i)); - } - - return 0; -} -module_init(kmemleak_test_init); - -static void __exit kmemleak_test_exit(void) -{ - struct test_node *elem, *tmp; - - /* - * Remove the list elements without actually freeing the - * memory. - */ - list_for_each_entry_safe(elem, tmp, &test_list, list) - list_del(&elem->list); -} -module_exit(kmemleak_test_exit); - -MODULE_LICENSE("GPL"); --- a/mm/Makefile~mmkmemleak-testc-move-kmemleak-testc-to-samples-dir +++ a/mm/Makefile @@ -94,7 +94,6 @@ obj-$(CONFIG_GUP_BENCHMARK) += gup_bench obj-$(CONFIG_MEMORY_FAILURE) += memory-failure.o obj-$(CONFIG_HWPOISON_INJECT) += hwpoison-inject.o obj-$(CONFIG_DEBUG_KMEMLEAK) += kmemleak.o -obj-$(CONFIG_DEBUG_KMEMLEAK_TEST) += kmemleak-test.o obj-$(CONFIG_DEBUG_RODATA_TEST) += rodata_test.o obj-$(CONFIG_DEBUG_VM_PGTABLE) += debug_vm_pgtable.o obj-$(CONFIG_PAGE_OWNER) += page_owner.o --- /dev/null +++ a/samples/kmemleak/kmemleak-test.c @@ -0,0 +1,99 @@ +// SPDX-License-Identifier: GPL-2.0-only +/* + * samples/kmemleak/kmemleak-test.c + * + * Copyright (C) 2008 ARM Limited + * Written by Catalin Marinas <catalin.marinas@arm.com> + */ + +#define pr_fmt(fmt) "kmemleak: " fmt + +#include <linux/init.h> +#include <linux/kernel.h> +#include <linux/module.h> +#include <linux/slab.h> +#include <linux/vmalloc.h> +#include <linux/list.h> +#include <linux/percpu.h> +#include <linux/fdtable.h> + +#include <linux/kmemleak.h> + +struct test_node { + long header[25]; + struct list_head list; + long footer[25]; +}; + +static LIST_HEAD(test_list); +static DEFINE_PER_CPU(void *, kmemleak_test_pointer); + +/* + * Some very simple testing. This function needs to be extended for + * proper testing. + */ +static int __init kmemleak_test_init(void) +{ + struct test_node *elem; + int i; + + pr_info("Kmemleak testing\n"); + + /* make some orphan objects */ + pr_info("kmalloc(32) = %p\n", kmalloc(32, GFP_KERNEL)); + pr_info("kmalloc(32) = %p\n", kmalloc(32, GFP_KERNEL)); + pr_info("kmalloc(1024) = %p\n", kmalloc(1024, GFP_KERNEL)); + pr_info("kmalloc(1024) = %p\n", kmalloc(1024, GFP_KERNEL)); + pr_info("kmalloc(2048) = %p\n", kmalloc(2048, GFP_KERNEL)); + pr_info("kmalloc(2048) = %p\n", kmalloc(2048, GFP_KERNEL)); + pr_info("kmalloc(4096) = %p\n", kmalloc(4096, GFP_KERNEL)); + pr_info("kmalloc(4096) = %p\n", kmalloc(4096, GFP_KERNEL)); +#ifndef CONFIG_MODULES + pr_info("kmem_cache_alloc(files_cachep) = %p\n", + kmem_cache_alloc(files_cachep, GFP_KERNEL)); + pr_info("kmem_cache_alloc(files_cachep) = %p\n", + kmem_cache_alloc(files_cachep, GFP_KERNEL)); +#endif + pr_info("vmalloc(64) = %p\n", vmalloc(64)); + pr_info("vmalloc(64) = %p\n", vmalloc(64)); + pr_info("vmalloc(64) = %p\n", vmalloc(64)); + pr_info("vmalloc(64) = %p\n", vmalloc(64)); + pr_info("vmalloc(64) = %p\n", vmalloc(64)); + + /* + * Add elements to a list. They should only appear as orphan + * after the module is removed. + */ + for (i = 0; i < 10; i++) { + elem = kzalloc(sizeof(*elem), GFP_KERNEL); + pr_info("kzalloc(sizeof(*elem)) = %p\n", elem); + if (!elem) + return -ENOMEM; + INIT_LIST_HEAD(&elem->list); + list_add_tail(&elem->list, &test_list); + } + + for_each_possible_cpu(i) { + per_cpu(kmemleak_test_pointer, i) = kmalloc(129, GFP_KERNEL); + pr_info("kmalloc(129) = %p\n", + per_cpu(kmemleak_test_pointer, i)); + } + + return 0; +} +module_init(kmemleak_test_init); + +static void __exit kmemleak_test_exit(void) +{ + struct test_node *elem, *tmp; + + /* + * Remove the list elements without actually freeing the + * memory. + */ + list_for_each_entry_safe(elem, tmp, &test_list, list) + list_del(&elem->list); +} +module_exit(kmemleak_test_exit); + +MODULE_LICENSE("GPL"); --- /dev/null +++ a/samples/kmemleak/Makefile @@ -0,0 +1,3 @@ +# SPDX-License-Identifier: GPL-2.0-only + +obj-$(CONFIG_DEBUG_KMEMLEAK_TEST) += kmemleak-test.o --- a/samples/Makefile~mmkmemleak-testc-move-kmemleak-testc-to-samples-dir +++ a/samples/Makefile @@ -28,3 +28,4 @@ subdir-$(CONFIG_SAMPLE_VFS) += vfs obj-$(CONFIG_SAMPLE_INTEL_MEI) += mei/ subdir-$(CONFIG_SAMPLE_WATCHDOG) += watchdog subdir-$(CONFIG_SAMPLE_WATCH_QUEUE) += watch_queue +obj-$(CONFIG_DEBUG_KMEMLEAK_TEST) += kmemleak/ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 026/181] x86/numa: cleanup configuration dependent command-line options 2020-10-13 23:46 incoming Andrew Morton ` (24 preceding siblings ...) 2020-10-13 23:48 ` [patch 025/181] mm,kmemleak-test.c: move kmemleak-test.c to samples dir Andrew Morton @ 2020-10-13 23:48 ` Andrew Morton 2020-10-13 23:49 ` [patch 027/181] x86/numa: add 'nohmat' option Andrew Morton ` (154 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:48 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: x86/numa: cleanup configuration dependent command-line options Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5. The device-dax facility allows an address range to be directly mapped through a chardev, or optionally hotplugged to the core kernel page allocator as System-RAM. It is the mechanism for converting persistent memory (pmem) to be used as another volatile memory pool i.e. the current Memory Tiering hot topic on linux-mm. In the case of pmem the nvdimm-namespace-label mechanism can sub-divide it, but that labeling mechanism is not available / applicable to soft-reserved ("EFI specific purpose") memory [3]. This series provides a sysfs-mechanism for the daxctl utility to enable provisioning of volatile-soft-reserved memory ranges. The motivations for this facility are: 1/ Allow performance differentiated memory ranges to be split between kernel-managed and directly-accessed use cases. 2/ Allow physical memory to be provisioned along performance relevant address boundaries. For example, divide a memory-side cache [4] along cache-color boundaries. 3/ Parcel out soft-reserved memory to VMs using device-dax as a security / permissions boundary [5]. Specifically I have seen people (ab)using memmap=nn!ss (mark System-RAM as Persistent Memory) just to get the device-dax interface on custom address ranges. A follow-on for the VM use case is to teach device-dax to dynamically allocate 'struct page' at runtime to reduce the duplication of 'struct page' space in both the guest and the host kernel for the same physical pages. [2]: http://lore.kernel.org/r/20200713160837.13774-11-joao.m.martins@oracle.com [3]: http://lore.kernel.org/r/157309097008.1579826.12818463304589384434.stgit@dwillia2-desk3.amr.corp.intel.com [4]: http://lore.kernel.org/r/154899811738.3165233.12325692939590944259.stgit@dwillia2-desk3.amr.corp.intel.com [5]: http://lore.kernel.org/r/20200110190313.17144-1-joao.m.martins@oracle.com This patch (of 23): In preparation for adding a new numa= option clean up the existing ones to avoid ifdefs in numa_setup(), and provide feedback when the option is numa=fake= option is invalid due to kernel config. The same does not need to be done for numa=noacpi, since the capability is already hard disabled at compile-time. Link: https://lkml.kernel.org/r/160106109960.30709.7379926726669669398.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/159643094279.4062302.17779410714418721328.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/159643094925.4062302.14979872973043772305.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Suggested-by: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/x86/include/asm/numa.h | 8 +++++++- arch/x86/mm/numa.c | 8 ++------ arch/x86/mm/numa_emulation.c | 3 ++- arch/x86/xen/enlighten_pv.c | 2 +- drivers/acpi/numa/srat.c | 9 +++++++-- include/acpi/acpi_numa.h | 6 +++++- 6 files changed, 24 insertions(+), 12 deletions(-) --- a/arch/x86/include/asm/numa.h~x86-numa-cleanup-configuration-dependent-command-line-options +++ a/arch/x86/include/asm/numa.h @@ -3,6 +3,7 @@ #define _ASM_X86_NUMA_H #include <linux/nodemask.h> +#include <linux/errno.h> #include <asm/topology.h> #include <asm/apicdef.h> @@ -77,7 +78,12 @@ void debug_cpumask_set_cpu(int cpu, int #ifdef CONFIG_NUMA_EMU #define FAKE_NODE_MIN_SIZE ((u64)32 << 20) #define FAKE_NODE_MIN_HASH_MASK (~(FAKE_NODE_MIN_SIZE - 1UL)) -void numa_emu_cmdline(char *); +int numa_emu_cmdline(char *str); +#else /* CONFIG_NUMA_EMU */ +static inline int numa_emu_cmdline(char *str) +{ + return -EINVAL; +} #endif /* CONFIG_NUMA_EMU */ #endif /* _ASM_X86_NUMA_H */ --- a/arch/x86/mm/numa.c~x86-numa-cleanup-configuration-dependent-command-line-options +++ a/arch/x86/mm/numa.c @@ -37,14 +37,10 @@ static __init int numa_setup(char *opt) return -EINVAL; if (!strncmp(opt, "off", 3)) numa_off = 1; -#ifdef CONFIG_NUMA_EMU if (!strncmp(opt, "fake=", 5)) - numa_emu_cmdline(opt + 5); -#endif -#ifdef CONFIG_ACPI_NUMA + return numa_emu_cmdline(opt + 5); if (!strncmp(opt, "noacpi", 6)) - acpi_numa = -1; -#endif + disable_srat(); return 0; } early_param("numa", numa_setup); --- a/arch/x86/mm/numa_emulation.c~x86-numa-cleanup-configuration-dependent-command-line-options +++ a/arch/x86/mm/numa_emulation.c @@ -13,9 +13,10 @@ static int emu_nid_to_phys[MAX_NUMNODES]; static char *emu_cmdline __initdata; -void __init numa_emu_cmdline(char *str) +int __init numa_emu_cmdline(char *str) { emu_cmdline = str; + return 0; } static int __init emu_find_memblk_by_nid(int nid, const struct numa_meminfo *mi) --- a/arch/x86/xen/enlighten_pv.c~x86-numa-cleanup-configuration-dependent-command-line-options +++ a/arch/x86/xen/enlighten_pv.c @@ -1300,7 +1300,7 @@ asmlinkage __visible void __init xen_sta * any NUMA information the kernel tries to get from ACPI will * be meaningless. Prevent it from trying. */ - acpi_numa = -1; + disable_srat(); #endif WARN_ON(xen_cpuhp_setup(xen_cpu_up_prepare_pv, xen_cpu_dead_pv)); --- a/drivers/acpi/numa/srat.c~x86-numa-cleanup-configuration-dependent-command-line-options +++ a/drivers/acpi/numa/srat.c @@ -27,7 +27,12 @@ static int node_to_pxm_map[MAX_NUMNODES] = { [0 ... MAX_NUMNODES - 1] = PXM_INVAL }; unsigned char acpi_srat_revision __initdata; -int acpi_numa __initdata; +static int acpi_numa __initdata; + +void __init disable_srat(void) +{ + acpi_numa = -1; +} int pxm_to_node(int pxm) { @@ -163,7 +168,7 @@ static int __init slit_valid(struct acpi void __init bad_srat(void) { pr_err("SRAT: SRAT not used.\n"); - acpi_numa = -1; + disable_srat(); } int __init srat_disabled(void) --- a/include/acpi/acpi_numa.h~x86-numa-cleanup-configuration-dependent-command-line-options +++ a/include/acpi/acpi_numa.h @@ -17,10 +17,14 @@ extern int pxm_to_node(int); extern int node_to_pxm(int); extern int acpi_map_pxm_to_node(int); extern unsigned char acpi_srat_revision; -extern int acpi_numa __initdata; +extern void disable_srat(void); extern void bad_srat(void); extern int srat_disabled(void); +#else /* CONFIG_ACPI_NUMA */ +static inline void disable_srat(void) +{ +} #endif /* CONFIG_ACPI_NUMA */ #endif /* __ACP_NUMA_H */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 027/181] x86/numa: add 'nohmat' option 2020-10-13 23:46 incoming Andrew Morton ` (25 preceding siblings ...) 2020-10-13 23:48 ` [patch 026/181] x86/numa: cleanup configuration dependent command-line options Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 028/181] efi/fake_mem: arrange for a resource entry per efi_fake_mem instance Andrew Morton ` (153 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: x86/numa: add 'nohmat' option Disable parsing of the HMAT for debug, to workaround broken platform instances, or cases where it is otherwise not wanted. [rdunlap@infradead.org: fix build when CONFIG_ACPI is not set] Link: https://lkml.kernel.org/r/70e5ee34-9809-a997-7b49-499e4be61307@infradead.org Link: https://lkml.kernel.org/r/159643095540.4062302.732962081968036212.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Signed-off-by: Randy Dunlap <rdunlap@infradead.org> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Ingo Molnar <mingo@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/x86/x86_64/boot-options.rst | 4 ++++ arch/x86/mm/numa.c | 2 ++ drivers/acpi/numa/hmat.c | 8 +++++++- include/acpi/acpi_numa.h | 8 ++++++++ include/linux/acpi.h | 2 ++ 5 files changed, 23 insertions(+), 1 deletion(-) --- a/arch/x86/mm/numa.c~x86-numa-add-nohmat-option +++ a/arch/x86/mm/numa.c @@ -41,6 +41,8 @@ static __init int numa_setup(char *opt) return numa_emu_cmdline(opt + 5); if (!strncmp(opt, "noacpi", 6)) disable_srat(); + if (!strncmp(opt, "nohmat", 6)) + disable_hmat(); return 0; } early_param("numa", numa_setup); --- a/Documentation/x86/x86_64/boot-options.rst~x86-numa-add-nohmat-option +++ a/Documentation/x86/x86_64/boot-options.rst @@ -173,6 +173,10 @@ NUMA numa=noacpi Don't parse the SRAT table for NUMA setup + numa=nohmat + Don't parse the HMAT table for NUMA setup, or soft-reserved memory + partitioning. + numa=fake=<size>[MG] If given as a memory unit, fills all system RAM with nodes of size interleaved over physical nodes. --- a/drivers/acpi/numa/hmat.c~x86-numa-add-nohmat-option +++ a/drivers/acpi/numa/hmat.c @@ -26,6 +26,12 @@ #include <linux/sysfs.h> static u8 hmat_revision; +static int hmat_disable __initdata; + +void __init disable_hmat(void) +{ + hmat_disable = 1; +} static LIST_HEAD(targets); static LIST_HEAD(initiators); @@ -814,7 +820,7 @@ static __init int hmat_init(void) enum acpi_hmat_type i; acpi_status status; - if (srat_disabled()) + if (srat_disabled() || hmat_disable) return 0; status = acpi_get_table(ACPI_SIG_SRAT, 0, &tbl); --- a/include/acpi/acpi_numa.h~x86-numa-add-nohmat-option +++ a/include/acpi/acpi_numa.h @@ -27,4 +27,12 @@ static inline void disable_srat(void) { } #endif /* CONFIG_ACPI_NUMA */ + +#ifdef CONFIG_ACPI_HMAT +extern void disable_hmat(void); +#else /* CONFIG_ACPI_HMAT */ +static inline void disable_hmat(void) +{ +} +#endif /* CONFIG_ACPI_HMAT */ #endif /* __ACP_NUMA_H */ --- a/include/linux/acpi.h~x86-numa-add-nohmat-option +++ a/include/linux/acpi.h @@ -709,6 +709,8 @@ static inline u64 acpi_arch_get_root_poi #define ACPI_HANDLE_FWNODE(fwnode) (NULL) #define ACPI_DEVICE_CLASS(_cls, _msk) .cls = (0), .cls_msk = (0), +#include <acpi/acpi_numa.h> + struct fwnode_handle; static inline bool acpi_dev_found(const char *hid) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 028/181] efi/fake_mem: arrange for a resource entry per efi_fake_mem instance 2020-10-13 23:46 incoming Andrew Morton ` (26 preceding siblings ...) 2020-10-13 23:49 ` [patch 027/181] x86/numa: add 'nohmat' option Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 029/181] ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device Andrew Morton ` (152 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: efi/fake_mem: arrange for a resource entry per efi_fake_mem instance In preparation for attaching a platform device per iomem resource teach the efi_fake_mem code to create an e820 entry per instance. Similar to E820_TYPE_PRAM, bypass merging resource when the e820 map is sanitized. Link: https://lkml.kernel.org/r/159643096068.4062302.11590041070221681669.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Acked-by: Ard Biesheuvel <ardb@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Ingo Molnar <mingo@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/x86/kernel/e820.c | 16 +++++++++++++++- drivers/firmware/efi/x86_fake_mem.c | 12 +++++++++--- 2 files changed, 24 insertions(+), 4 deletions(-) --- a/arch/x86/kernel/e820.c~efi-fake_mem-arrange-for-a-resource-entry-per-efi_fake_mem-instance +++ a/arch/x86/kernel/e820.c @@ -305,6 +305,20 @@ static int __init cpcompare(const void * return (ap->addr != ap->entry->addr) - (bp->addr != bp->entry->addr); } +static bool e820_nomerge(enum e820_type type) +{ + /* + * These types may indicate distinct platform ranges aligned to + * numa node, protection domain, performance domain, or other + * boundaries. Do not merge them. + */ + if (type == E820_TYPE_PRAM) + return true; + if (type == E820_TYPE_SOFT_RESERVED) + return true; + return false; +} + int __init e820__update_table(struct e820_table *table) { struct e820_entry *entries = table->entries; @@ -380,7 +394,7 @@ int __init e820__update_table(struct e82 } /* Continue building up new map based on this information: */ - if (current_type != last_type || current_type == E820_TYPE_PRAM) { + if (current_type != last_type || e820_nomerge(current_type)) { if (last_type != 0) { new_entries[new_nr_entries].size = change_point[chg_idx]->addr - last_addr; /* Move forward only if the new size was non-zero: */ --- a/drivers/firmware/efi/x86_fake_mem.c~efi-fake_mem-arrange-for-a-resource-entry-per-efi_fake_mem-instance +++ a/drivers/firmware/efi/x86_fake_mem.c @@ -38,7 +38,7 @@ void __init efi_fake_memmap_early(void) m_start = mem->range.start; m_end = mem->range.end; for_each_efi_memory_desc(md) { - u64 start, end; + u64 start, end, size; if (md->type != EFI_CONVENTIONAL_MEMORY) continue; @@ -58,11 +58,17 @@ void __init efi_fake_memmap_early(void) */ start = max(start, m_start); end = min(end, m_end); + size = end - start + 1; if (end <= start) continue; - e820__range_update(start, end - start + 1, E820_TYPE_RAM, - E820_TYPE_SOFT_RESERVED); + + /* + * Ensure each efi_fake_mem instance results in + * a unique e820 resource + */ + e820__range_remove(start, size, E820_TYPE_RAM, 1); + e820__range_add(start, size, E820_TYPE_SOFT_RESERVED); e820__update_table(e820_table); } } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 029/181] ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device 2020-10-13 23:46 incoming Andrew Morton ` (27 preceding siblings ...) 2020-10-13 23:49 ` [patch 028/181] efi/fake_mem: arrange for a resource entry per efi_fake_mem instance Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 030/181] resource: report parent to walk_iomem_res_desc() callback Andrew Morton ` (151 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device In preparation for exposing "Soft Reserved" memory ranges without an HMAT, move the hmem device registration to its own compilation unit and make the implementation generic. The generic implementation drops usage acpi_map_pxm_to_online_node() that was translating ACPI proximity domain values and instead relies on numa_map_to_online_node() to determine the numa node for the device. [joao.m.martins@oracle.com: CONFIG_DEV_DAX_HMEM_DEVICES should depend on CONFIG_DAX=y] Link: https://lkml.kernel.org/r/8f34727f-ec2d-9395-cb18-969ec8a5d0d4@oracle.com Link: https://lkml.kernel.org/r/159643096584.4062302.5035370788475153738.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lore.kernel.org/r/158318761484.2216124.2049322072599482736.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Signed-off-by: Joao Martins <joao.m.martins@oracle.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/acpi/numa/hmat.c | 68 +++--------------------------------- drivers/dax/Kconfig | 4 ++ drivers/dax/Makefile | 3 - drivers/dax/hmem.c | 56 ----------------------------- drivers/dax/hmem/Makefile | 5 ++ drivers/dax/hmem/device.c | 65 ++++++++++++++++++++++++++++++++++ drivers/dax/hmem/hmem.c | 56 +++++++++++++++++++++++++++++ include/linux/dax.h | 8 ++++ 8 files changed, 145 insertions(+), 120 deletions(-) --- a/drivers/acpi/numa/hmat.c~acpi-hmat-refactor-hmat_register_target_device-to-hmem_register_device +++ a/drivers/acpi/numa/hmat.c @@ -24,6 +24,7 @@ #include <linux/mutex.h> #include <linux/node.h> #include <linux/sysfs.h> +#include <linux/dax.h> static u8 hmat_revision; static int hmat_disable __initdata; @@ -640,66 +641,6 @@ static void hmat_register_target_perf(st node_set_perf_attrs(mem_nid, &target->hmem_attrs, 0); } -static void hmat_register_target_device(struct memory_target *target, - struct resource *r) -{ - /* define a clean / non-busy resource for the platform device */ - struct resource res = { - .start = r->start, - .end = r->end, - .flags = IORESOURCE_MEM, - }; - struct platform_device *pdev; - struct memregion_info info; - int rc, id; - - rc = region_intersects(res.start, resource_size(&res), IORESOURCE_MEM, - IORES_DESC_SOFT_RESERVED); - if (rc != REGION_INTERSECTS) - return; - - id = memregion_alloc(GFP_KERNEL); - if (id < 0) { - pr_err("memregion allocation failure for %pr\n", &res); - return; - } - - pdev = platform_device_alloc("hmem", id); - if (!pdev) { - pr_err("hmem device allocation failure for %pr\n", &res); - goto out_pdev; - } - - pdev->dev.numa_node = acpi_map_pxm_to_online_node(target->memory_pxm); - info = (struct memregion_info) { - .target_node = acpi_map_pxm_to_node(target->memory_pxm), - }; - rc = platform_device_add_data(pdev, &info, sizeof(info)); - if (rc < 0) { - pr_err("hmem memregion_info allocation failure for %pr\n", &res); - goto out_pdev; - } - - rc = platform_device_add_resources(pdev, &res, 1); - if (rc < 0) { - pr_err("hmem resource allocation failure for %pr\n", &res); - goto out_resource; - } - - rc = platform_device_add(pdev); - if (rc < 0) { - dev_err(&pdev->dev, "device add failed for %pr\n", &res); - goto out_resource; - } - - return; - -out_resource: - put_device(&pdev->dev); -out_pdev: - memregion_free(id); -} - static void hmat_register_target_devices(struct memory_target *target) { struct resource *res; @@ -711,8 +652,11 @@ static void hmat_register_target_devices if (!IS_ENABLED(CONFIG_DEV_DAX_HMEM)) return; - for (res = target->memregions.child; res; res = res->sibling) - hmat_register_target_device(target, res); + for (res = target->memregions.child; res; res = res->sibling) { + int target_nid = acpi_map_pxm_to_node(target->memory_pxm); + + hmem_register_device(target_nid, res); + } } static void hmat_register_target(struct memory_target *target) --- a/drivers/dax/hmem.c +++ /dev/null @@ -1,56 +0,0 @@ -// SPDX-License-Identifier: GPL-2.0 -#include <linux/platform_device.h> -#include <linux/memregion.h> -#include <linux/module.h> -#include <linux/pfn_t.h> -#include "bus.h" - -static int dax_hmem_probe(struct platform_device *pdev) -{ - struct device *dev = &pdev->dev; - struct dev_pagemap pgmap = { }; - struct dax_region *dax_region; - struct memregion_info *mri; - struct dev_dax *dev_dax; - struct resource *res; - - res = platform_get_resource(pdev, IORESOURCE_MEM, 0); - if (!res) - return -ENOMEM; - - mri = dev->platform_data; - memcpy(&pgmap.res, res, sizeof(*res)); - - dax_region = alloc_dax_region(dev, pdev->id, res, mri->target_node, - PMD_SIZE, PFN_DEV|PFN_MAP); - if (!dax_region) - return -ENOMEM; - - dev_dax = devm_create_dev_dax(dax_region, 0, &pgmap); - if (IS_ERR(dev_dax)) - return PTR_ERR(dev_dax); - - /* child dev_dax instances now own the lifetime of the dax_region */ - dax_region_put(dax_region); - return 0; -} - -static int dax_hmem_remove(struct platform_device *pdev) -{ - /* devm handles teardown */ - return 0; -} - -static struct platform_driver dax_hmem_driver = { - .probe = dax_hmem_probe, - .remove = dax_hmem_remove, - .driver = { - .name = "hmem", - }, -}; - -module_platform_driver(dax_hmem_driver); - -MODULE_ALIAS("platform:hmem*"); -MODULE_LICENSE("GPL v2"); -MODULE_AUTHOR("Intel Corporation"); --- /dev/null +++ a/drivers/dax/hmem/device.c @@ -0,0 +1,65 @@ +// SPDX-License-Identifier: GPL-2.0 +#include <linux/platform_device.h> +#include <linux/memregion.h> +#include <linux/module.h> +#include <linux/dax.h> +#include <linux/mm.h> + +void hmem_register_device(int target_nid, struct resource *r) +{ + /* define a clean / non-busy resource for the platform device */ + struct resource res = { + .start = r->start, + .end = r->end, + .flags = IORESOURCE_MEM, + }; + struct platform_device *pdev; + struct memregion_info info; + int rc, id; + + rc = region_intersects(res.start, resource_size(&res), IORESOURCE_MEM, + IORES_DESC_SOFT_RESERVED); + if (rc != REGION_INTERSECTS) + return; + + id = memregion_alloc(GFP_KERNEL); + if (id < 0) { + pr_err("memregion allocation failure for %pr\n", &res); + return; + } + + pdev = platform_device_alloc("hmem", id); + if (!pdev) { + pr_err("hmem device allocation failure for %pr\n", &res); + goto out_pdev; + } + + pdev->dev.numa_node = numa_map_to_online_node(target_nid); + info = (struct memregion_info) { + .target_node = target_nid, + }; + rc = platform_device_add_data(pdev, &info, sizeof(info)); + if (rc < 0) { + pr_err("hmem memregion_info allocation failure for %pr\n", &res); + goto out_pdev; + } + + rc = platform_device_add_resources(pdev, &res, 1); + if (rc < 0) { + pr_err("hmem resource allocation failure for %pr\n", &res); + goto out_resource; + } + + rc = platform_device_add(pdev); + if (rc < 0) { + dev_err(&pdev->dev, "device add failed for %pr\n", &res); + goto out_resource; + } + + return; + +out_resource: + put_device(&pdev->dev); +out_pdev: + memregion_free(id); +} --- /dev/null +++ a/drivers/dax/hmem/hmem.c @@ -0,0 +1,56 @@ +// SPDX-License-Identifier: GPL-2.0 +#include <linux/platform_device.h> +#include <linux/memregion.h> +#include <linux/module.h> +#include <linux/pfn_t.h> +#include "../bus.h" + +static int dax_hmem_probe(struct platform_device *pdev) +{ + struct device *dev = &pdev->dev; + struct dev_pagemap pgmap = { }; + struct dax_region *dax_region; + struct memregion_info *mri; + struct dev_dax *dev_dax; + struct resource *res; + + res = platform_get_resource(pdev, IORESOURCE_MEM, 0); + if (!res) + return -ENOMEM; + + mri = dev->platform_data; + memcpy(&pgmap.res, res, sizeof(*res)); + + dax_region = alloc_dax_region(dev, pdev->id, res, mri->target_node, + PMD_SIZE, PFN_DEV|PFN_MAP); + if (!dax_region) + return -ENOMEM; + + dev_dax = devm_create_dev_dax(dax_region, 0, &pgmap); + if (IS_ERR(dev_dax)) + return PTR_ERR(dev_dax); + + /* child dev_dax instances now own the lifetime of the dax_region */ + dax_region_put(dax_region); + return 0; +} + +static int dax_hmem_remove(struct platform_device *pdev) +{ + /* devm handles teardown */ + return 0; +} + +static struct platform_driver dax_hmem_driver = { + .probe = dax_hmem_probe, + .remove = dax_hmem_remove, + .driver = { + .name = "hmem", + }, +}; + +module_platform_driver(dax_hmem_driver); + +MODULE_ALIAS("platform:hmem*"); +MODULE_LICENSE("GPL v2"); +MODULE_AUTHOR("Intel Corporation"); --- /dev/null +++ a/drivers/dax/hmem/Makefile @@ -0,0 +1,5 @@ +# SPDX-License-Identifier: GPL-2.0 +obj-$(CONFIG_DEV_DAX_HMEM) += dax_hmem.o +obj-$(CONFIG_DEV_DAX_HMEM_DEVICES) += device.o + +dax_hmem-y := hmem.o --- a/drivers/dax/Kconfig~acpi-hmat-refactor-hmat_register_target_device-to-hmem_register_device +++ a/drivers/dax/Kconfig @@ -48,6 +48,10 @@ config DEV_DAX_HMEM Say M if unsure. +config DEV_DAX_HMEM_DEVICES + depends on DEV_DAX_HMEM && DAX=y + def_bool y + config DEV_DAX_KMEM tristate "KMEM DAX: volatile-use of persistent memory" default DEV_DAX --- a/drivers/dax/Makefile~acpi-hmat-refactor-hmat_register_target_device-to-hmem_register_device +++ a/drivers/dax/Makefile @@ -2,11 +2,10 @@ obj-$(CONFIG_DAX) += dax.o obj-$(CONFIG_DEV_DAX) += device_dax.o obj-$(CONFIG_DEV_DAX_KMEM) += kmem.o -obj-$(CONFIG_DEV_DAX_HMEM) += dax_hmem.o dax-y := super.o dax-y += bus.o device_dax-y := device.o -dax_hmem-y := hmem.o obj-y += pmem/ +obj-y += hmem/ --- a/include/linux/dax.h~acpi-hmat-refactor-hmat_register_target_device-to-hmem_register_device +++ a/include/linux/dax.h @@ -238,4 +238,12 @@ static inline bool dax_mapping(struct ad return mapping->host && IS_DAX(mapping->host); } +#ifdef CONFIG_DEV_DAX_HMEM_DEVICES +void hmem_register_device(int target_nid, struct resource *r); +#else +static inline void hmem_register_device(int target_nid, struct resource *r) +{ +} +#endif + #endif _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 030/181] resource: report parent to walk_iomem_res_desc() callback 2020-10-13 23:46 incoming Andrew Morton ` (28 preceding siblings ...) 2020-10-13 23:49 ` [patch 029/181] ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 031/181] mm/memory_hotplug: introduce default phys_to_target_node() implementation Andrew Morton ` (150 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: resource: report parent to walk_iomem_res_desc() callback In support of detecting whether a resource might have been been claimed, report the parent to the walk_iomem_res_desc() callback. For example, the ACPI HMAT parser publishes "hmem" platform devices per target range. However, if the HMAT is disabled / missing a fallback driver can attach devices to the raw memory ranges as a fallback if it sees unclaimed / orphan "Soft Reserved" resources in the resource tree. Otherwise, find_next_iomem_res() returns a resource with garbage data from the stack allocation in __walk_iomem_res_desc() for the res->parent field. There are currently no users that expect ->child and ->sibling to be valid, and the resource_lock would be needed to traverse them. Use a compound literal to implicitly zero initialize the fields that are not being returned in addition to setting ->parent. Link: https://lkml.kernel.org/r/159643097166.4062302.11875688887228572793.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Will Deacon <will@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- kernel/resource.c | 11 +++++++---- 1 file changed, 7 insertions(+), 4 deletions(-) --- a/kernel/resource.c~resource-report-parent-to-walk_iomem_res_desc-callback +++ a/kernel/resource.c @@ -382,10 +382,13 @@ static int find_next_iomem_res(resource_ if (p) { /* copy data */ - res->start = max(start, p->start); - res->end = min(end, p->end); - res->flags = p->flags; - res->desc = p->desc; + *res = (struct resource) { + .start = max(start, p->start), + .end = min(end, p->end), + .flags = p->flags, + .desc = p->desc, + .parent = p->parent, + }; } read_unlock(&resource_lock); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 031/181] mm/memory_hotplug: introduce default phys_to_target_node() implementation 2020-10-13 23:46 incoming Andrew Morton ` (29 preceding siblings ...) 2020-10-13 23:49 ` [patch 030/181] resource: report parent to walk_iomem_res_desc() callback Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 032/181] ACPI: HMAT: attach a device for each soft-reserved range Andrew Morton ` (149 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: mm/memory_hotplug: introduce default phys_to_target_node() implementation In preparation to set a fallback value for dev_dax->target_node, introduce generic fallback helpers for phys_to_target_node() A generic implementation based on node-data or memblock was proposed, but as noted by Mike: "Here again, I would prefer to add a weak default for phys_to_target_node() because the "generic" implementation is not really generic. The fallback to reserved ranges is x86 specfic because on x86 most of the reserved areas is not in memblock.memory. AFAIK, no other architecture does this." The info message in the generic memory_add_physaddr_to_nid() implementation is fixed up to properly reflect that memory_add_physaddr_to_nid() communicates "online" node info and phys_to_target_node() indicates "target / to-be-onlined" node info. [akpm@linux-foundation.org: fix CONFIG_MEMORY_HOTPLUG=n build] Link: https://lkml.kernel.org/r/202008252130.7YrHIyMI%25lkp@intel.com Link: https://lkml.kernel.org/r/159643097768.4062302.3135192588966888630.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Jia He <justin.he@arm.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/x86/mm/numa.c | 1 - include/linux/memory_hotplug.h | 23 ++++++++++++++--------- include/linux/numa.h | 11 ----------- mm/memory_hotplug.c | 10 +++++++++- 4 files changed, 23 insertions(+), 22 deletions(-) --- a/arch/x86/mm/numa.c~mm-memory_hotplug-introduce-default-phys_to_target_node-implementation +++ a/arch/x86/mm/numa.c @@ -917,7 +917,6 @@ int phys_to_target_node(phys_addr_t star return meminfo_to_nid(&numa_reserved_meminfo, start); } -EXPORT_SYMBOL_GPL(phys_to_target_node); int memory_add_physaddr_to_nid(u64 start) { --- a/include/linux/memory_hotplug.h~mm-memory_hotplug-introduce-default-phys_to_target_node-implementation +++ a/include/linux/memory_hotplug.h @@ -149,15 +149,6 @@ int add_pages(int nid, unsigned long sta struct mhp_params *params); #endif /* ARCH_HAS_ADD_PAGES */ -#ifdef CONFIG_NUMA -extern int memory_add_physaddr_to_nid(u64 start); -#else -static inline int memory_add_physaddr_to_nid(u64 start) -{ - return 0; -} -#endif - #ifdef CONFIG_HAVE_ARCH_NODEDATA_EXTENSION /* * For supporting node-hotadd, we have to allocate a new pgdat. @@ -284,6 +275,20 @@ static inline bool movable_node_is_enabl } #endif /* ! CONFIG_MEMORY_HOTPLUG */ +#ifdef CONFIG_NUMA +extern int memory_add_physaddr_to_nid(u64 start); +extern int phys_to_target_node(u64 start); +#else +static inline int memory_add_physaddr_to_nid(u64 start) +{ + return 0; +} +static inline int phys_to_target_node(u64 start) +{ + return 0; +} +#endif + #if defined(CONFIG_MEMORY_HOTPLUG) || defined(CONFIG_DEFERRED_STRUCT_PAGE_INIT) /* * pgdat resizing functions --- a/include/linux/numa.h~mm-memory_hotplug-introduce-default-phys_to_target_node-implementation +++ a/include/linux/numa.h @@ -23,22 +23,11 @@ #ifdef CONFIG_NUMA /* Generic implementation available */ int numa_map_to_online_node(int node); - -/* - * Optional architecture specific implementation, users need a "depends - * on $ARCH" - */ -int phys_to_target_node(phys_addr_t addr); #else static inline int numa_map_to_online_node(int node) { return NUMA_NO_NODE; } - -static inline int phys_to_target_node(phys_addr_t addr) -{ - return NUMA_NO_NODE; -} #endif #endif /* _LINUX_NUMA_H */ --- a/mm/memory_hotplug.c~mm-memory_hotplug-introduce-default-phys_to_target_node-implementation +++ a/mm/memory_hotplug.c @@ -353,11 +353,19 @@ int __ref __add_pages(int nid, unsigned #ifdef CONFIG_NUMA int __weak memory_add_physaddr_to_nid(u64 start) { - pr_info_once("Unknown target node for memory at 0x%llx, assuming node 0\n", + pr_info_once("Unknown online node for memory at 0x%llx, assuming node 0\n", start); return 0; } EXPORT_SYMBOL_GPL(memory_add_physaddr_to_nid); + +int __weak phys_to_target_node(u64 start) +{ + pr_info_once("Unknown target node for memory at 0x%llx, assuming node 0\n", + start); + return 0; +} +EXPORT_SYMBOL_GPL(phys_to_target_node); #endif /* find the smallest valid pfn in the range [start_pfn, end_pfn) */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 032/181] ACPI: HMAT: attach a device for each soft-reserved range 2020-10-13 23:46 incoming Andrew Morton ` (30 preceding siblings ...) 2020-10-13 23:49 ` [patch 031/181] mm/memory_hotplug: introduce default phys_to_target_node() implementation Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 033/181] device-dax: drop the dax_region.pfn_flags attribute Andrew Morton ` (148 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: ACPI: HMAT: attach a device for each soft-reserved range The hmem enabling in commit cf8741ac57ed ("ACPI: NUMA: HMAT: Register "soft reserved" memory as an "hmem" device") only registered ranges to the hmem driver for each soft-reservation that also appeared in the HMAT. While this is meant to encourage platform firmware to "do the right thing" and publish an HMAT, the corollary is that platforms that fail to publish an accurate HMAT will strand memory from Linux usage. Additionally, the "efi_fake_mem" kernel command line option enabling will strand memory by default without an HMAT. Arrange for "soft reserved" memory that goes unclaimed by HMAT entries to be published as raw resource ranges for the hmem driver to consume. Include a module parameter to disable either this fallback behavior, or the hmat enabling from creating hmem devices. The module parameter requires the hmem device enabling to have unique name in the module namespace: "device_hmem". The driver depends on the architecture providing phys_to_target_node() which is only x86 via numa_meminfo() and arm64 via a generic memblock implementation. [joao.m.martins@oracle.com: require NUMA_KEEP_MEMINFO for phys_to_target_node()] Link: https://lkml.kernel.org/r/aaae71a7-4846-f5cc-5acf-cf05fdb1f2dc@oracle.com Link: https://lkml.kernel.org/r/159643098298.4062302.17587338161136144730.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Signed-off-by: Joao Martins <joao.m.martins@oracle.com> Reviewed-by: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Will Deacon <will@kernel.org> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jia He <justin.he@arm.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Rafael J. Wysocki <rafael.j.wysocki@intel.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/Kconfig | 2 ++ drivers/dax/hmem/Makefile | 3 ++- drivers/dax/hmem/device.c | 35 +++++++++++++++++++++++++++++++++++ 3 files changed, 39 insertions(+), 1 deletion(-) --- a/drivers/dax/hmem/device.c~acpi-hmat-attach-a-device-for-each-soft-reserved-range +++ a/drivers/dax/hmem/device.c @@ -5,6 +5,9 @@ #include <linux/dax.h> #include <linux/mm.h> +static bool nohmem; +module_param_named(disable, nohmem, bool, 0444); + void hmem_register_device(int target_nid, struct resource *r) { /* define a clean / non-busy resource for the platform device */ @@ -17,6 +20,9 @@ void hmem_register_device(int target_nid struct memregion_info info; int rc, id; + if (nohmem) + return; + rc = region_intersects(res.start, resource_size(&res), IORESOURCE_MEM, IORES_DESC_SOFT_RESERVED); if (rc != REGION_INTERSECTS) @@ -63,3 +69,32 @@ out_resource: out_pdev: memregion_free(id); } + +static __init int hmem_register_one(struct resource *res, void *data) +{ + /* + * If the resource is not a top-level resource it was already + * assigned to a device by the HMAT parsing. + */ + if (res->parent != &iomem_resource) { + pr_info("HMEM: skip %pr, already claimed\n", res); + return 0; + } + + hmem_register_device(phys_to_target_node(res->start), res); + + return 0; +} + +static __init int hmem_init(void) +{ + walk_iomem_res_desc(IORES_DESC_SOFT_RESERVED, + IORESOURCE_MEM, 0, -1, NULL, hmem_register_one); + return 0; +} + +/* + * As this is a fallback for address ranges unclaimed by the ACPI HMAT + * parsing it must be at an initcall level greater than hmat_init(). + */ +late_initcall(hmem_init); --- a/drivers/dax/hmem/Makefile~acpi-hmat-attach-a-device-for-each-soft-reserved-range +++ a/drivers/dax/hmem/Makefile @@ -1,5 +1,6 @@ # SPDX-License-Identifier: GPL-2.0 obj-$(CONFIG_DEV_DAX_HMEM) += dax_hmem.o -obj-$(CONFIG_DEV_DAX_HMEM_DEVICES) += device.o +obj-$(CONFIG_DEV_DAX_HMEM_DEVICES) += device_hmem.o +device_hmem-y := device.o dax_hmem-y := hmem.o --- a/drivers/dax/Kconfig~acpi-hmat-attach-a-device-for-each-soft-reserved-range +++ a/drivers/dax/Kconfig @@ -35,6 +35,7 @@ config DEV_DAX_PMEM config DEV_DAX_HMEM tristate "HMEM DAX: direct access to 'specific purpose' memory" depends on EFI_SOFT_RESERVE + select NUMA_KEEP_MEMINFO if (NUMA && X86) default DEV_DAX help EFI 2.8 platforms, and others, may advertise 'specific purpose' @@ -49,6 +50,7 @@ config DEV_DAX_HMEM Say M if unsure. config DEV_DAX_HMEM_DEVICES + depends on NUMA_KEEP_MEMINFO # for phys_to_target_node() depends on DEV_DAX_HMEM && DAX=y def_bool y _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 033/181] device-dax: drop the dax_region.pfn_flags attribute 2020-10-13 23:46 incoming Andrew Morton ` (31 preceding siblings ...) 2020-10-13 23:49 ` [patch 032/181] ACPI: HMAT: attach a device for each soft-reserved range Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 034/181] device-dax: move instance creation parameters to 'struct dev_dax_data' Andrew Morton ` (147 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: drop the dax_region.pfn_flags attribute All callers specify the same flags to alloc_dax_region(), so there is no need to allow for anything other than PFN_DEV|PFN_MAP, or carry a ->pfn_flags around on the region. Device-dax instances are always page backed. Link: https://lkml.kernel.org/r/159643098829.4062302.13611520567669439046.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 4 +--- drivers/dax/bus.h | 3 +-- drivers/dax/dax-private.h | 2 -- drivers/dax/device.c | 26 +++----------------------- drivers/dax/hmem/hmem.c | 2 +- drivers/dax/pmem/core.c | 3 +-- 6 files changed, 7 insertions(+), 33 deletions(-) --- a/drivers/dax/bus.c~device-dax-drop-the-dax_regionpfn_flags-attribute +++ a/drivers/dax/bus.c @@ -226,8 +226,7 @@ static void dax_region_unregister(void * } struct dax_region *alloc_dax_region(struct device *parent, int region_id, - struct resource *res, int target_node, unsigned int align, - unsigned long long pfn_flags) + struct resource *res, int target_node, unsigned int align) { struct dax_region *dax_region; @@ -251,7 +250,6 @@ struct dax_region *alloc_dax_region(stru dev_set_drvdata(parent, dax_region); memcpy(&dax_region->res, res, sizeof(*res)); - dax_region->pfn_flags = pfn_flags; kref_init(&dax_region->kref); dax_region->id = region_id; dax_region->align = align; --- a/drivers/dax/bus.h~device-dax-drop-the-dax_regionpfn_flags-attribute +++ a/drivers/dax/bus.h @@ -10,8 +10,7 @@ struct dax_device; struct dax_region; void dax_region_put(struct dax_region *dax_region); struct dax_region *alloc_dax_region(struct device *parent, int region_id, - struct resource *res, int target_node, unsigned int align, - unsigned long long flags); + struct resource *res, int target_node, unsigned int align); enum dev_dax_subsys { DEV_DAX_BUS, --- a/drivers/dax/dax-private.h~device-dax-drop-the-dax_regionpfn_flags-attribute +++ a/drivers/dax/dax-private.h @@ -23,7 +23,6 @@ void dax_bus_exit(void); * @dev: parent device backing this region * @align: allocation and mapping alignment for child dax devices * @res: physical address range of the region - * @pfn_flags: identify whether the pfns are paged back or not */ struct dax_region { int id; @@ -32,7 +31,6 @@ struct dax_region { struct device *dev; unsigned int align; struct resource res; - unsigned long long pfn_flags; }; /** --- a/drivers/dax/device.c~device-dax-drop-the-dax_regionpfn_flags-attribute +++ a/drivers/dax/device.c @@ -41,14 +41,6 @@ static int check_vma(struct dev_dax *dev return -EINVAL; } - if ((dax_region->pfn_flags & (PFN_DEV|PFN_MAP)) == PFN_DEV - && (vma->vm_flags & VM_DONTCOPY) == 0) { - dev_info_ratelimited(dev, - "%s: %s: fail, dax range requires MADV_DONTFORK\n", - current->comm, func); - return -EINVAL; - } - if (!vma_is_dax(vma)) { dev_info_ratelimited(dev, "%s: %s: fail, vma is not DAX capable\n", @@ -102,7 +94,7 @@ static vm_fault_t __dev_dax_pte_fault(st return VM_FAULT_SIGBUS; } - *pfn = phys_to_pfn_t(phys, dax_region->pfn_flags); + *pfn = phys_to_pfn_t(phys, PFN_DEV|PFN_MAP); return vmf_insert_mixed(vmf->vma, vmf->address, *pfn); } @@ -127,12 +119,6 @@ static vm_fault_t __dev_dax_pmd_fault(st return VM_FAULT_SIGBUS; } - /* dax pmd mappings require pfn_t_devmap() */ - if ((dax_region->pfn_flags & (PFN_DEV|PFN_MAP)) != (PFN_DEV|PFN_MAP)) { - dev_dbg(dev, "region lacks devmap flags\n"); - return VM_FAULT_SIGBUS; - } - if (fault_size < dax_region->align) return VM_FAULT_SIGBUS; else if (fault_size > dax_region->align) @@ -150,7 +136,7 @@ static vm_fault_t __dev_dax_pmd_fault(st return VM_FAULT_SIGBUS; } - *pfn = phys_to_pfn_t(phys, dax_region->pfn_flags); + *pfn = phys_to_pfn_t(phys, PFN_DEV|PFN_MAP); return vmf_insert_pfn_pmd(vmf, *pfn, vmf->flags & FAULT_FLAG_WRITE); } @@ -177,12 +163,6 @@ static vm_fault_t __dev_dax_pud_fault(st return VM_FAULT_SIGBUS; } - /* dax pud mappings require pfn_t_devmap() */ - if ((dax_region->pfn_flags & (PFN_DEV|PFN_MAP)) != (PFN_DEV|PFN_MAP)) { - dev_dbg(dev, "region lacks devmap flags\n"); - return VM_FAULT_SIGBUS; - } - if (fault_size < dax_region->align) return VM_FAULT_SIGBUS; else if (fault_size > dax_region->align) @@ -200,7 +180,7 @@ static vm_fault_t __dev_dax_pud_fault(st return VM_FAULT_SIGBUS; } - *pfn = phys_to_pfn_t(phys, dax_region->pfn_flags); + *pfn = phys_to_pfn_t(phys, PFN_DEV|PFN_MAP); return vmf_insert_pfn_pud(vmf, *pfn, vmf->flags & FAULT_FLAG_WRITE); } --- a/drivers/dax/hmem/hmem.c~device-dax-drop-the-dax_regionpfn_flags-attribute +++ a/drivers/dax/hmem/hmem.c @@ -22,7 +22,7 @@ static int dax_hmem_probe(struct platfor memcpy(&pgmap.res, res, sizeof(*res)); dax_region = alloc_dax_region(dev, pdev->id, res, mri->target_node, - PMD_SIZE, PFN_DEV|PFN_MAP); + PMD_SIZE); if (!dax_region) return -ENOMEM; --- a/drivers/dax/pmem/core.c~device-dax-drop-the-dax_regionpfn_flags-attribute +++ a/drivers/dax/pmem/core.c @@ -53,8 +53,7 @@ struct dev_dax *__dax_pmem_probe(struct memcpy(&res, &pgmap.res, sizeof(res)); res.start += offset; dax_region = alloc_dax_region(dev, region_id, &res, - nd_region->target_node, le32_to_cpu(pfn_sb->align), - PFN_DEV|PFN_MAP); + nd_region->target_node, le32_to_cpu(pfn_sb->align)); if (!dax_region) return ERR_PTR(-ENOMEM); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 034/181] device-dax: move instance creation parameters to 'struct dev_dax_data' 2020-10-13 23:46 incoming Andrew Morton ` (32 preceding siblings ...) 2020-10-13 23:49 ` [patch 033/181] device-dax: drop the dax_region.pfn_flags attribute Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 035/181] device-dax: make pgmap optional for instance creation Andrew Morton ` (146 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: move instance creation parameters to 'struct dev_dax_data' In preparation for adding more parameters to instance creation, move existing parameters to a new struct. Link: https://lkml.kernel.org/r/159643099411.4062302.1337305960720423895.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Vivek Goyal <vgoyal@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 14 +++++++------- drivers/dax/bus.h | 16 ++++++++-------- drivers/dax/hmem/hmem.c | 8 +++++++- drivers/dax/pmem/core.c | 9 ++++++++- 4 files changed, 30 insertions(+), 17 deletions(-) --- a/drivers/dax/bus.c~device-dax-move-instance-creation-parameters-to-struct-dev_dax_data +++ a/drivers/dax/bus.c @@ -395,9 +395,9 @@ static void unregister_dev_dax(void *dev put_device(dev); } -struct dev_dax *__devm_create_dev_dax(struct dax_region *dax_region, int id, - struct dev_pagemap *pgmap, enum dev_dax_subsys subsys) +struct dev_dax *devm_create_dev_dax(struct dev_dax_data *data) { + struct dax_region *dax_region = data->dax_region; struct device *parent = dax_region->dev; struct dax_device *dax_dev; struct dev_dax *dev_dax; @@ -405,14 +405,14 @@ struct dev_dax *__devm_create_dev_dax(st struct device *dev; int rc = -ENOMEM; - if (id < 0) + if (data->id < 0) return ERR_PTR(-EINVAL); dev_dax = kzalloc(sizeof(*dev_dax), GFP_KERNEL); if (!dev_dax) return ERR_PTR(-ENOMEM); - memcpy(&dev_dax->pgmap, pgmap, sizeof(*pgmap)); + memcpy(&dev_dax->pgmap, data->pgmap, sizeof(struct dev_pagemap)); /* * No 'host' or dax_operations since there is no access to this @@ -438,13 +438,13 @@ struct dev_dax *__devm_create_dev_dax(st inode = dax_inode(dax_dev); dev->devt = inode->i_rdev; - if (subsys == DEV_DAX_BUS) + if (data->subsys == DEV_DAX_BUS) dev->bus = &dax_bus_type; else dev->class = dax_class; dev->parent = parent; dev->type = &dev_dax_type; - dev_set_name(dev, "dax%d.%d", dax_region->id, id); + dev_set_name(dev, "dax%d.%d", dax_region->id, data->id); rc = device_add(dev); if (rc) { @@ -464,7 +464,7 @@ struct dev_dax *__devm_create_dev_dax(st return ERR_PTR(rc); } -EXPORT_SYMBOL_GPL(__devm_create_dev_dax); +EXPORT_SYMBOL_GPL(devm_create_dev_dax); static int match_always_count; --- a/drivers/dax/bus.h~device-dax-move-instance-creation-parameters-to-struct-dev_dax_data +++ a/drivers/dax/bus.h @@ -13,18 +13,18 @@ struct dax_region *alloc_dax_region(stru struct resource *res, int target_node, unsigned int align); enum dev_dax_subsys { - DEV_DAX_BUS, + DEV_DAX_BUS = 0, /* zeroed dev_dax_data picks this by default */ DEV_DAX_CLASS, }; -struct dev_dax *__devm_create_dev_dax(struct dax_region *dax_region, int id, - struct dev_pagemap *pgmap, enum dev_dax_subsys subsys); +struct dev_dax_data { + struct dax_region *dax_region; + struct dev_pagemap *pgmap; + enum dev_dax_subsys subsys; + int id; +}; -static inline struct dev_dax *devm_create_dev_dax(struct dax_region *dax_region, - int id, struct dev_pagemap *pgmap) -{ - return __devm_create_dev_dax(dax_region, id, pgmap, DEV_DAX_BUS); -} +struct dev_dax *devm_create_dev_dax(struct dev_dax_data *data); /* to be deleted when DEV_DAX_CLASS is removed */ struct dev_dax *__dax_pmem_probe(struct device *dev, enum dev_dax_subsys subsys); --- a/drivers/dax/hmem/hmem.c~device-dax-move-instance-creation-parameters-to-struct-dev_dax_data +++ a/drivers/dax/hmem/hmem.c @@ -11,6 +11,7 @@ static int dax_hmem_probe(struct platfor struct dev_pagemap pgmap = { }; struct dax_region *dax_region; struct memregion_info *mri; + struct dev_dax_data data; struct dev_dax *dev_dax; struct resource *res; @@ -26,7 +27,12 @@ static int dax_hmem_probe(struct platfor if (!dax_region) return -ENOMEM; - dev_dax = devm_create_dev_dax(dax_region, 0, &pgmap); + data = (struct dev_dax_data) { + .dax_region = dax_region, + .id = 0, + .pgmap = &pgmap, + }; + dev_dax = devm_create_dev_dax(&data); if (IS_ERR(dev_dax)) return PTR_ERR(dev_dax); --- a/drivers/dax/pmem/core.c~device-dax-move-instance-creation-parameters-to-struct-dev_dax_data +++ a/drivers/dax/pmem/core.c @@ -14,6 +14,7 @@ struct dev_dax *__dax_pmem_probe(struct resource_size_t offset; struct nd_pfn_sb *pfn_sb; struct dev_dax *dev_dax; + struct dev_dax_data data; struct nd_namespace_io *nsio; struct dax_region *dax_region; struct dev_pagemap pgmap = { }; @@ -57,7 +58,13 @@ struct dev_dax *__dax_pmem_probe(struct if (!dax_region) return ERR_PTR(-ENOMEM); - dev_dax = __devm_create_dev_dax(dax_region, id, &pgmap, subsys); + data = (struct dev_dax_data) { + .dax_region = dax_region, + .id = id, + .pgmap = &pgmap, + .subsys = subsys, + }; + dev_dax = devm_create_dev_dax(&data); /* child dev_dax instances now own the lifetime of the dax_region */ dax_region_put(dax_region); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 035/181] device-dax: make pgmap optional for instance creation 2020-10-13 23:46 incoming Andrew Morton ` (33 preceding siblings ...) 2020-10-13 23:49 ` [patch 034/181] device-dax: move instance creation parameters to 'struct dev_dax_data' Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 036/181] device-dax/kmem: introduce dax_kmem_range() Andrew Morton ` (145 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: make pgmap optional for instance creation The passed in dev_pagemap is only required in the pmem case as the libnvdimm core may have reserved a vmem_altmap for dev_memremap_pages() to place the memmap in pmem directly. In the hmem case there is no agent reserving an altmap so it can all be handled by a core internal default. Pass the resource range via a new @range property of 'struct dev_dax_data'. Link: https://lkml.kernel.org/r/159643099958.4062302.10379230791041872886.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106110513.30709.4303239334850606031.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 29 +++++++++++++++-------------- drivers/dax/bus.h | 2 ++ drivers/dax/dax-private.h | 9 ++++++++- drivers/dax/device.c | 28 +++++++++++++++++++--------- drivers/dax/hmem/hmem.c | 8 ++++---- drivers/dax/kmem.c | 12 ++++++------ drivers/dax/pmem/core.c | 4 ++++ tools/testing/nvdimm/dax-dev.c | 8 ++++---- 8 files changed, 62 insertions(+), 38 deletions(-) --- a/drivers/dax/bus.c~device-dax-make-pgmap-optional-for-instance-creation +++ a/drivers/dax/bus.c @@ -271,7 +271,7 @@ static ssize_t size_show(struct device * struct device_attribute *attr, char *buf) { struct dev_dax *dev_dax = to_dev_dax(dev); - unsigned long long size = resource_size(&dev_dax->region->res); + unsigned long long size = range_len(&dev_dax->range); return sprintf(buf, "%llu\n", size); } @@ -293,19 +293,12 @@ static ssize_t target_node_show(struct d } static DEVICE_ATTR_RO(target_node); -static unsigned long long dev_dax_resource(struct dev_dax *dev_dax) -{ - struct dax_region *dax_region = dev_dax->region; - - return dax_region->res.start; -} - static ssize_t resource_show(struct device *dev, struct device_attribute *attr, char *buf) { struct dev_dax *dev_dax = to_dev_dax(dev); - return sprintf(buf, "%#llx\n", dev_dax_resource(dev_dax)); + return sprintf(buf, "%#llx\n", dev_dax->range.start); } static DEVICE_ATTR(resource, 0400, resource_show, NULL); @@ -376,6 +369,7 @@ static void dev_dax_release(struct devic dax_region_put(dax_region); put_dax(dax_dev); + kfree(dev_dax->pgmap); kfree(dev_dax); } @@ -412,7 +406,12 @@ struct dev_dax *devm_create_dev_dax(stru if (!dev_dax) return ERR_PTR(-ENOMEM); - memcpy(&dev_dax->pgmap, data->pgmap, sizeof(struct dev_pagemap)); + if (data->pgmap) { + dev_dax->pgmap = kmemdup(data->pgmap, + sizeof(struct dev_pagemap), GFP_KERNEL); + if (!dev_dax->pgmap) + goto err_pgmap; + } /* * No 'host' or dax_operations since there is no access to this @@ -421,18 +420,19 @@ struct dev_dax *devm_create_dev_dax(stru dax_dev = alloc_dax(dev_dax, NULL, NULL, DAXDEV_F_SYNC); if (IS_ERR(dax_dev)) { rc = PTR_ERR(dax_dev); - goto err; + goto err_alloc_dax; } /* a device_dax instance is dead while the driver is not attached */ kill_dax(dax_dev); - /* from here on we're committed to teardown via dax_dev_release() */ + /* from here on we're committed to teardown via dev_dax_release() */ dev = &dev_dax->dev; device_initialize(dev); dev_dax->dax_dev = dax_dev; dev_dax->region = dax_region; + dev_dax->range = data->range; dev_dax->target_node = dax_region->target_node; kref_get(&dax_region->kref); @@ -458,8 +458,9 @@ struct dev_dax *devm_create_dev_dax(stru return ERR_PTR(rc); return dev_dax; - - err: +err_alloc_dax: + kfree(dev_dax->pgmap); +err_pgmap: kfree(dev_dax); return ERR_PTR(rc); --- a/drivers/dax/bus.h~device-dax-make-pgmap-optional-for-instance-creation +++ a/drivers/dax/bus.h @@ -3,6 +3,7 @@ #ifndef __DAX_BUS_H__ #define __DAX_BUS_H__ #include <linux/device.h> +#include <linux/range.h> struct dev_dax; struct resource; @@ -21,6 +22,7 @@ struct dev_dax_data { struct dax_region *dax_region; struct dev_pagemap *pgmap; enum dev_dax_subsys subsys; + struct range range; int id; }; --- a/drivers/dax/dax-private.h~device-dax-make-pgmap-optional-for-instance-creation +++ a/drivers/dax/dax-private.h @@ -41,6 +41,7 @@ struct dax_region { * @target_node: effective numa node if dev_dax memory range is onlined * @dev - device core * @pgmap - pgmap for memmap setup / lifetime (driver owned) + * @range: resource range for the instance * @dax_mem_res: physical address range of hotadded DAX memory * @dax_mem_name: name for hotadded DAX memory via add_memory_driver_managed() */ @@ -49,10 +50,16 @@ struct dev_dax { struct dax_device *dax_dev; int target_node; struct device dev; - struct dev_pagemap pgmap; + struct dev_pagemap *pgmap; + struct range range; struct resource *dax_kmem_res; }; +static inline u64 range_len(struct range *range) +{ + return range->end - range->start + 1; +} + static inline struct dev_dax *to_dev_dax(struct device *dev) { return container_of(dev, struct dev_dax, dev); --- a/drivers/dax/device.c~device-dax-make-pgmap-optional-for-instance-creation +++ a/drivers/dax/device.c @@ -55,12 +55,12 @@ static int check_vma(struct dev_dax *dev __weak phys_addr_t dax_pgoff_to_phys(struct dev_dax *dev_dax, pgoff_t pgoff, unsigned long size) { - struct resource *res = &dev_dax->region->res; + struct range *range = &dev_dax->range; phys_addr_t phys; - phys = pgoff * PAGE_SIZE + res->start; - if (phys >= res->start && phys <= res->end) { - if (phys + size - 1 <= res->end) + phys = pgoff * PAGE_SIZE + range->start; + if (phys >= range->start && phys <= range->end) { + if (phys + size - 1 <= range->end) return phys; } @@ -396,21 +396,31 @@ int dev_dax_probe(struct device *dev) { struct dev_dax *dev_dax = to_dev_dax(dev); struct dax_device *dax_dev = dev_dax->dax_dev; - struct resource *res = &dev_dax->region->res; + struct range *range = &dev_dax->range; + struct dev_pagemap *pgmap; struct inode *inode; struct cdev *cdev; void *addr; int rc; /* 1:1 map region resource range to device-dax instance range */ - if (!devm_request_mem_region(dev, res->start, resource_size(res), + if (!devm_request_mem_region(dev, range->start, range_len(range), dev_name(dev))) { - dev_warn(dev, "could not reserve region %pR\n", res); + dev_warn(dev, "could not reserve range: %#llx - %#llx\n", + range->start, range->end); return -EBUSY; } - dev_dax->pgmap.type = MEMORY_DEVICE_GENERIC; - addr = devm_memremap_pages(dev, &dev_dax->pgmap); + pgmap = dev_dax->pgmap; + if (!pgmap) { + pgmap = devm_kzalloc(dev, sizeof(*pgmap), GFP_KERNEL); + if (!pgmap) + return -ENOMEM; + pgmap->res.start = range->start; + pgmap->res.end = range->end; + } + pgmap->type = MEMORY_DEVICE_GENERIC; + addr = devm_memremap_pages(dev, pgmap); if (IS_ERR(addr)) return PTR_ERR(addr); --- a/drivers/dax/hmem/hmem.c~device-dax-make-pgmap-optional-for-instance-creation +++ a/drivers/dax/hmem/hmem.c @@ -8,7 +8,6 @@ static int dax_hmem_probe(struct platform_device *pdev) { struct device *dev = &pdev->dev; - struct dev_pagemap pgmap = { }; struct dax_region *dax_region; struct memregion_info *mri; struct dev_dax_data data; @@ -20,8 +19,6 @@ static int dax_hmem_probe(struct platfor return -ENOMEM; mri = dev->platform_data; - memcpy(&pgmap.res, res, sizeof(*res)); - dax_region = alloc_dax_region(dev, pdev->id, res, mri->target_node, PMD_SIZE); if (!dax_region) @@ -30,7 +27,10 @@ static int dax_hmem_probe(struct platfor data = (struct dev_dax_data) { .dax_region = dax_region, .id = 0, - .pgmap = &pgmap, + .range = { + .start = res->start, + .end = res->end, + }, }; dev_dax = devm_create_dev_dax(&data); if (IS_ERR(dev_dax)) --- a/drivers/dax/kmem.c~device-dax-make-pgmap-optional-for-instance-creation +++ a/drivers/dax/kmem.c @@ -22,7 +22,7 @@ static bool any_hotremove_failed; int dev_dax_kmem_probe(struct device *dev) { struct dev_dax *dev_dax = to_dev_dax(dev); - struct resource *res = &dev_dax->region->res; + struct range *range = &dev_dax->range; resource_size_t kmem_start; resource_size_t kmem_size; resource_size_t kmem_end; @@ -39,17 +39,17 @@ int dev_dax_kmem_probe(struct device *de */ numa_node = dev_dax->target_node; if (numa_node < 0) { - dev_warn(dev, "rejecting DAX region %pR with invalid node: %d\n", - res, numa_node); + dev_warn(dev, "rejecting DAX region with invalid node: %d\n", + numa_node); return -EINVAL; } /* Hotplug starting at the beginning of the next block: */ - kmem_start = ALIGN(res->start, memory_block_size_bytes()); + kmem_start = ALIGN(range->start, memory_block_size_bytes()); - kmem_size = resource_size(res); + kmem_size = range_len(range); /* Adjust the size down to compensate for moving up kmem_start: */ - kmem_size -= kmem_start - res->start; + kmem_size -= kmem_start - range->start; /* Align the size down to cover only complete blocks: */ kmem_size &= ~(memory_block_size_bytes() - 1); kmem_end = kmem_start + kmem_size; --- a/drivers/dax/pmem/core.c~device-dax-make-pgmap-optional-for-instance-creation +++ a/drivers/dax/pmem/core.c @@ -63,6 +63,10 @@ struct dev_dax *__dax_pmem_probe(struct .id = id, .pgmap = &pgmap, .subsys = subsys, + .range = { + .start = res.start, + .end = res.end, + }, }; dev_dax = devm_create_dev_dax(&data); --- a/tools/testing/nvdimm/dax-dev.c~device-dax-make-pgmap-optional-for-instance-creation +++ a/tools/testing/nvdimm/dax-dev.c @@ -9,12 +9,12 @@ phys_addr_t dax_pgoff_to_phys(struct dev_dax *dev_dax, pgoff_t pgoff, unsigned long size) { - struct resource *res = &dev_dax->region->res; + struct range *range = &dev_dax->range; phys_addr_t addr; - addr = pgoff * PAGE_SIZE + res->start; - if (addr >= res->start && addr <= res->end) { - if (addr + size - 1 <= res->end) { + addr = pgoff * PAGE_SIZE + range->start; + if (addr >= range->start && addr <= range->end) { + if (addr + size - 1 <= range->end) { if (get_nfit_res(addr)) { struct page *page; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 036/181] device-dax/kmem: introduce dax_kmem_range() 2020-10-13 23:46 incoming Andrew Morton ` (34 preceding siblings ...) 2020-10-13 23:49 ` [patch 035/181] device-dax: make pgmap optional for instance creation Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 037/181] device-dax/kmem: move resource name tracking to drvdata Andrew Morton ` (144 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax/kmem: introduce dax_kmem_range() Towards removing the mode specific @dax_kmem_res attribute from the generic 'struct dev_dax', and preparing for multi-range support, teach the driver to calculate the hotplug range from the device range. The hotplug range is the trivially calculated memory-block-size aligned version of the device range. Link: https://lkml.kernel.org/r/160106111109.30709.3173462396758431559.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/kmem.c | 40 +++++++++++++++++----------------------- 1 file changed, 17 insertions(+), 23 deletions(-) --- a/drivers/dax/kmem.c~device-dax-kmem-introduce-dax_kmem_range +++ a/drivers/dax/kmem.c @@ -19,13 +19,20 @@ static const char *kmem_name; /* Set if any memory will remain added when the driver will be unloaded. */ static bool any_hotremove_failed; +static struct range dax_kmem_range(struct dev_dax *dev_dax) +{ + struct range range; + + /* memory-block align the hotplug range */ + range.start = ALIGN(dev_dax->range.start, memory_block_size_bytes()); + range.end = ALIGN_DOWN(dev_dax->range.end + 1, memory_block_size_bytes()) - 1; + return range; +} + int dev_dax_kmem_probe(struct device *dev) { struct dev_dax *dev_dax = to_dev_dax(dev); - struct range *range = &dev_dax->range; - resource_size_t kmem_start; - resource_size_t kmem_size; - resource_size_t kmem_end; + struct range range = dax_kmem_range(dev_dax); struct resource *new_res; const char *new_res_name; int numa_node; @@ -44,25 +51,14 @@ int dev_dax_kmem_probe(struct device *de return -EINVAL; } - /* Hotplug starting at the beginning of the next block: */ - kmem_start = ALIGN(range->start, memory_block_size_bytes()); - - kmem_size = range_len(range); - /* Adjust the size down to compensate for moving up kmem_start: */ - kmem_size -= kmem_start - range->start; - /* Align the size down to cover only complete blocks: */ - kmem_size &= ~(memory_block_size_bytes() - 1); - kmem_end = kmem_start + kmem_size; - new_res_name = kstrdup(dev_name(dev), GFP_KERNEL); if (!new_res_name) return -ENOMEM; /* Region is permanently reserved if hotremove fails. */ - new_res = request_mem_region(kmem_start, kmem_size, new_res_name); + new_res = request_mem_region(range.start, range_len(&range), new_res_name); if (!new_res) { - dev_warn(dev, "could not reserve region [%pa-%pa]\n", - &kmem_start, &kmem_end); + dev_warn(dev, "could not reserve region [%#llx-%#llx]\n", range.start, range.end); kfree(new_res_name); return -EBUSY; } @@ -96,9 +92,8 @@ int dev_dax_kmem_probe(struct device *de static int dev_dax_kmem_remove(struct device *dev) { struct dev_dax *dev_dax = to_dev_dax(dev); + struct range range = dax_kmem_range(dev_dax); struct resource *res = dev_dax->dax_kmem_res; - resource_size_t kmem_start = res->start; - resource_size_t kmem_size = resource_size(res); const char *res_name = res->name; int rc; @@ -108,12 +103,11 @@ static int dev_dax_kmem_remove(struct de * there is no way to hotremove this memory until reboot because device * unbind will succeed even if we return failure. */ - rc = remove_memory(dev_dax->target_node, kmem_start, kmem_size); + rc = remove_memory(dev_dax->target_node, range.start, range_len(&range)); if (rc) { any_hotremove_failed = true; - dev_err(dev, - "DAX region %pR cannot be hotremoved until the next reboot\n", - res); + dev_err(dev, "%#llx-%#llx cannot be hotremoved until the next reboot\n", + range.start, range.end); return rc; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 037/181] device-dax/kmem: move resource name tracking to drvdata 2020-10-13 23:46 incoming Andrew Morton ` (35 preceding siblings ...) 2020-10-13 23:49 ` [patch 036/181] device-dax/kmem: introduce dax_kmem_range() Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:49 ` [patch 038/181] device-dax/kmem: replace release_resource() with release_mem_region() Andrew Morton ` (143 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax/kmem: move resource name tracking to drvdata Towards removing the mode specific @dax_kmem_res attribute from the generic 'struct dev_dax', and preparing for multi-range support, move resource name tracking to driver data. The memory for the resource name needs to have its own lifetime separate from the device bind lifetime for cases where the driver is unbound, but the kmem range could not be unplugged from the page allocator. Link: https://lkml.kernel.org/r/160106111639.30709.17624822766862009183.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/kmem.c | 16 +++++++++------- 1 file changed, 9 insertions(+), 7 deletions(-) --- a/drivers/dax/kmem.c~device-dax-kmem-move-resource-name-tracking-to-drvdata +++ a/drivers/dax/kmem.c @@ -34,7 +34,7 @@ int dev_dax_kmem_probe(struct device *de struct dev_dax *dev_dax = to_dev_dax(dev); struct range range = dax_kmem_range(dev_dax); struct resource *new_res; - const char *new_res_name; + char *res_name; int numa_node; int rc; @@ -51,15 +51,15 @@ int dev_dax_kmem_probe(struct device *de return -EINVAL; } - new_res_name = kstrdup(dev_name(dev), GFP_KERNEL); - if (!new_res_name) + res_name = kstrdup(dev_name(dev), GFP_KERNEL); + if (!res_name) return -ENOMEM; /* Region is permanently reserved if hotremove fails. */ - new_res = request_mem_region(range.start, range_len(&range), new_res_name); + new_res = request_mem_region(range.start, range_len(&range), res_name); if (!new_res) { dev_warn(dev, "could not reserve region [%#llx-%#llx]\n", range.start, range.end); - kfree(new_res_name); + kfree(res_name); return -EBUSY; } @@ -80,9 +80,11 @@ int dev_dax_kmem_probe(struct device *de if (rc) { release_resource(new_res); kfree(new_res); - kfree(new_res_name); + kfree(res_name); return rc; } + + dev_set_drvdata(dev, res_name); dev_dax->dax_kmem_res = new_res; return 0; @@ -94,7 +96,7 @@ static int dev_dax_kmem_remove(struct de struct dev_dax *dev_dax = to_dev_dax(dev); struct range range = dax_kmem_range(dev_dax); struct resource *res = dev_dax->dax_kmem_res; - const char *res_name = res->name; + const char *res_name = dev_get_drvdata(dev); int rc; /* _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 038/181] device-dax/kmem: replace release_resource() with release_mem_region() 2020-10-13 23:46 incoming Andrew Morton ` (36 preceding siblings ...) 2020-10-13 23:49 ` [patch 037/181] device-dax/kmem: move resource name tracking to drvdata Andrew Morton @ 2020-10-13 23:49 ` Andrew Morton 2020-10-13 23:50 ` [patch 039/181] device-dax: add an allocation interface for device-dax instances Andrew Morton ` (142 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:49 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax/kmem: replace release_resource() with release_mem_region() Towards removing the mode specific @dax_kmem_res attribute from the generic 'struct dev_dax', and preparing for multi-range support, change the kmem driver to use the idiomatic release_mem_region() to pair with the initial request_mem_region(). This also eliminates the need to open code the release of the resource allocated by request_mem_region(). As there are no more dax_kmem_res users, delete this struct member. Link: https://lkml.kernel.org/r/160106112239.30709.15909567572288425294.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/dax-private.h | 3 --- drivers/dax/kmem.c | 20 +++++++------------- 2 files changed, 7 insertions(+), 16 deletions(-) --- a/drivers/dax/dax-private.h~device-dax-kmem-replace-release_resource-with-release_mem_region +++ a/drivers/dax/dax-private.h @@ -42,8 +42,6 @@ struct dax_region { * @dev - device core * @pgmap - pgmap for memmap setup / lifetime (driver owned) * @range: resource range for the instance - * @dax_mem_res: physical address range of hotadded DAX memory - * @dax_mem_name: name for hotadded DAX memory via add_memory_driver_managed() */ struct dev_dax { struct dax_region *region; @@ -52,7 +50,6 @@ struct dev_dax { struct device dev; struct dev_pagemap *pgmap; struct range range; - struct resource *dax_kmem_res; }; static inline u64 range_len(struct range *range) --- a/drivers/dax/kmem.c~device-dax-kmem-replace-release_resource-with-release_mem_region +++ a/drivers/dax/kmem.c @@ -33,7 +33,7 @@ int dev_dax_kmem_probe(struct device *de { struct dev_dax *dev_dax = to_dev_dax(dev); struct range range = dax_kmem_range(dev_dax); - struct resource *new_res; + struct resource *res; char *res_name; int numa_node; int rc; @@ -56,8 +56,8 @@ int dev_dax_kmem_probe(struct device *de return -ENOMEM; /* Region is permanently reserved if hotremove fails. */ - new_res = request_mem_region(range.start, range_len(&range), res_name); - if (!new_res) { + res = request_mem_region(range.start, range_len(&range), res_name); + if (!res) { dev_warn(dev, "could not reserve region [%#llx-%#llx]\n", range.start, range.end); kfree(res_name); return -EBUSY; @@ -69,23 +69,20 @@ int dev_dax_kmem_probe(struct device *de * inherit flags from the parent since it may set new flags * unknown to us that will break add_memory() below. */ - new_res->flags = IORESOURCE_SYSTEM_RAM; + res->flags = IORESOURCE_SYSTEM_RAM; /* * Ensure that future kexec'd kernels will not treat this as RAM * automatically. */ - rc = add_memory_driver_managed(numa_node, new_res->start, - resource_size(new_res), kmem_name); + rc = add_memory_driver_managed(numa_node, range.start, range_len(&range), kmem_name); if (rc) { - release_resource(new_res); - kfree(new_res); + release_mem_region(range.start, range_len(&range)); kfree(res_name); return rc; } dev_set_drvdata(dev, res_name); - dev_dax->dax_kmem_res = new_res; return 0; } @@ -95,7 +92,6 @@ static int dev_dax_kmem_remove(struct de { struct dev_dax *dev_dax = to_dev_dax(dev); struct range range = dax_kmem_range(dev_dax); - struct resource *res = dev_dax->dax_kmem_res; const char *res_name = dev_get_drvdata(dev); int rc; @@ -114,10 +110,8 @@ static int dev_dax_kmem_remove(struct de } /* Release and free dax resources */ - release_resource(res); - kfree(res); + release_mem_region(range.start, range_len(&range)); kfree(res_name); - dev_dax->dax_kmem_res = NULL; return 0; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 039/181] device-dax: add an allocation interface for device-dax instances 2020-10-13 23:46 incoming Andrew Morton ` (37 preceding siblings ...) 2020-10-13 23:49 ` [patch 038/181] device-dax/kmem: replace release_resource() with release_mem_region() Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 040/181] device-dax: introduce 'struct dev_dax' typed-driver operations Andrew Morton ` (141 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: add an allocation interface for device-dax instances In preparation for a facility that enables dax regions to be sub-divided, introduce infrastructure to track and allocate region capacity. The new dax_region/available_size attribute is only enabled for volatile hmem devices, not pmem devices that are defined by nvdimm namespace boundaries. This is per Jeff's feedback the last time dynamic device-dax capacity allocation support was discussed. Link: https://lore.kernel.org/linux-nvdimm/x49shpp3zn8.fsf@segfault.boston.devel.redhat.com Link: https://lkml.kernel.org/r/159643101035.4062302.6785857915652647857.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106112801.30709.14601438735305335071.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 120 +++++++++++++++++++++++++++++++++--- drivers/dax/bus.h | 7 +- drivers/dax/dax-private.h | 2 drivers/dax/hmem/hmem.c | 7 -- drivers/dax/pmem/core.c | 8 -- 5 files changed, 121 insertions(+), 23 deletions(-) --- a/drivers/dax/bus.c~device-dax-add-an-allocation-interface-for-device-dax-instances +++ a/drivers/dax/bus.c @@ -130,6 +130,11 @@ ATTRIBUTE_GROUPS(dax_drv); static int dax_bus_match(struct device *dev, struct device_driver *drv); +static bool is_static(struct dax_region *dax_region) +{ + return (dax_region->res.flags & IORESOURCE_DAX_STATIC) != 0; +} + static struct bus_type dax_bus_type = { .name = "dax", .uevent = dax_bus_uevent, @@ -185,7 +190,48 @@ static ssize_t align_show(struct device } static DEVICE_ATTR_RO(align); +#define for_each_dax_region_resource(dax_region, res) \ + for (res = (dax_region)->res.child; res; res = res->sibling) + +static unsigned long long dax_region_avail_size(struct dax_region *dax_region) +{ + resource_size_t size = resource_size(&dax_region->res); + struct resource *res; + + device_lock_assert(dax_region->dev); + + for_each_dax_region_resource(dax_region, res) + size -= resource_size(res); + return size; +} + +static ssize_t available_size_show(struct device *dev, + struct device_attribute *attr, char *buf) +{ + struct dax_region *dax_region = dev_get_drvdata(dev); + unsigned long long size; + + device_lock(dev); + size = dax_region_avail_size(dax_region); + device_unlock(dev); + + return sprintf(buf, "%llu\n", size); +} +static DEVICE_ATTR_RO(available_size); + +static umode_t dax_region_visible(struct kobject *kobj, struct attribute *a, + int n) +{ + struct device *dev = container_of(kobj, struct device, kobj); + struct dax_region *dax_region = dev_get_drvdata(dev); + + if (is_static(dax_region) && a == &dev_attr_available_size.attr) + return 0; + return a->mode; +} + static struct attribute *dax_region_attributes[] = { + &dev_attr_available_size.attr, &dev_attr_region_size.attr, &dev_attr_align.attr, &dev_attr_id.attr, @@ -195,6 +241,7 @@ static struct attribute *dax_region_attr static const struct attribute_group dax_region_attribute_group = { .name = "dax_region", .attrs = dax_region_attributes, + .is_visible = dax_region_visible, }; static const struct attribute_group *dax_region_attribute_groups[] = { @@ -226,7 +273,8 @@ static void dax_region_unregister(void * } struct dax_region *alloc_dax_region(struct device *parent, int region_id, - struct resource *res, int target_node, unsigned int align) + struct resource *res, int target_node, unsigned int align, + unsigned long flags) { struct dax_region *dax_region; @@ -249,12 +297,17 @@ struct dax_region *alloc_dax_region(stru return NULL; dev_set_drvdata(parent, dax_region); - memcpy(&dax_region->res, res, sizeof(*res)); kref_init(&dax_region->kref); dax_region->id = region_id; dax_region->align = align; dax_region->dev = parent; dax_region->target_node = target_node; + dax_region->res = (struct resource) { + .start = res->start, + .end = res->end, + .flags = IORESOURCE_MEM | flags, + }; + if (sysfs_create_groups(&parent->kobj, dax_region_attribute_groups)) { kfree(dax_region); return NULL; @@ -267,6 +320,32 @@ struct dax_region *alloc_dax_region(stru } EXPORT_SYMBOL_GPL(alloc_dax_region); +static int alloc_dev_dax_range(struct dev_dax *dev_dax, resource_size_t size) +{ + struct dax_region *dax_region = dev_dax->region; + struct resource *res = &dax_region->res; + struct device *dev = &dev_dax->dev; + struct resource *alloc; + + device_lock_assert(dax_region->dev); + + /* TODO: handle multiple allocations per region */ + if (res->child) + return -ENOMEM; + + alloc = __request_region(res, res->start, size, dev_name(dev), 0); + + if (!alloc) + return -ENOMEM; + + dev_dax->range = (struct range) { + .start = alloc->start, + .end = alloc->end, + }; + + return 0; +} + static ssize_t size_show(struct device *dev, struct device_attribute *attr, char *buf) { @@ -361,6 +440,15 @@ void kill_dev_dax(struct dev_dax *dev_da } EXPORT_SYMBOL_GPL(kill_dev_dax); +static void free_dev_dax_range(struct dev_dax *dev_dax) +{ + struct dax_region *dax_region = dev_dax->region; + struct range *range = &dev_dax->range; + + device_lock_assert(dax_region->dev); + __release_region(&dax_region->res, range->start, range_len(range)); +} + static void dev_dax_release(struct device *dev) { struct dev_dax *dev_dax = to_dev_dax(dev); @@ -385,6 +473,7 @@ static void unregister_dev_dax(void *dev dev_dbg(dev, "%s\n", __func__); kill_dev_dax(dev_dax); + free_dev_dax_range(dev_dax); device_del(dev); put_device(dev); } @@ -397,7 +486,7 @@ struct dev_dax *devm_create_dev_dax(stru struct dev_dax *dev_dax; struct inode *inode; struct device *dev; - int rc = -ENOMEM; + int rc; if (data->id < 0) return ERR_PTR(-EINVAL); @@ -406,11 +495,25 @@ struct dev_dax *devm_create_dev_dax(stru if (!dev_dax) return ERR_PTR(-ENOMEM); + dev_dax->region = dax_region; + dev = &dev_dax->dev; + device_initialize(dev); + dev_set_name(dev, "dax%d.%d", dax_region->id, data->id); + + rc = alloc_dev_dax_range(dev_dax, data->size); + if (rc) + goto err_range; + if (data->pgmap) { + dev_WARN_ONCE(parent, !is_static(dax_region), + "custom dev_pagemap requires a static dax_region\n"); + dev_dax->pgmap = kmemdup(data->pgmap, sizeof(struct dev_pagemap), GFP_KERNEL); - if (!dev_dax->pgmap) + if (!dev_dax->pgmap) { + rc = -ENOMEM; goto err_pgmap; + } } /* @@ -427,12 +530,7 @@ struct dev_dax *devm_create_dev_dax(stru kill_dax(dax_dev); /* from here on we're committed to teardown via dev_dax_release() */ - dev = &dev_dax->dev; - device_initialize(dev); - dev_dax->dax_dev = dax_dev; - dev_dax->region = dax_region; - dev_dax->range = data->range; dev_dax->target_node = dax_region->target_node; kref_get(&dax_region->kref); @@ -444,7 +542,6 @@ struct dev_dax *devm_create_dev_dax(stru dev->class = dax_class; dev->parent = parent; dev->type = &dev_dax_type; - dev_set_name(dev, "dax%d.%d", dax_region->id, data->id); rc = device_add(dev); if (rc) { @@ -458,9 +555,12 @@ struct dev_dax *devm_create_dev_dax(stru return ERR_PTR(rc); return dev_dax; + err_alloc_dax: kfree(dev_dax->pgmap); err_pgmap: + free_dev_dax_range(dev_dax); +err_range: kfree(dev_dax); return ERR_PTR(rc); --- a/drivers/dax/bus.h~device-dax-add-an-allocation-interface-for-device-dax-instances +++ a/drivers/dax/bus.h @@ -10,8 +10,11 @@ struct resource; struct dax_device; struct dax_region; void dax_region_put(struct dax_region *dax_region); + +#define IORESOURCE_DAX_STATIC (1UL << 0) struct dax_region *alloc_dax_region(struct device *parent, int region_id, - struct resource *res, int target_node, unsigned int align); + struct resource *res, int target_node, unsigned int align, + unsigned long flags); enum dev_dax_subsys { DEV_DAX_BUS = 0, /* zeroed dev_dax_data picks this by default */ @@ -22,7 +25,7 @@ struct dev_dax_data { struct dax_region *dax_region; struct dev_pagemap *pgmap; enum dev_dax_subsys subsys; - struct range range; + resource_size_t size; int id; }; --- a/drivers/dax/dax-private.h~device-dax-add-an-allocation-interface-for-device-dax-instances +++ a/drivers/dax/dax-private.h @@ -22,7 +22,7 @@ void dax_bus_exit(void); * @kref: to pin while other agents have a need to do lookups * @dev: parent device backing this region * @align: allocation and mapping alignment for child dax devices - * @res: physical address range of the region + * @res: resource tree to track instance allocations */ struct dax_region { int id; --- a/drivers/dax/hmem/hmem.c~device-dax-add-an-allocation-interface-for-device-dax-instances +++ a/drivers/dax/hmem/hmem.c @@ -20,17 +20,14 @@ static int dax_hmem_probe(struct platfor mri = dev->platform_data; dax_region = alloc_dax_region(dev, pdev->id, res, mri->target_node, - PMD_SIZE); + PMD_SIZE, 0); if (!dax_region) return -ENOMEM; data = (struct dev_dax_data) { .dax_region = dax_region, .id = 0, - .range = { - .start = res->start, - .end = res->end, - }, + .size = resource_size(res), }; dev_dax = devm_create_dev_dax(&data); if (IS_ERR(dev_dax)) --- a/drivers/dax/pmem/core.c~device-dax-add-an-allocation-interface-for-device-dax-instances +++ a/drivers/dax/pmem/core.c @@ -54,7 +54,8 @@ struct dev_dax *__dax_pmem_probe(struct memcpy(&res, &pgmap.res, sizeof(res)); res.start += offset; dax_region = alloc_dax_region(dev, region_id, &res, - nd_region->target_node, le32_to_cpu(pfn_sb->align)); + nd_region->target_node, le32_to_cpu(pfn_sb->align), + IORESOURCE_DAX_STATIC); if (!dax_region) return ERR_PTR(-ENOMEM); @@ -63,10 +64,7 @@ struct dev_dax *__dax_pmem_probe(struct .id = id, .pgmap = &pgmap, .subsys = subsys, - .range = { - .start = res.start, - .end = res.end, - }, + .size = resource_size(&res), }; dev_dax = devm_create_dev_dax(&data); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 040/181] device-dax: introduce 'struct dev_dax' typed-driver operations 2020-10-13 23:46 incoming Andrew Morton ` (38 preceding siblings ...) 2020-10-13 23:50 ` [patch 039/181] device-dax: add an allocation interface for device-dax instances Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 041/181] device-dax: introduce 'seed' devices Andrew Morton ` (140 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: introduce 'struct dev_dax' typed-driver operations In preparation for introducing seed devices the dax-bus core needs to be able to intercept ->probe() and ->remove() operations. Towards that end arrange for the bus and drivers to switch from raw 'struct device' driver operations to 'struct dev_dax' typed operations. Link: https://lkml.kernel.org/r/160106113357.30709.4541750544799737855.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Reported-by: Hulk Robot <hulkci@huawei.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 18 ++++++++++++++++++ drivers/dax/bus.h | 4 +++- drivers/dax/device.c | 12 +++++------- drivers/dax/kmem.c | 18 ++++++++---------- drivers/dax/pmem/compat.c | 2 +- 5 files changed, 35 insertions(+), 19 deletions(-) --- a/drivers/dax/bus.c~device-dax-introduce-struct-dev_dax-typed-driver-operations +++ a/drivers/dax/bus.c @@ -135,10 +135,28 @@ static bool is_static(struct dax_region return (dax_region->res.flags & IORESOURCE_DAX_STATIC) != 0; } +static int dax_bus_probe(struct device *dev) +{ + struct dax_device_driver *dax_drv = to_dax_drv(dev->driver); + struct dev_dax *dev_dax = to_dev_dax(dev); + + return dax_drv->probe(dev_dax); +} + +static int dax_bus_remove(struct device *dev) +{ + struct dax_device_driver *dax_drv = to_dax_drv(dev->driver); + struct dev_dax *dev_dax = to_dev_dax(dev); + + return dax_drv->remove(dev_dax); +} + static struct bus_type dax_bus_type = { .name = "dax", .uevent = dax_bus_uevent, .match = dax_bus_match, + .probe = dax_bus_probe, + .remove = dax_bus_remove, .drv_groups = dax_drv_groups, }; --- a/drivers/dax/bus.h~device-dax-introduce-struct-dev_dax-typed-driver-operations +++ a/drivers/dax/bus.h @@ -38,6 +38,8 @@ struct dax_device_driver { struct device_driver drv; struct list_head ids; int match_always; + int (*probe)(struct dev_dax *dev); + int (*remove)(struct dev_dax *dev); }; int __dax_driver_register(struct dax_device_driver *dax_drv, @@ -48,7 +50,7 @@ void dax_driver_unregister(struct dax_de void kill_dev_dax(struct dev_dax *dev_dax); #if IS_ENABLED(CONFIG_DEV_DAX_PMEM_COMPAT) -int dev_dax_probe(struct device *dev); +int dev_dax_probe(struct dev_dax *dev_dax); #endif /* --- a/drivers/dax/device.c~device-dax-introduce-struct-dev_dax-typed-driver-operations +++ a/drivers/dax/device.c @@ -392,11 +392,11 @@ static void dev_dax_kill(void *dev_dax) kill_dev_dax(dev_dax); } -int dev_dax_probe(struct device *dev) +int dev_dax_probe(struct dev_dax *dev_dax) { - struct dev_dax *dev_dax = to_dev_dax(dev); struct dax_device *dax_dev = dev_dax->dax_dev; struct range *range = &dev_dax->range; + struct device *dev = &dev_dax->dev; struct dev_pagemap *pgmap; struct inode *inode; struct cdev *cdev; @@ -446,17 +446,15 @@ int dev_dax_probe(struct device *dev) } EXPORT_SYMBOL_GPL(dev_dax_probe); -static int dev_dax_remove(struct device *dev) +static int dev_dax_remove(struct dev_dax *dev_dax) { /* all probe actions are unwound by devm */ return 0; } static struct dax_device_driver device_dax_driver = { - .drv = { - .probe = dev_dax_probe, - .remove = dev_dax_remove, - }, + .probe = dev_dax_probe, + .remove = dev_dax_remove, .match_always = 1, }; --- a/drivers/dax/kmem.c~device-dax-introduce-struct-dev_dax-typed-driver-operations +++ a/drivers/dax/kmem.c @@ -29,10 +29,10 @@ static struct range dax_kmem_range(struc return range; } -int dev_dax_kmem_probe(struct device *dev) +static int dev_dax_kmem_probe(struct dev_dax *dev_dax) { - struct dev_dax *dev_dax = to_dev_dax(dev); struct range range = dax_kmem_range(dev_dax); + struct device *dev = &dev_dax->dev; struct resource *res; char *res_name; int numa_node; @@ -88,12 +88,12 @@ int dev_dax_kmem_probe(struct device *de } #ifdef CONFIG_MEMORY_HOTREMOVE -static int dev_dax_kmem_remove(struct device *dev) +static int dev_dax_kmem_remove(struct dev_dax *dev_dax) { - struct dev_dax *dev_dax = to_dev_dax(dev); + int rc; + struct device *dev = &dev_dax->dev; struct range range = dax_kmem_range(dev_dax); const char *res_name = dev_get_drvdata(dev); - int rc; /* * We have one shot for removing memory, if some memory blocks were not @@ -116,7 +116,7 @@ static int dev_dax_kmem_remove(struct de return 0; } #else -static int dev_dax_kmem_remove(struct device *dev) +static int dev_dax_kmem_remove(struct dev_dax *dev_dax) { /* * Without hotremove purposely leak the request_mem_region() for the @@ -131,10 +131,8 @@ static int dev_dax_kmem_remove(struct de #endif /* CONFIG_MEMORY_HOTREMOVE */ static struct dax_device_driver device_dax_kmem_driver = { - .drv = { - .probe = dev_dax_kmem_probe, - .remove = dev_dax_kmem_remove, - }, + .probe = dev_dax_kmem_probe, + .remove = dev_dax_kmem_remove, }; static int __init dax_kmem_init(void) --- a/drivers/dax/pmem/compat.c~device-dax-introduce-struct-dev_dax-typed-driver-operations +++ a/drivers/dax/pmem/compat.c @@ -22,7 +22,7 @@ static int dax_pmem_compat_probe(struct return -ENOMEM; device_lock(&dev_dax->dev); - rc = dev_dax_probe(&dev_dax->dev); + rc = dev_dax_probe(dev_dax); device_unlock(&dev_dax->dev); devres_close_group(&dev_dax->dev, dev_dax); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 041/181] device-dax: introduce 'seed' devices 2020-10-13 23:46 incoming Andrew Morton ` (39 preceding siblings ...) 2020-10-13 23:50 ` [patch 040/181] device-dax: introduce 'struct dev_dax' typed-driver operations Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 042/181] drivers/base: make device_find_child_by_name() compatible with sysfs inputs Andrew Morton ` (139 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: introduce 'seed' devices Add a seed device concept for dynamic dax regions to be able to split the region amongst multiple sub-instances. The seed device, similar to libnvdimm seed devices, is a device that starts with zero capacity allocated and unbound to a driver. In contrast to libnvdimm seed devices explicit 'create' and 'delete' interfaces are added to the region to trigger seeds to be created and unused devices to be reclaimed. The explicit create and delete replaces implicit create as a side effect of probe and implicit delete when writing 0 to the size that libnvdimm implements. Delete can be performed on any 0-sized and idle device. This avoids the gymnastics of needing to move device_unregister() to its own async context. Specifically, it avoids the deadlock of deleting a device via one of its own attributes. It is also less surprising to userspace which never sees an extra device it did not request. For now just add the device creation, teardown, and ->probe() prevention. A later patch will arrange for the 'dax/size' attribute to be writable to allocate capacity from the region. Link: https://lkml.kernel.org/r/159643101583.4062302.12255093902950754962.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106113873.30709.15168756050631539431.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 301 +++++++++++++++++++++++++++++++----- drivers/dax/dax-private.h | 9 + drivers/dax/hmem/hmem.c | 2 3 files changed, 272 insertions(+), 40 deletions(-) --- a/drivers/dax/bus.c~device-dax-introduce-seed-devices +++ a/drivers/dax/bus.c @@ -139,8 +139,26 @@ static int dax_bus_probe(struct device * { struct dax_device_driver *dax_drv = to_dax_drv(dev->driver); struct dev_dax *dev_dax = to_dev_dax(dev); + struct dax_region *dax_region = dev_dax->region; + struct range *range = &dev_dax->range; + int rc; + + if (range_len(range) == 0 || dev_dax->id < 0) + return -ENXIO; + + rc = dax_drv->probe(dev_dax); - return dax_drv->probe(dev_dax); + if (rc || is_static(dax_region)) + return rc; + + /* + * Track new seed creation only after successful probe of the + * previous seed. + */ + if (dax_region->seed == dev) + dax_region->seed = NULL; + + return 0; } static int dax_bus_remove(struct device *dev) @@ -237,14 +255,216 @@ static ssize_t available_size_show(struc } static DEVICE_ATTR_RO(available_size); +static ssize_t seed_show(struct device *dev, + struct device_attribute *attr, char *buf) +{ + struct dax_region *dax_region = dev_get_drvdata(dev); + struct device *seed; + ssize_t rc; + + if (is_static(dax_region)) + return -EINVAL; + + device_lock(dev); + seed = dax_region->seed; + rc = sprintf(buf, "%s\n", seed ? dev_name(seed) : ""); + device_unlock(dev); + + return rc; +} +static DEVICE_ATTR_RO(seed); + +static ssize_t create_show(struct device *dev, + struct device_attribute *attr, char *buf) +{ + struct dax_region *dax_region = dev_get_drvdata(dev); + struct device *youngest; + ssize_t rc; + + if (is_static(dax_region)) + return -EINVAL; + + device_lock(dev); + youngest = dax_region->youngest; + rc = sprintf(buf, "%s\n", youngest ? dev_name(youngest) : ""); + device_unlock(dev); + + return rc; +} + +static ssize_t create_store(struct device *dev, struct device_attribute *attr, + const char *buf, size_t len) +{ + struct dax_region *dax_region = dev_get_drvdata(dev); + unsigned long long avail; + ssize_t rc; + int val; + + if (is_static(dax_region)) + return -EINVAL; + + rc = kstrtoint(buf, 0, &val); + if (rc) + return rc; + if (val != 1) + return -EINVAL; + + device_lock(dev); + avail = dax_region_avail_size(dax_region); + if (avail == 0) + rc = -ENOSPC; + else { + struct dev_dax_data data = { + .dax_region = dax_region, + .size = 0, + .id = -1, + }; + struct dev_dax *dev_dax = devm_create_dev_dax(&data); + + if (IS_ERR(dev_dax)) + rc = PTR_ERR(dev_dax); + else { + /* + * In support of crafting multiple new devices + * simultaneously multiple seeds can be created, + * but only the first one that has not been + * successfully bound is tracked as the region + * seed. + */ + if (!dax_region->seed) + dax_region->seed = &dev_dax->dev; + dax_region->youngest = &dev_dax->dev; + rc = len; + } + } + device_unlock(dev); + + return rc; +} +static DEVICE_ATTR_RW(create); + +void kill_dev_dax(struct dev_dax *dev_dax) +{ + struct dax_device *dax_dev = dev_dax->dax_dev; + struct inode *inode = dax_inode(dax_dev); + + kill_dax(dax_dev); + unmap_mapping_range(inode->i_mapping, 0, 0, 1); +} +EXPORT_SYMBOL_GPL(kill_dev_dax); + +static void free_dev_dax_range(struct dev_dax *dev_dax) +{ + struct dax_region *dax_region = dev_dax->region; + struct range *range = &dev_dax->range; + + device_lock_assert(dax_region->dev); + if (range_len(range)) + __release_region(&dax_region->res, range->start, + range_len(range)); +} + +static void unregister_dev_dax(void *dev) +{ + struct dev_dax *dev_dax = to_dev_dax(dev); + + dev_dbg(dev, "%s\n", __func__); + + kill_dev_dax(dev_dax); + free_dev_dax_range(dev_dax); + device_del(dev); + put_device(dev); +} + +/* a return value >= 0 indicates this invocation invalidated the id */ +static int __free_dev_dax_id(struct dev_dax *dev_dax) +{ + struct dax_region *dax_region = dev_dax->region; + struct device *dev = &dev_dax->dev; + int rc = dev_dax->id; + + device_lock_assert(dev); + + if (is_static(dax_region) || dev_dax->id < 0) + return -1; + ida_free(&dax_region->ida, dev_dax->id); + dev_dax->id = -1; + return rc; +} + +static int free_dev_dax_id(struct dev_dax *dev_dax) +{ + struct device *dev = &dev_dax->dev; + int rc; + + device_lock(dev); + rc = __free_dev_dax_id(dev_dax); + device_unlock(dev); + return rc; +} + +static ssize_t delete_store(struct device *dev, struct device_attribute *attr, + const char *buf, size_t len) +{ + struct dax_region *dax_region = dev_get_drvdata(dev); + struct dev_dax *dev_dax; + struct device *victim; + bool do_del = false; + int rc; + + if (is_static(dax_region)) + return -EINVAL; + + victim = device_find_child_by_name(dax_region->dev, buf); + if (!victim) + return -ENXIO; + + device_lock(dev); + device_lock(victim); + dev_dax = to_dev_dax(victim); + if (victim->driver || range_len(&dev_dax->range)) + rc = -EBUSY; + else { + /* + * Invalidate the device so it does not become active + * again, but always preserve device-id-0 so that + * /sys/bus/dax/ is guaranteed to be populated while any + * dax_region is registered. + */ + if (dev_dax->id > 0) { + do_del = __free_dev_dax_id(dev_dax) >= 0; + rc = len; + if (dax_region->seed == victim) + dax_region->seed = NULL; + if (dax_region->youngest == victim) + dax_region->youngest = NULL; + } else + rc = -EBUSY; + } + device_unlock(victim); + + /* won the race to invalidate the device, clean it up */ + if (do_del) + devm_release_action(dev, unregister_dev_dax, victim); + device_unlock(dev); + put_device(victim); + + return rc; +} +static DEVICE_ATTR_WO(delete); + static umode_t dax_region_visible(struct kobject *kobj, struct attribute *a, int n) { struct device *dev = container_of(kobj, struct device, kobj); struct dax_region *dax_region = dev_get_drvdata(dev); - if (is_static(dax_region) && a == &dev_attr_available_size.attr) - return 0; + if (is_static(dax_region)) + if (a == &dev_attr_available_size.attr + || a == &dev_attr_create.attr + || a == &dev_attr_seed.attr + || a == &dev_attr_delete.attr) + return 0; return a->mode; } @@ -252,6 +472,9 @@ static struct attribute *dax_region_attr &dev_attr_available_size.attr, &dev_attr_region_size.attr, &dev_attr_align.attr, + &dev_attr_create.attr, + &dev_attr_seed.attr, + &dev_attr_delete.attr, &dev_attr_id.attr, NULL, }; @@ -320,6 +543,7 @@ struct dax_region *alloc_dax_region(stru dax_region->align = align; dax_region->dev = parent; dax_region->target_node = target_node; + ida_init(&dax_region->ida); dax_region->res = (struct resource) { .start = res->start, .end = res->end, @@ -347,6 +571,15 @@ static int alloc_dev_dax_range(struct de device_lock_assert(dax_region->dev); + /* handle the seed alloc special case */ + if (!size) { + dev_dax->range = (struct range) { + .start = res->start, + .end = res->start - 1, + }; + return 0; + } + /* TODO: handle multiple allocations per region */ if (res->child) return -ENOMEM; @@ -448,33 +681,15 @@ static const struct attribute_group *dax NULL, }; -void kill_dev_dax(struct dev_dax *dev_dax) -{ - struct dax_device *dax_dev = dev_dax->dax_dev; - struct inode *inode = dax_inode(dax_dev); - - kill_dax(dax_dev); - unmap_mapping_range(inode->i_mapping, 0, 0, 1); -} -EXPORT_SYMBOL_GPL(kill_dev_dax); - -static void free_dev_dax_range(struct dev_dax *dev_dax) -{ - struct dax_region *dax_region = dev_dax->region; - struct range *range = &dev_dax->range; - - device_lock_assert(dax_region->dev); - __release_region(&dax_region->res, range->start, range_len(range)); -} - static void dev_dax_release(struct device *dev) { struct dev_dax *dev_dax = to_dev_dax(dev); struct dax_region *dax_region = dev_dax->region; struct dax_device *dax_dev = dev_dax->dax_dev; - dax_region_put(dax_region); put_dax(dax_dev); + free_dev_dax_id(dev_dax); + dax_region_put(dax_region); kfree(dev_dax->pgmap); kfree(dev_dax); } @@ -484,18 +699,6 @@ static const struct device_type dev_dax_ .groups = dax_attribute_groups, }; -static void unregister_dev_dax(void *dev) -{ - struct dev_dax *dev_dax = to_dev_dax(dev); - - dev_dbg(dev, "%s\n", __func__); - - kill_dev_dax(dev_dax); - free_dev_dax_range(dev_dax); - device_del(dev); - put_device(dev); -} - struct dev_dax *devm_create_dev_dax(struct dev_dax_data *data) { struct dax_region *dax_region = data->dax_region; @@ -506,17 +709,35 @@ struct dev_dax *devm_create_dev_dax(stru struct device *dev; int rc; - if (data->id < 0) - return ERR_PTR(-EINVAL); - dev_dax = kzalloc(sizeof(*dev_dax), GFP_KERNEL); if (!dev_dax) return ERR_PTR(-ENOMEM); + if (is_static(dax_region)) { + if (dev_WARN_ONCE(parent, data->id < 0, + "dynamic id specified to static region\n")) { + rc = -EINVAL; + goto err_id; + } + + dev_dax->id = data->id; + } else { + if (dev_WARN_ONCE(parent, data->id >= 0, + "static id specified to dynamic region\n")) { + rc = -EINVAL; + goto err_id; + } + + rc = ida_alloc(&dax_region->ida, GFP_KERNEL); + if (rc < 0) + goto err_id; + dev_dax->id = rc; + } + dev_dax->region = dax_region; dev = &dev_dax->dev; device_initialize(dev); - dev_set_name(dev, "dax%d.%d", dax_region->id, data->id); + dev_set_name(dev, "dax%d.%d", dax_region->id, dev_dax->id); rc = alloc_dev_dax_range(dev_dax, data->size); if (rc) @@ -579,6 +800,8 @@ err_alloc_dax: err_pgmap: free_dev_dax_range(dev_dax); err_range: + free_dev_dax_id(dev_dax); +err_id: kfree(dev_dax); return ERR_PTR(rc); --- a/drivers/dax/dax-private.h~device-dax-introduce-seed-devices +++ a/drivers/dax/dax-private.h @@ -7,6 +7,7 @@ #include <linux/device.h> #include <linux/cdev.h> +#include <linux/idr.h> /* private routines between core files */ struct dax_device; @@ -22,7 +23,10 @@ void dax_bus_exit(void); * @kref: to pin while other agents have a need to do lookups * @dev: parent device backing this region * @align: allocation and mapping alignment for child dax devices + * @ida: instance id allocator * @res: resource tree to track instance allocations + * @seed: allow userspace to find the first unbound seed device + * @youngest: allow userspace to find the most recently created device */ struct dax_region { int id; @@ -30,7 +34,10 @@ struct dax_region { struct kref kref; struct device *dev; unsigned int align; + struct ida ida; struct resource res; + struct device *seed; + struct device *youngest; }; /** @@ -39,6 +46,7 @@ struct dax_region { * @region - parent region * @dax_dev - core dax functionality * @target_node: effective numa node if dev_dax memory range is onlined + * @id: ida allocated id * @dev - device core * @pgmap - pgmap for memmap setup / lifetime (driver owned) * @range: resource range for the instance @@ -47,6 +55,7 @@ struct dev_dax { struct dax_region *region; struct dax_device *dax_dev; int target_node; + int id; struct device dev; struct dev_pagemap *pgmap; struct range range; --- a/drivers/dax/hmem/hmem.c~device-dax-introduce-seed-devices +++ a/drivers/dax/hmem/hmem.c @@ -26,7 +26,7 @@ static int dax_hmem_probe(struct platfor data = (struct dev_dax_data) { .dax_region = dax_region, - .id = 0, + .id = -1, .size = resource_size(res), }; dev_dax = devm_create_dev_dax(&data); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 042/181] drivers/base: make device_find_child_by_name() compatible with sysfs inputs 2020-10-13 23:46 incoming Andrew Morton ` (40 preceding siblings ...) 2020-10-13 23:50 ` [patch 041/181] device-dax: introduce 'seed' devices Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 043/181] device-dax: add resize support Andrew Morton ` (138 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: drivers/base: make device_find_child_by_name() compatible with sysfs inputs Use sysfs_streq() in device_find_child_by_name() to allow it to use a sysfs input string that might contain a trailing newline. The other "device by name" interfaces, {bus,driver,class}_find_device_by_name(), already account for sysfs strings. Link: https://lkml.kernel.org/r/159643102106.4062302.12229802117645312104.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106114576.30709.2960091665444712180.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Reviewed-by: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/base/core.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/drivers/base/core.c~drivers-base-make-device_find_child_by_name-compatible-with-sysfs-inputs +++ a/drivers/base/core.c @@ -3324,7 +3324,7 @@ struct device *device_find_child_by_name klist_iter_init(&parent->p->klist_children, &i); while ((child = next_device(&i))) - if (!strcmp(dev_name(child), name) && get_device(child)) + if (sysfs_streq(dev_name(child), name) && get_device(child)) break; klist_iter_exit(&i); return child; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 043/181] device-dax: add resize support 2020-10-13 23:46 incoming Andrew Morton ` (41 preceding siblings ...) 2020-10-13 23:50 ` [patch 042/181] drivers/base: make device_find_child_by_name() compatible with sysfs inputs Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 044/181] mm/memremap_pages: convert to 'struct range' Andrew Morton ` (137 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: add resize support Make the device-dax 'size' attribute writable to allow capacity to be split between multiple instances in a region. The intended consumers of this capability are users that want to split a scarce memory resource between device-dax and System-RAM access, or users that want to have multiple security domains for a large region. By default the hmem instance provider allocates an entire region to the first instance. The process of creating a new instance (assuming a region-id of 0) is find the region and trigger the 'create' attribute which yields an empty instance to configure. For example: cd /sys/bus/dax/devices echo dax0.0 > dax0.0/driver/unbind echo $new_size > dax0.0/size echo 1 > $(readlink -f dax0.0)../dax_region/create seed=$(cat $(readlink -f dax0.0)../dax_region/seed) echo $new_size > $seed/size echo dax0.0 > ../drivers/{device_dax,kmem}/bind echo dax0.1 > ../drivers/{device_dax,kmem}/bind Instances can be destroyed by: echo $device > $(readlink -f $device)../dax_region/delete Link: https://lkml.kernel.org/r/159643102625.4062302.7431838945566033852.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106115239.30709.9850106928133493138.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: David Airlie <airlied@linux.ie> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 161 +++++++++++++++++++++++++++++++++++++++++--- 1 file changed, 152 insertions(+), 9 deletions(-) --- a/drivers/dax/bus.c~device-dax-add-resize-support +++ a/drivers/dax/bus.c @@ -6,6 +6,7 @@ #include <linux/list.h> #include <linux/slab.h> #include <linux/dax.h> +#include <linux/io.h> #include "dax-private.h" #include "bus.h" @@ -562,7 +563,8 @@ struct dax_region *alloc_dax_region(stru } EXPORT_SYMBOL_GPL(alloc_dax_region); -static int alloc_dev_dax_range(struct dev_dax *dev_dax, resource_size_t size) +static int alloc_dev_dax_range(struct dev_dax *dev_dax, u64 start, + resource_size_t size) { struct dax_region *dax_region = dev_dax->region; struct resource *res = &dax_region->res; @@ -580,12 +582,7 @@ static int alloc_dev_dax_range(struct de return 0; } - /* TODO: handle multiple allocations per region */ - if (res->child) - return -ENOMEM; - - alloc = __request_region(res, res->start, size, dev_name(dev), 0); - + alloc = __request_region(res, start, size, dev_name(dev), 0); if (!alloc) return -ENOMEM; @@ -597,6 +594,29 @@ static int alloc_dev_dax_range(struct de return 0; } +static int adjust_dev_dax_range(struct dev_dax *dev_dax, struct resource *res, resource_size_t size) +{ + struct dax_region *dax_region = dev_dax->region; + struct range *range = &dev_dax->range; + int rc = 0; + + device_lock_assert(dax_region->dev); + + if (size) + rc = adjust_resource(res, range->start, size); + else + __release_region(&dax_region->res, range->start, range_len(range)); + if (rc) + return rc; + + dev_dax->range = (struct range) { + .start = range->start, + .end = range->start + size - 1, + }; + + return 0; +} + static ssize_t size_show(struct device *dev, struct device_attribute *attr, char *buf) { @@ -605,7 +625,127 @@ static ssize_t size_show(struct device * return sprintf(buf, "%llu\n", size); } -static DEVICE_ATTR_RO(size); + +static bool alloc_is_aligned(struct dax_region *dax_region, + resource_size_t size) +{ + /* + * The minimum mapping granularity for a device instance is a + * single subsection, unless the arch says otherwise. + */ + return IS_ALIGNED(size, max_t(unsigned long, dax_region->align, + memremap_compat_align())); +} + +static int dev_dax_shrink(struct dev_dax *dev_dax, resource_size_t size) +{ + struct dax_region *dax_region = dev_dax->region; + struct range *range = &dev_dax->range; + struct resource *res, *adjust = NULL; + struct device *dev = &dev_dax->dev; + + for_each_dax_region_resource(dax_region, res) + if (strcmp(res->name, dev_name(dev)) == 0 + && res->start == range->start) { + adjust = res; + break; + } + + if (dev_WARN_ONCE(dev, !adjust, "failed to find matching resource\n")) + return -ENXIO; + return adjust_dev_dax_range(dev_dax, adjust, size); +} + +static ssize_t dev_dax_resize(struct dax_region *dax_region, + struct dev_dax *dev_dax, resource_size_t size) +{ + resource_size_t avail = dax_region_avail_size(dax_region), to_alloc; + resource_size_t dev_size = range_len(&dev_dax->range); + struct resource *region_res = &dax_region->res; + struct device *dev = &dev_dax->dev; + const char *name = dev_name(dev); + struct resource *res, *first; + + if (dev->driver) + return -EBUSY; + if (size == dev_size) + return 0; + if (size > dev_size && size - dev_size > avail) + return -ENOSPC; + if (size < dev_size) + return dev_dax_shrink(dev_dax, size); + + to_alloc = size - dev_size; + if (dev_WARN_ONCE(dev, !alloc_is_aligned(dax_region, to_alloc), + "resize of %pa misaligned\n", &to_alloc)) + return -ENXIO; + + /* + * Expand the device into the unused portion of the region. This + * may involve adjusting the end of an existing resource, or + * allocating a new resource. + */ + first = region_res->child; + if (!first) + return alloc_dev_dax_range(dev_dax, dax_region->res.start, to_alloc); + for (res = first; to_alloc && res; res = res->sibling) { + struct resource *next = res->sibling; + resource_size_t free; + + /* space at the beginning of the region */ + free = 0; + if (res == first && res->start > dax_region->res.start) + free = res->start - dax_region->res.start; + if (free >= to_alloc && dev_size == 0) + return alloc_dev_dax_range(dev_dax, dax_region->res.start, to_alloc); + + free = 0; + /* space between allocations */ + if (next && next->start > res->end + 1) + free = next->start - res->end + 1; + + /* space at the end of the region */ + if (free < to_alloc && !next && res->end < region_res->end) + free = region_res->end - res->end; + + if (free >= to_alloc && strcmp(name, res->name) == 0) + return adjust_dev_dax_range(dev_dax, res, resource_size(res) + to_alloc); + else if (free >= to_alloc && dev_size == 0) + return alloc_dev_dax_range(dev_dax, res->end + 1, to_alloc); + } + return -ENOSPC; +} + +static ssize_t size_store(struct device *dev, struct device_attribute *attr, + const char *buf, size_t len) +{ + ssize_t rc; + unsigned long long val; + struct dev_dax *dev_dax = to_dev_dax(dev); + struct dax_region *dax_region = dev_dax->region; + + rc = kstrtoull(buf, 0, &val); + if (rc) + return rc; + + if (!alloc_is_aligned(dax_region, val)) { + dev_dbg(dev, "%s: size: %lld misaligned\n", __func__, val); + return -EINVAL; + } + + device_lock(dax_region->dev); + if (!dax_region->dev->driver) { + device_unlock(dax_region->dev); + return -ENXIO; + } + device_lock(dev); + rc = dev_dax_resize(dax_region, dev_dax, val); + device_unlock(dev); + device_unlock(dax_region->dev); + + return rc == 0 ? len : rc; +} +static DEVICE_ATTR_RW(size); static int dev_dax_target_node(struct dev_dax *dev_dax) { @@ -654,11 +794,14 @@ static umode_t dev_dax_visible(struct ko { struct device *dev = container_of(kobj, struct device, kobj); struct dev_dax *dev_dax = to_dev_dax(dev); + struct dax_region *dax_region = dev_dax->region; if (a == &dev_attr_target_node.attr && dev_dax_target_node(dev_dax) < 0) return 0; if (a == &dev_attr_numa_node.attr && !IS_ENABLED(CONFIG_NUMA)) return 0; + if (a == &dev_attr_size.attr && is_static(dax_region)) + return 0444; return a->mode; } @@ -739,7 +882,7 @@ struct dev_dax *devm_create_dev_dax(stru device_initialize(dev); dev_set_name(dev, "dax%d.%d", dax_region->id, dev_dax->id); - rc = alloc_dev_dax_range(dev_dax, data->size); + rc = alloc_dev_dax_range(dev_dax, dax_region->res.start, data->size); if (rc) goto err_range; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 044/181] mm/memremap_pages: convert to 'struct range' 2020-10-13 23:46 incoming Andrew Morton ` (42 preceding siblings ...) 2020-10-13 23:50 ` [patch 043/181] device-dax: add resize support Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 045/181] mm/memremap_pages: support multiple ranges per invocation Andrew Morton ` (136 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.carpenter, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: mm/memremap_pages: convert to 'struct range' The 'struct resource' in 'struct dev_pagemap' is only used for holding resource span information. The other fields, 'name', 'flags', 'desc', 'parent', 'sibling', and 'child' are all unused wasted space. This is in preparation for introducing a multi-range extension of devm_memremap_pages(). The bulk of this change is unwinding all the places internal to libnvdimm that used 'struct resource' unnecessarily, and replacing instances of 'struct dev_pagemap'.res with 'struct dev_pagemap'.range. P2PDMA had a minor usage of the resource flags field, but only to report failures with "%pR". That is replaced with an open coded print of the range. [dan.carpenter@oracle.com: mm/hmm/test: use after free in dmirror_allocate_chunk()] Link: https://lkml.kernel.org/r/20200926121402.GA7467@kadam Link: https://lkml.kernel.org/r/159643103173.4062302.768998885691711532.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106115761.30709.13539840236873663620.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Signed-off-by: Dan Carpenter <dan.carpenter@oracle.com> Reviewed-by: Boris Ostrovsky <boris.ostrovsky@oracle.com> [xen] Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: David Airlie <airlied@linux.ie> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Juergen Gross <jgross@suse.com> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: kernel test robot <lkp@intel.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/powerpc/kvm/book3s_hv_uvmem.c | 13 ++- drivers/dax/bus.c | 10 +- drivers/dax/bus.h | 2 drivers/dax/dax-private.h | 5 - drivers/dax/device.c | 3 drivers/dax/hmem/hmem.c | 5 + drivers/dax/pmem/core.c | 12 +-- drivers/gpu/drm/nouveau/nouveau_dmem.c | 14 ++-- drivers/nvdimm/badrange.c | 26 +++---- drivers/nvdimm/claim.c | 13 ++- drivers/nvdimm/nd.h | 3 drivers/nvdimm/pfn_devs.c | 12 +-- drivers/nvdimm/pmem.c | 26 ++++--- drivers/nvdimm/region.c | 21 +++--- drivers/pci/p2pdma.c | 11 +-- drivers/xen/unpopulated-alloc.c | 44 ++++++++----- include/linux/memremap.h | 5 - include/linux/range.h | 6 + lib/test_hmm.c | 50 +++++++------- mm/memremap.c | 77 +++++++++++------------ tools/testing/nvdimm/test/iomap.c | 2 21 files changed, 195 insertions(+), 165 deletions(-) --- a/arch/powerpc/kvm/book3s_hv_uvmem.c~mm-memremap_pages-convert-to-struct-range +++ a/arch/powerpc/kvm/book3s_hv_uvmem.c @@ -687,9 +687,9 @@ static struct page *kvmppc_uvmem_get_pag struct kvmppc_uvmem_page_pvt *pvt; unsigned long pfn_last, pfn_first; - pfn_first = kvmppc_uvmem_pgmap.res.start >> PAGE_SHIFT; + pfn_first = kvmppc_uvmem_pgmap.range.start >> PAGE_SHIFT; pfn_last = pfn_first + - (resource_size(&kvmppc_uvmem_pgmap.res) >> PAGE_SHIFT); + (range_len(&kvmppc_uvmem_pgmap.range) >> PAGE_SHIFT); spin_lock(&kvmppc_uvmem_bitmap_lock); bit = find_first_zero_bit(kvmppc_uvmem_bitmap, @@ -1007,7 +1007,7 @@ static vm_fault_t kvmppc_uvmem_migrate_t static void kvmppc_uvmem_page_free(struct page *page) { unsigned long pfn = page_to_pfn(page) - - (kvmppc_uvmem_pgmap.res.start >> PAGE_SHIFT); + (kvmppc_uvmem_pgmap.range.start >> PAGE_SHIFT); struct kvmppc_uvmem_page_pvt *pvt; spin_lock(&kvmppc_uvmem_bitmap_lock); @@ -1170,7 +1170,8 @@ int kvmppc_uvmem_init(void) } kvmppc_uvmem_pgmap.type = MEMORY_DEVICE_PRIVATE; - kvmppc_uvmem_pgmap.res = *res; + kvmppc_uvmem_pgmap.range.start = res->start; + kvmppc_uvmem_pgmap.range.end = res->end; kvmppc_uvmem_pgmap.ops = &kvmppc_uvmem_ops; /* just one global instance: */ kvmppc_uvmem_pgmap.owner = &kvmppc_uvmem_pgmap; @@ -1205,7 +1206,7 @@ void kvmppc_uvmem_free(void) return; memunmap_pages(&kvmppc_uvmem_pgmap); - release_mem_region(kvmppc_uvmem_pgmap.res.start, - resource_size(&kvmppc_uvmem_pgmap.res)); + release_mem_region(kvmppc_uvmem_pgmap.range.start, + range_len(&kvmppc_uvmem_pgmap.range)); kfree(kvmppc_uvmem_bitmap); } --- a/drivers/dax/bus.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/dax/bus.c @@ -515,7 +515,7 @@ static void dax_region_unregister(void * } struct dax_region *alloc_dax_region(struct device *parent, int region_id, - struct resource *res, int target_node, unsigned int align, + struct range *range, int target_node, unsigned int align, unsigned long flags) { struct dax_region *dax_region; @@ -530,8 +530,8 @@ struct dax_region *alloc_dax_region(stru return NULL; } - if (!IS_ALIGNED(res->start, align) - || !IS_ALIGNED(resource_size(res), align)) + if (!IS_ALIGNED(range->start, align) + || !IS_ALIGNED(range_len(range), align)) return NULL; dax_region = kzalloc(sizeof(*dax_region), GFP_KERNEL); @@ -546,8 +546,8 @@ struct dax_region *alloc_dax_region(stru dax_region->target_node = target_node; ida_init(&dax_region->ida); dax_region->res = (struct resource) { - .start = res->start, - .end = res->end, + .start = range->start, + .end = range->end, .flags = IORESOURCE_MEM | flags, }; --- a/drivers/dax/bus.h~mm-memremap_pages-convert-to-struct-range +++ a/drivers/dax/bus.h @@ -13,7 +13,7 @@ void dax_region_put(struct dax_region *d #define IORESOURCE_DAX_STATIC (1UL << 0) struct dax_region *alloc_dax_region(struct device *parent, int region_id, - struct resource *res, int target_node, unsigned int align, + struct range *range, int target_node, unsigned int align, unsigned long flags); enum dev_dax_subsys { --- a/drivers/dax/dax-private.h~mm-memremap_pages-convert-to-struct-range +++ a/drivers/dax/dax-private.h @@ -61,11 +61,6 @@ struct dev_dax { struct range range; }; -static inline u64 range_len(struct range *range) -{ - return range->end - range->start + 1; -} - static inline struct dev_dax *to_dev_dax(struct device *dev) { return container_of(dev, struct dev_dax, dev); --- a/drivers/dax/device.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/dax/device.c @@ -416,8 +416,7 @@ int dev_dax_probe(struct dev_dax *dev_da pgmap = devm_kzalloc(dev, sizeof(*pgmap), GFP_KERNEL); if (!pgmap) return -ENOMEM; - pgmap->res.start = range->start; - pgmap->res.end = range->end; + pgmap->range = *range; } pgmap->type = MEMORY_DEVICE_GENERIC; addr = devm_memremap_pages(dev, pgmap); --- a/drivers/dax/hmem/hmem.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/dax/hmem/hmem.c @@ -13,13 +13,16 @@ static int dax_hmem_probe(struct platfor struct dev_dax_data data; struct dev_dax *dev_dax; struct resource *res; + struct range range; res = platform_get_resource(pdev, IORESOURCE_MEM, 0); if (!res) return -ENOMEM; mri = dev->platform_data; - dax_region = alloc_dax_region(dev, pdev->id, res, mri->target_node, + range.start = res->start; + range.end = res->end; + dax_region = alloc_dax_region(dev, pdev->id, &range, mri->target_node, PMD_SIZE, 0); if (!dax_region) return -ENOMEM; --- a/drivers/dax/pmem/core.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/dax/pmem/core.c @@ -9,7 +9,7 @@ struct dev_dax *__dax_pmem_probe(struct device *dev, enum dev_dax_subsys subsys) { - struct resource res; + struct range range; int rc, id, region_id; resource_size_t offset; struct nd_pfn_sb *pfn_sb; @@ -50,10 +50,10 @@ struct dev_dax *__dax_pmem_probe(struct if (rc != 2) return ERR_PTR(-EINVAL); - /* adjust the dax_region resource to the start of data */ - memcpy(&res, &pgmap.res, sizeof(res)); - res.start += offset; - dax_region = alloc_dax_region(dev, region_id, &res, + /* adjust the dax_region range to the start of data */ + range = pgmap.range; + range.start += offset, + dax_region = alloc_dax_region(dev, region_id, &range, nd_region->target_node, le32_to_cpu(pfn_sb->align), IORESOURCE_DAX_STATIC); if (!dax_region) @@ -64,7 +64,7 @@ struct dev_dax *__dax_pmem_probe(struct .id = id, .pgmap = &pgmap, .subsys = subsys, - .size = resource_size(&res), + .size = range_len(&range), }; dev_dax = devm_create_dev_dax(&data); --- a/drivers/gpu/drm/nouveau/nouveau_dmem.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/gpu/drm/nouveau/nouveau_dmem.c @@ -101,7 +101,7 @@ unsigned long nouveau_dmem_page_addr(str { struct nouveau_dmem_chunk *chunk = nouveau_page_to_chunk(page); unsigned long off = (page_to_pfn(page) << PAGE_SHIFT) - - chunk->pagemap.res.start; + chunk->pagemap.range.start; return chunk->bo->offset + off; } @@ -249,7 +249,8 @@ nouveau_dmem_chunk_alloc(struct nouveau_ chunk->drm = drm; chunk->pagemap.type = MEMORY_DEVICE_PRIVATE; - chunk->pagemap.res = *res; + chunk->pagemap.range.start = res->start; + chunk->pagemap.range.end = res->end; chunk->pagemap.ops = &nouveau_dmem_pagemap_ops; chunk->pagemap.owner = drm->dev; @@ -273,7 +274,7 @@ nouveau_dmem_chunk_alloc(struct nouveau_ list_add(&chunk->list, &drm->dmem->chunks); mutex_unlock(&drm->dmem->mutex); - pfn_first = chunk->pagemap.res.start >> PAGE_SHIFT; + pfn_first = chunk->pagemap.range.start >> PAGE_SHIFT; page = pfn_to_page(pfn_first); spin_lock(&drm->dmem->lock); for (i = 0; i < DMEM_CHUNK_NPAGES - 1; ++i, ++page) { @@ -294,8 +295,7 @@ out_bo_unpin: out_bo_free: nouveau_bo_ref(NULL, &chunk->bo); out_release: - release_mem_region(chunk->pagemap.res.start, - resource_size(&chunk->pagemap.res)); + release_mem_region(chunk->pagemap.range.start, range_len(&chunk->pagemap.range)); out_free: kfree(chunk); out: @@ -382,8 +382,8 @@ nouveau_dmem_fini(struct nouveau_drm *dr nouveau_bo_ref(NULL, &chunk->bo); list_del(&chunk->list); memunmap_pages(&chunk->pagemap); - release_mem_region(chunk->pagemap.res.start, - resource_size(&chunk->pagemap.res)); + release_mem_region(chunk->pagemap.range.start, + range_len(&chunk->pagemap.range)); kfree(chunk); } --- a/drivers/nvdimm/badrange.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/nvdimm/badrange.c @@ -211,7 +211,7 @@ static void __add_badblock_range(struct } static void badblocks_populate(struct badrange *badrange, - struct badblocks *bb, const struct resource *res) + struct badblocks *bb, const struct range *range) { struct badrange_entry *bre; @@ -222,34 +222,34 @@ static void badblocks_populate(struct ba u64 bre_end = bre->start + bre->length - 1; /* Discard intervals with no intersection */ - if (bre_end < res->start) + if (bre_end < range->start) continue; - if (bre->start > res->end) + if (bre->start > range->end) continue; /* Deal with any overlap after start of the namespace */ - if (bre->start >= res->start) { + if (bre->start >= range->start) { u64 start = bre->start; u64 len; - if (bre_end <= res->end) + if (bre_end <= range->end) len = bre->length; else - len = res->start + resource_size(res) + len = range->start + range_len(range) - bre->start; - __add_badblock_range(bb, start - res->start, len); + __add_badblock_range(bb, start - range->start, len); continue; } /* * Deal with overlap for badrange starting before * the namespace. */ - if (bre->start < res->start) { + if (bre->start < range->start) { u64 len; - if (bre_end < res->end) - len = bre->start + bre->length - res->start; + if (bre_end < range->end) + len = bre->start + bre->length - range->start; else - len = resource_size(res); + len = range_len(range); __add_badblock_range(bb, 0, len); } } @@ -267,7 +267,7 @@ static void badblocks_populate(struct ba * and add badblocks entries for all matching sub-ranges */ void nvdimm_badblocks_populate(struct nd_region *nd_region, - struct badblocks *bb, const struct resource *res) + struct badblocks *bb, const struct range *range) { struct nvdimm_bus *nvdimm_bus; @@ -279,7 +279,7 @@ void nvdimm_badblocks_populate(struct nd nvdimm_bus = walk_to_nvdimm_bus(&nd_region->dev); nvdimm_bus_lock(&nvdimm_bus->dev); - badblocks_populate(&nvdimm_bus->badrange, bb, res); + badblocks_populate(&nvdimm_bus->badrange, bb, range); nvdimm_bus_unlock(&nvdimm_bus->dev); } EXPORT_SYMBOL_GPL(nvdimm_badblocks_populate); --- a/drivers/nvdimm/claim.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/nvdimm/claim.c @@ -303,13 +303,16 @@ static int nsio_rw_bytes(struct nd_names int devm_nsio_enable(struct device *dev, struct nd_namespace_io *nsio, resource_size_t size) { - struct resource *res = &nsio->res; struct nd_namespace_common *ndns = &nsio->common; + struct range range = { + .start = nsio->res.start, + .end = nsio->res.end, + }; nsio->size = size; - if (!devm_request_mem_region(dev, res->start, size, + if (!devm_request_mem_region(dev, range.start, size, dev_name(&ndns->dev))) { - dev_warn(dev, "could not reserve region %pR\n", res); + dev_warn(dev, "could not reserve region %pR\n", &nsio->res); return -EBUSY; } @@ -317,9 +320,9 @@ int devm_nsio_enable(struct device *dev, if (devm_init_badblocks(dev, &nsio->bb)) return -ENOMEM; nvdimm_badblocks_populate(to_nd_region(ndns->dev.parent), &nsio->bb, - &nsio->res); + &range); - nsio->addr = devm_memremap(dev, res->start, size, ARCH_MEMREMAP_PMEM); + nsio->addr = devm_memremap(dev, range.start, size, ARCH_MEMREMAP_PMEM); return PTR_ERR_OR_ZERO(nsio->addr); } --- a/drivers/nvdimm/nd.h~mm-memremap_pages-convert-to-struct-range +++ a/drivers/nvdimm/nd.h @@ -377,8 +377,9 @@ int nvdimm_namespace_detach_btt(struct n const char *nvdimm_namespace_disk_name(struct nd_namespace_common *ndns, char *name); unsigned int pmem_sector_size(struct nd_namespace_common *ndns); +struct range; void nvdimm_badblocks_populate(struct nd_region *nd_region, - struct badblocks *bb, const struct resource *res); + struct badblocks *bb, const struct range *range); int devm_namespace_enable(struct device *dev, struct nd_namespace_common *ndns, resource_size_t size); void devm_namespace_disable(struct device *dev, --- a/drivers/nvdimm/pfn_devs.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/nvdimm/pfn_devs.c @@ -672,7 +672,7 @@ static unsigned long init_altmap_reserve static int __nvdimm_setup_pfn(struct nd_pfn *nd_pfn, struct dev_pagemap *pgmap) { - struct resource *res = &pgmap->res; + struct range *range = &pgmap->range; struct vmem_altmap *altmap = &pgmap->altmap; struct nd_pfn_sb *pfn_sb = nd_pfn->pfn_sb; u64 offset = le64_to_cpu(pfn_sb->dataoff); @@ -689,16 +689,16 @@ static int __nvdimm_setup_pfn(struct nd_ .end_pfn = PHYS_PFN(end), }; - memcpy(res, &nsio->res, sizeof(*res)); - res->start += start_pad; - res->end -= end_trunc; - + *range = (struct range) { + .start = nsio->res.start + start_pad, + .end = nsio->res.end - end_trunc, + }; if (nd_pfn->mode == PFN_MODE_RAM) { if (offset < reserve) return -EINVAL; nd_pfn->npfns = le64_to_cpu(pfn_sb->npfns); } else if (nd_pfn->mode == PFN_MODE_PMEM) { - nd_pfn->npfns = PHYS_PFN((resource_size(res) - offset)); + nd_pfn->npfns = PHYS_PFN((range_len(range) - offset)); if (le64_to_cpu(nd_pfn->pfn_sb->npfns) > nd_pfn->npfns) dev_info(&nd_pfn->dev, "number of pfns truncated from %lld to %ld\n", --- a/drivers/nvdimm/pmem.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/nvdimm/pmem.c @@ -375,7 +375,7 @@ static int pmem_attach_disk(struct devic struct nd_region *nd_region = to_nd_region(dev->parent); int nid = dev_to_node(dev), fua; struct resource *res = &nsio->res; - struct resource bb_res; + struct range bb_range; struct nd_pfn *nd_pfn = NULL; struct dax_device *dax_dev; struct nd_pfn_sb *pfn_sb; @@ -434,24 +434,26 @@ static int pmem_attach_disk(struct devic pfn_sb = nd_pfn->pfn_sb; pmem->data_offset = le64_to_cpu(pfn_sb->dataoff); pmem->pfn_pad = resource_size(res) - - resource_size(&pmem->pgmap.res); + range_len(&pmem->pgmap.range); pmem->pfn_flags |= PFN_MAP; - memcpy(&bb_res, &pmem->pgmap.res, sizeof(bb_res)); - bb_res.start += pmem->data_offset; + bb_range = pmem->pgmap.range; + bb_range.start += pmem->data_offset; } else if (pmem_should_map_pages(dev)) { - memcpy(&pmem->pgmap.res, &nsio->res, sizeof(pmem->pgmap.res)); + pmem->pgmap.range.start = res->start; + pmem->pgmap.range.end = res->end; pmem->pgmap.type = MEMORY_DEVICE_FS_DAX; pmem->pgmap.ops = &fsdax_pagemap_ops; addr = devm_memremap_pages(dev, &pmem->pgmap); pmem->pfn_flags |= PFN_MAP; - memcpy(&bb_res, &pmem->pgmap.res, sizeof(bb_res)); + bb_range = pmem->pgmap.range; } else { if (devm_add_action_or_reset(dev, pmem_release_queue, &pmem->pgmap)) return -ENOMEM; addr = devm_memremap(dev, pmem->phys_addr, pmem->size, ARCH_MEMREMAP_PMEM); - memcpy(&bb_res, &nsio->res, sizeof(bb_res)); + bb_range.start = res->start; + bb_range.end = res->end; } if (IS_ERR(addr)) @@ -480,7 +482,7 @@ static int pmem_attach_disk(struct devic / 512); if (devm_init_badblocks(dev, &pmem->bb)) return -ENOMEM; - nvdimm_badblocks_populate(nd_region, &pmem->bb, &bb_res); + nvdimm_badblocks_populate(nd_region, &pmem->bb, &bb_range); disk->bb = &pmem->bb; if (is_nvdimm_sync(nd_region)) @@ -591,8 +593,8 @@ static void nd_pmem_notify(struct device resource_size_t offset = 0, end_trunc = 0; struct nd_namespace_common *ndns; struct nd_namespace_io *nsio; - struct resource res; struct badblocks *bb; + struct range range; struct kernfs_node *bb_state; if (event != NVDIMM_REVALIDATE_POISON) @@ -628,9 +630,9 @@ static void nd_pmem_notify(struct device nsio = to_nd_namespace_io(&ndns->dev); } - res.start = nsio->res.start + offset; - res.end = nsio->res.end - end_trunc; - nvdimm_badblocks_populate(nd_region, bb, &res); + range.start = nsio->res.start + offset; + range.end = nsio->res.end - end_trunc; + nvdimm_badblocks_populate(nd_region, bb, &range); if (bb_state) sysfs_notify_dirent(bb_state); } --- a/drivers/nvdimm/region.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/nvdimm/region.c @@ -35,7 +35,10 @@ static int nd_region_probe(struct device return rc; if (is_memory(&nd_region->dev)) { - struct resource ndr_res; + struct range range = { + .start = nd_region->ndr_start, + .end = nd_region->ndr_start + nd_region->ndr_size - 1, + }; if (devm_init_badblocks(dev, &nd_region->bb)) return -ENODEV; @@ -44,9 +47,7 @@ static int nd_region_probe(struct device if (!nd_region->bb_state) dev_warn(&nd_region->dev, "'badblocks' notification disabled\n"); - ndr_res.start = nd_region->ndr_start; - ndr_res.end = nd_region->ndr_start + nd_region->ndr_size - 1; - nvdimm_badblocks_populate(nd_region, &nd_region->bb, &ndr_res); + nvdimm_badblocks_populate(nd_region, &nd_region->bb, &range); } rc = nd_region_register_namespaces(nd_region, &err); @@ -121,14 +122,16 @@ static void nd_region_notify(struct devi { if (event == NVDIMM_REVALIDATE_POISON) { struct nd_region *nd_region = to_nd_region(dev); - struct resource res; if (is_memory(&nd_region->dev)) { - res.start = nd_region->ndr_start; - res.end = nd_region->ndr_start + - nd_region->ndr_size - 1; + struct range range = { + .start = nd_region->ndr_start, + .end = nd_region->ndr_start + + nd_region->ndr_size - 1, + }; + nvdimm_badblocks_populate(nd_region, - &nd_region->bb, &res); + &nd_region->bb, &range); if (nd_region->bb_state) sysfs_notify_dirent(nd_region->bb_state); } --- a/drivers/pci/p2pdma.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/pci/p2pdma.c @@ -185,9 +185,8 @@ int pci_p2pdma_add_resource(struct pci_d return -ENOMEM; pgmap = &p2p_pgmap->pgmap; - pgmap->res.start = pci_resource_start(pdev, bar) + offset; - pgmap->res.end = pgmap->res.start + size - 1; - pgmap->res.flags = pci_resource_flags(pdev, bar); + pgmap->range.start = pci_resource_start(pdev, bar) + offset; + pgmap->range.end = pgmap->range.start + size - 1; pgmap->type = MEMORY_DEVICE_PCI_P2PDMA; p2p_pgmap->provider = pdev; @@ -202,13 +201,13 @@ int pci_p2pdma_add_resource(struct pci_d error = gen_pool_add_owner(pdev->p2pdma->pool, (unsigned long)addr, pci_bus_address(pdev, bar) + offset, - resource_size(&pgmap->res), dev_to_node(&pdev->dev), + range_len(&pgmap->range), dev_to_node(&pdev->dev), pgmap->ref); if (error) goto pages_free; - pci_info(pdev, "added peer-to-peer DMA memory %pR\n", - &pgmap->res); + pci_info(pdev, "added peer-to-peer DMA memory %#llx-%#llx\n", + pgmap->range.start, pgmap->range.end); return 0; --- a/drivers/xen/unpopulated-alloc.c~mm-memremap_pages-convert-to-struct-range +++ a/drivers/xen/unpopulated-alloc.c @@ -18,27 +18,37 @@ static unsigned int list_count; static int fill_list(unsigned int nr_pages) { struct dev_pagemap *pgmap; + struct resource *res; void *vaddr; unsigned int i, alloc_pages = round_up(nr_pages, PAGES_PER_SECTION); - int ret; + int ret = -ENOMEM; + + res = kzalloc(sizeof(*res), GFP_KERNEL); + if (!res) + return -ENOMEM; pgmap = kzalloc(sizeof(*pgmap), GFP_KERNEL); if (!pgmap) - return -ENOMEM; + goto err_pgmap; pgmap->type = MEMORY_DEVICE_GENERIC; - pgmap->res.name = "Xen scratch"; - pgmap->res.flags = IORESOURCE_MEM | IORESOURCE_BUSY; + res->name = "Xen scratch"; + res->flags = IORESOURCE_MEM | IORESOURCE_BUSY; - ret = allocate_resource(&iomem_resource, &pgmap->res, + ret = allocate_resource(&iomem_resource, res, alloc_pages * PAGE_SIZE, 0, -1, PAGES_PER_SECTION * PAGE_SIZE, NULL, NULL); if (ret < 0) { pr_err("Cannot allocate new IOMEM resource\n"); - kfree(pgmap); - return ret; + goto err_resource; } + pgmap->range = (struct range) { + .start = res->start, + .end = res->end, + }; + pgmap->owner = res; + #ifdef CONFIG_XEN_HAVE_PVMMU /* * memremap will build page tables for the new memory so @@ -50,14 +60,13 @@ static int fill_list(unsigned int nr_pag * conflict with any devices. */ if (!xen_feature(XENFEAT_auto_translated_physmap)) { - xen_pfn_t pfn = PFN_DOWN(pgmap->res.start); + xen_pfn_t pfn = PFN_DOWN(res->start); for (i = 0; i < alloc_pages; i++) { if (!set_phys_to_machine(pfn + i, INVALID_P2M_ENTRY)) { pr_warn("set_phys_to_machine() failed, no memory added\n"); - release_resource(&pgmap->res); - kfree(pgmap); - return -ENOMEM; + ret = -ENOMEM; + goto err_memremap; } } } @@ -66,9 +75,8 @@ static int fill_list(unsigned int nr_pag vaddr = memremap_pages(pgmap, NUMA_NO_NODE); if (IS_ERR(vaddr)) { pr_err("Cannot remap memory range\n"); - release_resource(&pgmap->res); - kfree(pgmap); - return PTR_ERR(vaddr); + ret = PTR_ERR(vaddr); + goto err_memremap; } for (i = 0; i < alloc_pages; i++) { @@ -80,6 +88,14 @@ static int fill_list(unsigned int nr_pag } return 0; + +err_memremap: + release_resource(res); +err_resource: + kfree(pgmap); +err_pgmap: + kfree(res); + return ret; } /** --- a/include/linux/memremap.h~mm-memremap_pages-convert-to-struct-range +++ a/include/linux/memremap.h @@ -1,6 +1,7 @@ /* SPDX-License-Identifier: GPL-2.0 */ #ifndef _LINUX_MEMREMAP_H_ #define _LINUX_MEMREMAP_H_ +#include <linux/range.h> #include <linux/ioport.h> #include <linux/percpu-refcount.h> @@ -93,7 +94,7 @@ struct dev_pagemap_ops { /** * struct dev_pagemap - metadata for ZONE_DEVICE mappings * @altmap: pre-allocated/reserved memory for vmemmap allocations - * @res: physical address range covered by @ref + * @range: physical address range covered by @ref * @ref: reference count that pins the devm_memremap_pages() mapping * @internal_ref: internal reference if @ref is not provided by the caller * @done: completion for @internal_ref @@ -106,7 +107,7 @@ struct dev_pagemap_ops { */ struct dev_pagemap { struct vmem_altmap altmap; - struct resource res; + struct range range; struct percpu_ref *ref; struct percpu_ref internal_ref; struct completion done; --- a/include/linux/range.h~mm-memremap_pages-convert-to-struct-range +++ a/include/linux/range.h @@ -1,12 +1,18 @@ /* SPDX-License-Identifier: GPL-2.0 */ #ifndef _LINUX_RANGE_H #define _LINUX_RANGE_H +#include <linux/types.h> struct range { u64 start; u64 end; }; +static inline u64 range_len(const struct range *range) +{ + return range->end - range->start + 1; +} + int add_range(struct range *range, int az, int nr_range, u64 start, u64 end); --- a/lib/test_hmm.c~mm-memremap_pages-convert-to-struct-range +++ a/lib/test_hmm.c @@ -460,6 +460,21 @@ static bool dmirror_allocate_chunk(struc unsigned long pfn_last; void *ptr; + devmem = kzalloc(sizeof(*devmem), GFP_KERNEL); + if (!devmem) + return -ENOMEM; + + res = request_free_mem_region(&iomem_resource, DEVMEM_CHUNK_SIZE, + "hmm_dmirror"); + if (IS_ERR(res)) + goto err_devmem; + + devmem->pagemap.type = MEMORY_DEVICE_PRIVATE; + devmem->pagemap.range.start = res->start; + devmem->pagemap.range.end = res->end; + devmem->pagemap.ops = &dmirror_devmem_ops; + devmem->pagemap.owner = mdevice; + mutex_lock(&mdevice->devmem_lock); if (mdevice->devmem_count == mdevice->devmem_capacity) { @@ -472,33 +487,18 @@ static bool dmirror_allocate_chunk(struc sizeof(new_chunks[0]) * new_capacity, GFP_KERNEL); if (!new_chunks) - goto err; + goto err_release; mdevice->devmem_capacity = new_capacity; mdevice->devmem_chunks = new_chunks; } - res = request_free_mem_region(&iomem_resource, DEVMEM_CHUNK_SIZE, - "hmm_dmirror"); - if (IS_ERR(res)) - goto err; - - devmem = kzalloc(sizeof(*devmem), GFP_KERNEL); - if (!devmem) - goto err_release; - - devmem->pagemap.type = MEMORY_DEVICE_PRIVATE; - devmem->pagemap.res = *res; - devmem->pagemap.ops = &dmirror_devmem_ops; - devmem->pagemap.owner = mdevice; - ptr = memremap_pages(&devmem->pagemap, numa_node_id()); if (IS_ERR(ptr)) - goto err_free; + goto err_release; devmem->mdevice = mdevice; - pfn_first = devmem->pagemap.res.start >> PAGE_SHIFT; - pfn_last = pfn_first + - (resource_size(&devmem->pagemap.res) >> PAGE_SHIFT); + pfn_first = devmem->pagemap.range.start >> PAGE_SHIFT; + pfn_last = pfn_first + (range_len(&devmem->pagemap.range) >> PAGE_SHIFT); mdevice->devmem_chunks[mdevice->devmem_count++] = devmem; mutex_unlock(&mdevice->devmem_lock); @@ -525,12 +525,12 @@ static bool dmirror_allocate_chunk(struc return true; -err_free: - kfree(devmem); err_release: - release_mem_region(res->start, resource_size(res)); -err: mutex_unlock(&mdevice->devmem_lock); + release_mem_region(devmem->pagemap.range.start, range_len(&devmem->pagemap.range)); +err_devmem: + kfree(devmem); + return false; } @@ -1100,8 +1100,8 @@ static void dmirror_device_remove(struct mdevice->devmem_chunks[i]; memunmap_pages(&devmem->pagemap); - release_mem_region(devmem->pagemap.res.start, - resource_size(&devmem->pagemap.res)); + release_mem_region(devmem->pagemap.range.start, + range_len(&devmem->pagemap.range)); kfree(devmem); } kfree(mdevice->devmem_chunks); --- a/mm/memremap.c~mm-memremap_pages-convert-to-struct-range +++ a/mm/memremap.c @@ -70,24 +70,24 @@ static void devmap_managed_enable_put(vo } #endif /* CONFIG_DEV_PAGEMAP_OPS */ -static void pgmap_array_delete(struct resource *res) +static void pgmap_array_delete(struct range *range) { - xa_store_range(&pgmap_array, PHYS_PFN(res->start), PHYS_PFN(res->end), + xa_store_range(&pgmap_array, PHYS_PFN(range->start), PHYS_PFN(range->end), NULL, GFP_KERNEL); synchronize_rcu(); } static unsigned long pfn_first(struct dev_pagemap *pgmap) { - return PHYS_PFN(pgmap->res.start) + + return PHYS_PFN(pgmap->range.start) + vmem_altmap_offset(pgmap_altmap(pgmap)); } static unsigned long pfn_end(struct dev_pagemap *pgmap) { - const struct resource *res = &pgmap->res; + const struct range *range = &pgmap->range; - return (res->start + resource_size(res)) >> PAGE_SHIFT; + return (range->start + range_len(range)) >> PAGE_SHIFT; } static unsigned long pfn_next(unsigned long pfn) @@ -126,7 +126,7 @@ static void dev_pagemap_cleanup(struct d void memunmap_pages(struct dev_pagemap *pgmap) { - struct resource *res = &pgmap->res; + struct range *range = &pgmap->range; struct page *first_page; unsigned long pfn; int nid; @@ -143,20 +143,20 @@ void memunmap_pages(struct dev_pagemap * nid = page_to_nid(first_page); mem_hotplug_begin(); - remove_pfn_range_from_zone(page_zone(first_page), PHYS_PFN(res->start), - PHYS_PFN(resource_size(res))); + remove_pfn_range_from_zone(page_zone(first_page), PHYS_PFN(range->start), + PHYS_PFN(range_len(range))); if (pgmap->type == MEMORY_DEVICE_PRIVATE) { - __remove_pages(PHYS_PFN(res->start), - PHYS_PFN(resource_size(res)), NULL); + __remove_pages(PHYS_PFN(range->start), + PHYS_PFN(range_len(range)), NULL); } else { - arch_remove_memory(nid, res->start, resource_size(res), + arch_remove_memory(nid, range->start, range_len(range), pgmap_altmap(pgmap)); - kasan_remove_zero_shadow(__va(res->start), resource_size(res)); + kasan_remove_zero_shadow(__va(range->start), range_len(range)); } mem_hotplug_done(); - untrack_pfn(NULL, PHYS_PFN(res->start), resource_size(res)); - pgmap_array_delete(res); + untrack_pfn(NULL, PHYS_PFN(range->start), range_len(range)); + pgmap_array_delete(range); WARN_ONCE(pgmap->altmap.alloc, "failed to free all reserved pages\n"); devmap_managed_enable_put(); } @@ -182,7 +182,7 @@ static void dev_pagemap_percpu_release(s */ void *memremap_pages(struct dev_pagemap *pgmap, int nid) { - struct resource *res = &pgmap->res; + struct range *range = &pgmap->range; struct dev_pagemap *conflict_pgmap; struct mhp_params params = { /* @@ -251,7 +251,7 @@ void *memremap_pages(struct dev_pagemap return ERR_PTR(error); } - conflict_pgmap = get_dev_pagemap(PHYS_PFN(res->start), NULL); + conflict_pgmap = get_dev_pagemap(PHYS_PFN(range->start), NULL); if (conflict_pgmap) { WARN(1, "Conflicting mapping in same section\n"); put_dev_pagemap(conflict_pgmap); @@ -259,7 +259,7 @@ void *memremap_pages(struct dev_pagemap goto err_array; } - conflict_pgmap = get_dev_pagemap(PHYS_PFN(res->end), NULL); + conflict_pgmap = get_dev_pagemap(PHYS_PFN(range->end), NULL); if (conflict_pgmap) { WARN(1, "Conflicting mapping in same section\n"); put_dev_pagemap(conflict_pgmap); @@ -267,26 +267,27 @@ void *memremap_pages(struct dev_pagemap goto err_array; } - is_ram = region_intersects(res->start, resource_size(res), + is_ram = region_intersects(range->start, range_len(range), IORESOURCE_SYSTEM_RAM, IORES_DESC_NONE); if (is_ram != REGION_DISJOINT) { - WARN_ONCE(1, "%s attempted on %s region %pr\n", __func__, - is_ram == REGION_MIXED ? "mixed" : "ram", res); + WARN_ONCE(1, "attempted on %s region %#llx-%#llx\n", + is_ram == REGION_MIXED ? "mixed" : "ram", + range->start, range->end); error = -ENXIO; goto err_array; } - error = xa_err(xa_store_range(&pgmap_array, PHYS_PFN(res->start), - PHYS_PFN(res->end), pgmap, GFP_KERNEL)); + error = xa_err(xa_store_range(&pgmap_array, PHYS_PFN(range->start), + PHYS_PFN(range->end), pgmap, GFP_KERNEL)); if (error) goto err_array; if (nid < 0) nid = numa_mem_id(); - error = track_pfn_remap(NULL, ¶ms.pgprot, PHYS_PFN(res->start), - 0, resource_size(res)); + error = track_pfn_remap(NULL, ¶ms.pgprot, PHYS_PFN(range->start), 0, + range_len(range)); if (error) goto err_pfn_remap; @@ -304,16 +305,16 @@ void *memremap_pages(struct dev_pagemap * arch_add_memory(). */ if (pgmap->type == MEMORY_DEVICE_PRIVATE) { - error = add_pages(nid, PHYS_PFN(res->start), - PHYS_PFN(resource_size(res)), ¶ms); + error = add_pages(nid, PHYS_PFN(range->start), + PHYS_PFN(range_len(range)), ¶ms); } else { - error = kasan_add_zero_shadow(__va(res->start), resource_size(res)); + error = kasan_add_zero_shadow(__va(range->start), range_len(range)); if (error) { mem_hotplug_done(); goto err_kasan; } - error = arch_add_memory(nid, res->start, resource_size(res), + error = arch_add_memory(nid, range->start, range_len(range), ¶ms); } @@ -321,8 +322,8 @@ void *memremap_pages(struct dev_pagemap struct zone *zone; zone = &NODE_DATA(nid)->node_zones[ZONE_DEVICE]; - move_pfn_range_to_zone(zone, PHYS_PFN(res->start), - PHYS_PFN(resource_size(res)), params.altmap); + move_pfn_range_to_zone(zone, PHYS_PFN(range->start), + PHYS_PFN(range_len(range)), params.altmap); } mem_hotplug_done(); @@ -334,17 +335,17 @@ void *memremap_pages(struct dev_pagemap * to allow us to do the work while not holding the hotplug lock. */ memmap_init_zone_device(&NODE_DATA(nid)->node_zones[ZONE_DEVICE], - PHYS_PFN(res->start), - PHYS_PFN(resource_size(res)), pgmap); + PHYS_PFN(range->start), + PHYS_PFN(range_len(range)), pgmap); percpu_ref_get_many(pgmap->ref, pfn_end(pgmap) - pfn_first(pgmap)); - return __va(res->start); + return __va(range->start); err_add_memory: - kasan_remove_zero_shadow(__va(res->start), resource_size(res)); + kasan_remove_zero_shadow(__va(range->start), range_len(range)); err_kasan: - untrack_pfn(NULL, PHYS_PFN(res->start), resource_size(res)); + untrack_pfn(NULL, PHYS_PFN(range->start), range_len(range)); err_pfn_remap: - pgmap_array_delete(res); + pgmap_array_delete(range); err_array: dev_pagemap_kill(pgmap); dev_pagemap_cleanup(pgmap); @@ -369,7 +370,7 @@ EXPORT_SYMBOL_GPL(memremap_pages); * 'live' on entry and will be killed and reaped at * devm_memremap_pages_release() time, or if this routine fails. * - * 4/ res is expected to be a host memory range that could feasibly be + * 4/ range is expected to be a host memory range that could feasibly be * treated as a "System RAM" range, i.e. not a device mmio range, but * this is not enforced. */ @@ -426,7 +427,7 @@ struct dev_pagemap *get_dev_pagemap(unsi * In the cached case we're already holding a live reference. */ if (pgmap) { - if (phys >= pgmap->res.start && phys <= pgmap->res.end) + if (phys >= pgmap->range.start && phys <= pgmap->range.end) return pgmap; put_dev_pagemap(pgmap); } --- a/tools/testing/nvdimm/test/iomap.c~mm-memremap_pages-convert-to-struct-range +++ a/tools/testing/nvdimm/test/iomap.c @@ -126,7 +126,7 @@ static void dev_pagemap_percpu_release(s void *__wrap_devm_memremap_pages(struct device *dev, struct dev_pagemap *pgmap) { int error; - resource_size_t offset = pgmap->res.start; + resource_size_t offset = pgmap->range.start; struct nfit_test_resource *nfit_res = get_nfit_res(offset); if (!nfit_res) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 045/181] mm/memremap_pages: support multiple ranges per invocation 2020-10-13 23:46 incoming Andrew Morton ` (43 preceding siblings ...) 2020-10-13 23:50 ` [patch 044/181] mm/memremap_pages: convert to 'struct range' Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 046/181] device-dax: add dis-contiguous resource support Andrew Morton ` (135 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: mm/memremap_pages: support multiple ranges per invocation In support of device-dax growing the ability to front physically dis-contiguous ranges of memory, update devm_memremap_pages() to track multiple ranges with a single reference counter and devm instance. Convert all [devm_]memremap_pages() users to specify the number of ranges they are mapping in their 'struct dev_pagemap' instance. Link: https://lkml.kernel.org/r/159643103789.4062302.18426128170217903785.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106116293.30709.13350662794915396198.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: David Airlie <airlied@linux.ie> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Juergen Gross <jgross@suse.com> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: "Jérôme Glisse" <jglisse@redhat.co Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: kernel test robot <lkp@intel.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/powerpc/kvm/book3s_hv_uvmem.c | 1 drivers/dax/device.c | 1 drivers/gpu/drm/nouveau/nouveau_dmem.c | 1 drivers/nvdimm/pfn_devs.c | 1 drivers/nvdimm/pmem.c | 1 drivers/pci/p2pdma.c | 1 drivers/xen/unpopulated-alloc.c | 1 include/linux/memremap.h | 10 lib/test_hmm.c | 1 mm/memremap.c | 258 +++++++++++++---------- 10 files changed, 166 insertions(+), 110 deletions(-) --- a/arch/powerpc/kvm/book3s_hv_uvmem.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/arch/powerpc/kvm/book3s_hv_uvmem.c @@ -1172,6 +1172,7 @@ int kvmppc_uvmem_init(void) kvmppc_uvmem_pgmap.type = MEMORY_DEVICE_PRIVATE; kvmppc_uvmem_pgmap.range.start = res->start; kvmppc_uvmem_pgmap.range.end = res->end; + kvmppc_uvmem_pgmap.nr_range = 1; kvmppc_uvmem_pgmap.ops = &kvmppc_uvmem_ops; /* just one global instance: */ kvmppc_uvmem_pgmap.owner = &kvmppc_uvmem_pgmap; --- a/drivers/dax/device.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/drivers/dax/device.c @@ -417,6 +417,7 @@ int dev_dax_probe(struct dev_dax *dev_da if (!pgmap) return -ENOMEM; pgmap->range = *range; + pgmap->nr_range = 1; } pgmap->type = MEMORY_DEVICE_GENERIC; addr = devm_memremap_pages(dev, pgmap); --- a/drivers/gpu/drm/nouveau/nouveau_dmem.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/drivers/gpu/drm/nouveau/nouveau_dmem.c @@ -251,6 +251,7 @@ nouveau_dmem_chunk_alloc(struct nouveau_ chunk->pagemap.type = MEMORY_DEVICE_PRIVATE; chunk->pagemap.range.start = res->start; chunk->pagemap.range.end = res->end; + chunk->pagemap.nr_range = 1; chunk->pagemap.ops = &nouveau_dmem_pagemap_ops; chunk->pagemap.owner = drm->dev; --- a/drivers/nvdimm/pfn_devs.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/drivers/nvdimm/pfn_devs.c @@ -693,6 +693,7 @@ static int __nvdimm_setup_pfn(struct nd_ .start = nsio->res.start + start_pad, .end = nsio->res.end - end_trunc, }; + pgmap->nr_range = 1; if (nd_pfn->mode == PFN_MODE_RAM) { if (offset < reserve) return -EINVAL; --- a/drivers/nvdimm/pmem.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/drivers/nvdimm/pmem.c @@ -441,6 +441,7 @@ static int pmem_attach_disk(struct devic } else if (pmem_should_map_pages(dev)) { pmem->pgmap.range.start = res->start; pmem->pgmap.range.end = res->end; + pmem->pgmap.nr_range = 1; pmem->pgmap.type = MEMORY_DEVICE_FS_DAX; pmem->pgmap.ops = &fsdax_pagemap_ops; addr = devm_memremap_pages(dev, &pmem->pgmap); --- a/drivers/pci/p2pdma.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/drivers/pci/p2pdma.c @@ -187,6 +187,7 @@ int pci_p2pdma_add_resource(struct pci_d pgmap = &p2p_pgmap->pgmap; pgmap->range.start = pci_resource_start(pdev, bar) + offset; pgmap->range.end = pgmap->range.start + size - 1; + pgmap->nr_range = 1; pgmap->type = MEMORY_DEVICE_PCI_P2PDMA; p2p_pgmap->provider = pdev; --- a/drivers/xen/unpopulated-alloc.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/drivers/xen/unpopulated-alloc.c @@ -47,6 +47,7 @@ static int fill_list(unsigned int nr_pag .start = res->start, .end = res->end, }; + pgmap->nr_range = 1; pgmap->owner = res; #ifdef CONFIG_XEN_HAVE_PVMMU --- a/include/linux/memremap.h~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/include/linux/memremap.h @@ -94,7 +94,6 @@ struct dev_pagemap_ops { /** * struct dev_pagemap - metadata for ZONE_DEVICE mappings * @altmap: pre-allocated/reserved memory for vmemmap allocations - * @range: physical address range covered by @ref * @ref: reference count that pins the devm_memremap_pages() mapping * @internal_ref: internal reference if @ref is not provided by the caller * @done: completion for @internal_ref @@ -104,10 +103,12 @@ struct dev_pagemap_ops { * @owner: an opaque pointer identifying the entity that manages this * instance. Used by various helpers to make sure that no * foreign ZONE_DEVICE memory is accessed. + * @nr_range: number of ranges to be mapped + * @range: range to be mapped when nr_range == 1 + * @ranges: array of ranges to be mapped when nr_range > 1 */ struct dev_pagemap { struct vmem_altmap altmap; - struct range range; struct percpu_ref *ref; struct percpu_ref internal_ref; struct completion done; @@ -115,6 +116,11 @@ struct dev_pagemap { unsigned int flags; const struct dev_pagemap_ops *ops; void *owner; + int nr_range; + union { + struct range range; + struct range ranges[0]; + }; }; static inline struct vmem_altmap *pgmap_altmap(struct dev_pagemap *pgmap) --- a/lib/test_hmm.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/lib/test_hmm.c @@ -472,6 +472,7 @@ static bool dmirror_allocate_chunk(struc devmem->pagemap.type = MEMORY_DEVICE_PRIVATE; devmem->pagemap.range.start = res->start; devmem->pagemap.range.end = res->end; + devmem->pagemap.nr_range = 1; devmem->pagemap.ops = &dmirror_devmem_ops; devmem->pagemap.owner = mdevice; --- a/mm/memremap.c~mm-memremap_pages-support-multiple-ranges-per-invocation +++ a/mm/memremap.c @@ -77,15 +77,19 @@ static void pgmap_array_delete(struct ra synchronize_rcu(); } -static unsigned long pfn_first(struct dev_pagemap *pgmap) +static unsigned long pfn_first(struct dev_pagemap *pgmap, int range_id) { - return PHYS_PFN(pgmap->range.start) + - vmem_altmap_offset(pgmap_altmap(pgmap)); + struct range *range = &pgmap->ranges[range_id]; + unsigned long pfn = PHYS_PFN(range->start); + + if (range_id) + return pfn; + return pfn + vmem_altmap_offset(pgmap_altmap(pgmap)); } -static unsigned long pfn_end(struct dev_pagemap *pgmap) +static unsigned long pfn_end(struct dev_pagemap *pgmap, int range_id) { - const struct range *range = &pgmap->range; + const struct range *range = &pgmap->ranges[range_id]; return (range->start + range_len(range)) >> PAGE_SHIFT; } @@ -97,8 +101,8 @@ static unsigned long pfn_next(unsigned l return pfn + 1; } -#define for_each_device_pfn(pfn, map) \ - for (pfn = pfn_first(map); pfn < pfn_end(map); pfn = pfn_next(pfn)) +#define for_each_device_pfn(pfn, map, i) \ + for (pfn = pfn_first(map, i); pfn < pfn_end(map, i); pfn = pfn_next(pfn)) static void dev_pagemap_kill(struct dev_pagemap *pgmap) { @@ -124,20 +128,14 @@ static void dev_pagemap_cleanup(struct d pgmap->ref = NULL; } -void memunmap_pages(struct dev_pagemap *pgmap) +static void pageunmap_range(struct dev_pagemap *pgmap, int range_id) { - struct range *range = &pgmap->range; + struct range *range = &pgmap->ranges[range_id]; struct page *first_page; - unsigned long pfn; int nid; - dev_pagemap_kill(pgmap); - for_each_device_pfn(pfn, pgmap) - put_page(pfn_to_page(pfn)); - dev_pagemap_cleanup(pgmap); - /* make sure to access a memmap that was actually initialized */ - first_page = pfn_to_page(pfn_first(pgmap)); + first_page = pfn_to_page(pfn_first(pgmap, range_id)); /* pages are dead and unused, undo the arch mapping */ nid = page_to_nid(first_page); @@ -157,6 +155,22 @@ void memunmap_pages(struct dev_pagemap * untrack_pfn(NULL, PHYS_PFN(range->start), range_len(range)); pgmap_array_delete(range); +} + +void memunmap_pages(struct dev_pagemap *pgmap) +{ + unsigned long pfn; + int i; + + dev_pagemap_kill(pgmap); + for (i = 0; i < pgmap->nr_range; i++) + for_each_device_pfn(pfn, pgmap, i) + put_page(pfn_to_page(pfn)); + dev_pagemap_cleanup(pgmap); + + for (i = 0; i < pgmap->nr_range; i++) + pageunmap_range(pgmap, i); + WARN_ONCE(pgmap->altmap.alloc, "failed to free all reserved pages\n"); devmap_managed_enable_put(); } @@ -175,96 +189,29 @@ static void dev_pagemap_percpu_release(s complete(&pgmap->done); } -/* - * Not device managed version of dev_memremap_pages, undone by - * memunmap_pages(). Please use dev_memremap_pages if you have a struct - * device available. - */ -void *memremap_pages(struct dev_pagemap *pgmap, int nid) +static int pagemap_range(struct dev_pagemap *pgmap, struct mhp_params *params, + int range_id, int nid) { - struct range *range = &pgmap->range; + struct range *range = &pgmap->ranges[range_id]; struct dev_pagemap *conflict_pgmap; - struct mhp_params params = { - /* - * We do not want any optional features only our own memmap - */ - .altmap = pgmap_altmap(pgmap), - .pgprot = PAGE_KERNEL, - }; int error, is_ram; - bool need_devmap_managed = true; - - switch (pgmap->type) { - case MEMORY_DEVICE_PRIVATE: - if (!IS_ENABLED(CONFIG_DEVICE_PRIVATE)) { - WARN(1, "Device private memory not supported\n"); - return ERR_PTR(-EINVAL); - } - if (!pgmap->ops || !pgmap->ops->migrate_to_ram) { - WARN(1, "Missing migrate_to_ram method\n"); - return ERR_PTR(-EINVAL); - } - if (!pgmap->owner) { - WARN(1, "Missing owner\n"); - return ERR_PTR(-EINVAL); - } - break; - case MEMORY_DEVICE_FS_DAX: - if (!IS_ENABLED(CONFIG_ZONE_DEVICE) || - IS_ENABLED(CONFIG_FS_DAX_LIMITED)) { - WARN(1, "File system DAX not supported\n"); - return ERR_PTR(-EINVAL); - } - break; - case MEMORY_DEVICE_GENERIC: - need_devmap_managed = false; - break; - case MEMORY_DEVICE_PCI_P2PDMA: - params.pgprot = pgprot_noncached(params.pgprot); - need_devmap_managed = false; - break; - default: - WARN(1, "Invalid pgmap type %d\n", pgmap->type); - break; - } - - if (!pgmap->ref) { - if (pgmap->ops && (pgmap->ops->kill || pgmap->ops->cleanup)) - return ERR_PTR(-EINVAL); - init_completion(&pgmap->done); - error = percpu_ref_init(&pgmap->internal_ref, - dev_pagemap_percpu_release, 0, GFP_KERNEL); - if (error) - return ERR_PTR(error); - pgmap->ref = &pgmap->internal_ref; - } else { - if (!pgmap->ops || !pgmap->ops->kill || !pgmap->ops->cleanup) { - WARN(1, "Missing reference count teardown definition\n"); - return ERR_PTR(-EINVAL); - } - } - - if (need_devmap_managed) { - error = devmap_managed_enable_get(pgmap); - if (error) - return ERR_PTR(error); - } + if (WARN_ONCE(pgmap_altmap(pgmap) && range_id > 0, + "altmap not supported for multiple ranges\n")) + return -EINVAL; conflict_pgmap = get_dev_pagemap(PHYS_PFN(range->start), NULL); if (conflict_pgmap) { WARN(1, "Conflicting mapping in same section\n"); put_dev_pagemap(conflict_pgmap); - error = -ENOMEM; - goto err_array; + return -ENOMEM; } conflict_pgmap = get_dev_pagemap(PHYS_PFN(range->end), NULL); if (conflict_pgmap) { WARN(1, "Conflicting mapping in same section\n"); put_dev_pagemap(conflict_pgmap); - error = -ENOMEM; - goto err_array; + return -ENOMEM; } is_ram = region_intersects(range->start, range_len(range), @@ -274,19 +221,18 @@ void *memremap_pages(struct dev_pagemap WARN_ONCE(1, "attempted on %s region %#llx-%#llx\n", is_ram == REGION_MIXED ? "mixed" : "ram", range->start, range->end); - error = -ENXIO; - goto err_array; + return -ENXIO; } error = xa_err(xa_store_range(&pgmap_array, PHYS_PFN(range->start), PHYS_PFN(range->end), pgmap, GFP_KERNEL)); if (error) - goto err_array; + return error; if (nid < 0) nid = numa_mem_id(); - error = track_pfn_remap(NULL, ¶ms.pgprot, PHYS_PFN(range->start), 0, + error = track_pfn_remap(NULL, ¶ms->pgprot, PHYS_PFN(range->start), 0, range_len(range)); if (error) goto err_pfn_remap; @@ -306,7 +252,7 @@ void *memremap_pages(struct dev_pagemap */ if (pgmap->type == MEMORY_DEVICE_PRIVATE) { error = add_pages(nid, PHYS_PFN(range->start), - PHYS_PFN(range_len(range)), ¶ms); + PHYS_PFN(range_len(range)), params); } else { error = kasan_add_zero_shadow(__va(range->start), range_len(range)); if (error) { @@ -315,7 +261,7 @@ void *memremap_pages(struct dev_pagemap } error = arch_add_memory(nid, range->start, range_len(range), - ¶ms); + params); } if (!error) { @@ -323,7 +269,7 @@ void *memremap_pages(struct dev_pagemap zone = &NODE_DATA(nid)->node_zones[ZONE_DEVICE]; move_pfn_range_to_zone(zone, PHYS_PFN(range->start), - PHYS_PFN(range_len(range)), params.altmap); + PHYS_PFN(range_len(range)), params->altmap); } mem_hotplug_done(); @@ -337,20 +283,116 @@ void *memremap_pages(struct dev_pagemap memmap_init_zone_device(&NODE_DATA(nid)->node_zones[ZONE_DEVICE], PHYS_PFN(range->start), PHYS_PFN(range_len(range)), pgmap); - percpu_ref_get_many(pgmap->ref, pfn_end(pgmap) - pfn_first(pgmap)); - return __va(range->start); + percpu_ref_get_many(pgmap->ref, pfn_end(pgmap, range_id) + - pfn_first(pgmap, range_id)); + return 0; - err_add_memory: +err_add_memory: kasan_remove_zero_shadow(__va(range->start), range_len(range)); - err_kasan: +err_kasan: untrack_pfn(NULL, PHYS_PFN(range->start), range_len(range)); - err_pfn_remap: +err_pfn_remap: pgmap_array_delete(range); - err_array: - dev_pagemap_kill(pgmap); - dev_pagemap_cleanup(pgmap); - devmap_managed_enable_put(); - return ERR_PTR(error); + return error; +} + + +/* + * Not device managed version of dev_memremap_pages, undone by + * memunmap_pages(). Please use dev_memremap_pages if you have a struct + * device available. + */ +void *memremap_pages(struct dev_pagemap *pgmap, int nid) +{ + struct mhp_params params = { + .altmap = pgmap_altmap(pgmap), + .pgprot = PAGE_KERNEL, + }; + const int nr_range = pgmap->nr_range; + bool need_devmap_managed = true; + int error, i; + + if (WARN_ONCE(!nr_range, "nr_range must be specified\n")) + return ERR_PTR(-EINVAL); + + switch (pgmap->type) { + case MEMORY_DEVICE_PRIVATE: + if (!IS_ENABLED(CONFIG_DEVICE_PRIVATE)) { + WARN(1, "Device private memory not supported\n"); + return ERR_PTR(-EINVAL); + } + if (!pgmap->ops || !pgmap->ops->migrate_to_ram) { + WARN(1, "Missing migrate_to_ram method\n"); + return ERR_PTR(-EINVAL); + } + if (!pgmap->owner) { + WARN(1, "Missing owner\n"); + return ERR_PTR(-EINVAL); + } + break; + case MEMORY_DEVICE_FS_DAX: + if (!IS_ENABLED(CONFIG_ZONE_DEVICE) || + IS_ENABLED(CONFIG_FS_DAX_LIMITED)) { + WARN(1, "File system DAX not supported\n"); + return ERR_PTR(-EINVAL); + } + break; + case MEMORY_DEVICE_GENERIC: + need_devmap_managed = false; + break; + case MEMORY_DEVICE_PCI_P2PDMA: + params.pgprot = pgprot_noncached(params.pgprot); + need_devmap_managed = false; + break; + default: + WARN(1, "Invalid pgmap type %d\n", pgmap->type); + break; + } + + if (!pgmap->ref) { + if (pgmap->ops && (pgmap->ops->kill || pgmap->ops->cleanup)) + return ERR_PTR(-EINVAL); + + init_completion(&pgmap->done); + error = percpu_ref_init(&pgmap->internal_ref, + dev_pagemap_percpu_release, 0, GFP_KERNEL); + if (error) + return ERR_PTR(error); + pgmap->ref = &pgmap->internal_ref; + } else { + if (!pgmap->ops || !pgmap->ops->kill || !pgmap->ops->cleanup) { + WARN(1, "Missing reference count teardown definition\n"); + return ERR_PTR(-EINVAL); + } + } + + if (need_devmap_managed) { + error = devmap_managed_enable_get(pgmap); + if (error) + return ERR_PTR(error); + } + + /* + * Clear the pgmap nr_range as it will be incremented for each + * successfully processed range. This communicates how many + * regions to unwind in the abort case. + */ + pgmap->nr_range = 0; + error = 0; + for (i = 0; i < nr_range; i++) { + error = pagemap_range(pgmap, ¶ms, i, nid); + if (error) + break; + pgmap->nr_range++; + } + + if (i < nr_range) { + memunmap_pages(pgmap); + pgmap->nr_range = nr_range; + return ERR_PTR(error); + } + + return __va(pgmap->ranges[0].start); } EXPORT_SYMBOL_GPL(memremap_pages); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 046/181] device-dax: add dis-contiguous resource support 2020-10-13 23:46 incoming Andrew Morton ` (44 preceding siblings ...) 2020-10-13 23:50 ` [patch 045/181] mm/memremap_pages: support multiple ranges per invocation Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 047/181] device-dax: introduce 'mapping' devices Andrew Morton ` (134 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: add dis-contiguous resource support Break the requirement that device-dax instances are physically contiguous. With this constraint removed it allows fragmented available capacity to be fully allocated. This capability is useful to mitigate the "noisy neighbor" problem with memory-side-cache management for virtual machines, or any other scenario where a platform address boundary also designates a performance boundary. For example a direct mapped memory side cache might rotate cache colors at 1GB boundaries. With dis-contiguous allocations a device-dax instance could be configured to contain only 1 cache color. It also satisfies Joao's use case (see link) for partitioning memory for exclusive guest access. It allows for a future potential mode where the host kernel need not allocate 'struct page' capacity up-front. Link: https://lore.kernel.org/lkml/20200110190313.17144-1-joao.m.martins@oracle.com/ Link: https://lkml.kernel.org/r/159643104304.4062302.16561669534797528660.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106116875.30709.11456649969327399771.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Reported-by: Joao Martins <joao.m.martins@oracle.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 231 +++++++++++++++++++++++-------- drivers/dax/dax-private.h | 9 - drivers/dax/device.c | 53 ++++--- drivers/dax/kmem.c | 130 +++++++++++------ tools/testing/nvdimm/dax-dev.c | 20 +- 5 files changed, 321 insertions(+), 122 deletions(-) --- a/drivers/dax/bus.c~device-dax-add-dis-contiguous-resource-support +++ a/drivers/dax/bus.c @@ -136,15 +136,27 @@ static bool is_static(struct dax_region return (dax_region->res.flags & IORESOURCE_DAX_STATIC) != 0; } +static u64 dev_dax_size(struct dev_dax *dev_dax) +{ + u64 size = 0; + int i; + + device_lock_assert(&dev_dax->dev); + + for (i = 0; i < dev_dax->nr_range; i++) + size += range_len(&dev_dax->ranges[i].range); + + return size; +} + static int dax_bus_probe(struct device *dev) { struct dax_device_driver *dax_drv = to_dax_drv(dev->driver); struct dev_dax *dev_dax = to_dev_dax(dev); struct dax_region *dax_region = dev_dax->region; - struct range *range = &dev_dax->range; int rc; - if (range_len(range) == 0 || dev_dax->id < 0) + if (dev_dax_size(dev_dax) == 0 || dev_dax->id < 0) return -ENXIO; rc = dax_drv->probe(dev_dax); @@ -354,15 +366,19 @@ void kill_dev_dax(struct dev_dax *dev_da } EXPORT_SYMBOL_GPL(kill_dev_dax); -static void free_dev_dax_range(struct dev_dax *dev_dax) +static void free_dev_dax_ranges(struct dev_dax *dev_dax) { struct dax_region *dax_region = dev_dax->region; - struct range *range = &dev_dax->range; + int i; device_lock_assert(dax_region->dev); - if (range_len(range)) + for (i = 0; i < dev_dax->nr_range; i++) { + struct range *range = &dev_dax->ranges[i].range; + __release_region(&dax_region->res, range->start, range_len(range)); + } + dev_dax->nr_range = 0; } static void unregister_dev_dax(void *dev) @@ -372,7 +388,7 @@ static void unregister_dev_dax(void *dev dev_dbg(dev, "%s\n", __func__); kill_dev_dax(dev_dax); - free_dev_dax_range(dev_dax); + free_dev_dax_ranges(dev_dax); device_del(dev); put_device(dev); } @@ -423,7 +439,7 @@ static ssize_t delete_store(struct devic device_lock(dev); device_lock(victim); dev_dax = to_dev_dax(victim); - if (victim->driver || range_len(&dev_dax->range)) + if (victim->driver || dev_dax_size(dev_dax)) rc = -EBUSY; else { /* @@ -569,51 +585,86 @@ static int alloc_dev_dax_range(struct de struct dax_region *dax_region = dev_dax->region; struct resource *res = &dax_region->res; struct device *dev = &dev_dax->dev; + struct dev_dax_range *ranges; + unsigned long pgoff = 0; struct resource *alloc; + int i; device_lock_assert(dax_region->dev); /* handle the seed alloc special case */ if (!size) { - dev_dax->range = (struct range) { - .start = res->start, - .end = res->start - 1, - }; + if (dev_WARN_ONCE(dev, dev_dax->nr_range, + "0-size allocation must be first\n")) + return -EBUSY; + /* nr_range == 0 is elsewhere special cased as 0-size device */ return 0; } + ranges = krealloc(dev_dax->ranges, sizeof(*ranges) + * (dev_dax->nr_range + 1), GFP_KERNEL); + if (!ranges) + return -ENOMEM; + alloc = __request_region(res, start, size, dev_name(dev), 0); - if (!alloc) + if (!alloc) { + /* + * If this was an empty set of ranges nothing else + * will release @ranges, so do it now. + */ + if (!dev_dax->nr_range) { + kfree(ranges); + ranges = NULL; + } + dev_dax->ranges = ranges; return -ENOMEM; + } - dev_dax->range = (struct range) { - .start = alloc->start, - .end = alloc->end, + for (i = 0; i < dev_dax->nr_range; i++) + pgoff += PHYS_PFN(range_len(&ranges[i].range)); + dev_dax->ranges = ranges; + ranges[dev_dax->nr_range++] = (struct dev_dax_range) { + .pgoff = pgoff, + .range = { + .start = alloc->start, + .end = alloc->end, + }, }; + dev_dbg(dev, "alloc range[%d]: %pa:%pa\n", dev_dax->nr_range - 1, + &alloc->start, &alloc->end); + return 0; } static int adjust_dev_dax_range(struct dev_dax *dev_dax, struct resource *res, resource_size_t size) { + int last_range = dev_dax->nr_range - 1; + struct dev_dax_range *dax_range = &dev_dax->ranges[last_range]; struct dax_region *dax_region = dev_dax->region; - struct range *range = &dev_dax->range; - int rc = 0; + bool is_shrink = resource_size(res) > size; + struct range *range = &dax_range->range; + struct device *dev = &dev_dax->dev; + int rc; device_lock_assert(dax_region->dev); - if (size) - rc = adjust_resource(res, range->start, size); - else - __release_region(&dax_region->res, range->start, range_len(range)); + if (dev_WARN_ONCE(dev, !size, "deletion is handled by dev_dax_shrink\n")) + return -EINVAL; + + rc = adjust_resource(res, range->start, size); if (rc) return rc; - dev_dax->range = (struct range) { + *range = (struct range) { .start = range->start, .end = range->start + size - 1, }; + dev_dbg(dev, "%s range[%d]: %#llx:%#llx\n", is_shrink ? "shrink" : "extend", + last_range, (unsigned long long) range->start, + (unsigned long long) range->end); + return 0; } @@ -621,7 +672,11 @@ static ssize_t size_show(struct device * struct device_attribute *attr, char *buf) { struct dev_dax *dev_dax = to_dev_dax(dev); - unsigned long long size = range_len(&dev_dax->range); + unsigned long long size; + + device_lock(dev); + size = dev_dax_size(dev_dax); + device_unlock(dev); return sprintf(buf, "%llu\n", size); } @@ -639,32 +694,82 @@ static bool alloc_is_aligned(struct dax_ static int dev_dax_shrink(struct dev_dax *dev_dax, resource_size_t size) { + resource_size_t to_shrink = dev_dax_size(dev_dax) - size; struct dax_region *dax_region = dev_dax->region; - struct range *range = &dev_dax->range; - struct resource *res, *adjust = NULL; struct device *dev = &dev_dax->dev; + int i; - for_each_dax_region_resource(dax_region, res) - if (strcmp(res->name, dev_name(dev)) == 0 - && res->start == range->start) { - adjust = res; - break; + for (i = dev_dax->nr_range - 1; i >= 0; i--) { + struct range *range = &dev_dax->ranges[i].range; + struct resource *adjust = NULL, *res; + resource_size_t shrink; + + shrink = min_t(u64, to_shrink, range_len(range)); + if (shrink >= range_len(range)) { + __release_region(&dax_region->res, range->start, + range_len(range)); + dev_dax->nr_range--; + dev_dbg(dev, "delete range[%d]: %#llx:%#llx\n", i, + (unsigned long long) range->start, + (unsigned long long) range->end); + to_shrink -= shrink; + if (!to_shrink) + break; + continue; } - if (dev_WARN_ONCE(dev, !adjust, "failed to find matching resource\n")) - return -ENXIO; - return adjust_dev_dax_range(dev_dax, adjust, size); + for_each_dax_region_resource(dax_region, res) + if (strcmp(res->name, dev_name(dev)) == 0 + && res->start == range->start) { + adjust = res; + break; + } + + if (dev_WARN_ONCE(dev, !adjust || i != dev_dax->nr_range - 1, + "failed to find matching resource\n")) + return -ENXIO; + return adjust_dev_dax_range(dev_dax, adjust, range_len(range) + - shrink); + } + return 0; +} + +/* + * Only allow adjustments that preserve the relative pgoff of existing + * allocations. I.e. the dev_dax->ranges array is ordered by increasing pgoff. + */ +static bool adjust_ok(struct dev_dax *dev_dax, struct resource *res) +{ + struct dev_dax_range *last; + int i; + + if (dev_dax->nr_range == 0) + return false; + if (strcmp(res->name, dev_name(&dev_dax->dev)) != 0) + return false; + last = &dev_dax->ranges[dev_dax->nr_range - 1]; + if (last->range.start != res->start || last->range.end != res->end) + return false; + for (i = 0; i < dev_dax->nr_range - 1; i++) { + struct dev_dax_range *dax_range = &dev_dax->ranges[i]; + + if (dax_range->pgoff > last->pgoff) + return false; + } + + return true; } static ssize_t dev_dax_resize(struct dax_region *dax_region, struct dev_dax *dev_dax, resource_size_t size) { resource_size_t avail = dax_region_avail_size(dax_region), to_alloc; - resource_size_t dev_size = range_len(&dev_dax->range); + resource_size_t dev_size = dev_dax_size(dev_dax); struct resource *region_res = &dax_region->res; struct device *dev = &dev_dax->dev; - const char *name = dev_name(dev); struct resource *res, *first; + resource_size_t alloc = 0; + int rc; if (dev->driver) return -EBUSY; @@ -685,35 +790,47 @@ static ssize_t dev_dax_resize(struct dax * may involve adjusting the end of an existing resource, or * allocating a new resource. */ +retry: first = region_res->child; if (!first) return alloc_dev_dax_range(dev_dax, dax_region->res.start, to_alloc); - for (res = first; to_alloc && res; res = res->sibling) { + + rc = -ENOSPC; + for (res = first; res; res = res->sibling) { struct resource *next = res->sibling; - resource_size_t free; /* space at the beginning of the region */ - free = 0; - if (res == first && res->start > dax_region->res.start) - free = res->start - dax_region->res.start; - if (free >= to_alloc && dev_size == 0) - return alloc_dev_dax_range(dev_dax, dax_region->res.start, to_alloc); + if (res == first && res->start > dax_region->res.start) { + alloc = min(res->start - dax_region->res.start, to_alloc); + rc = alloc_dev_dax_range(dev_dax, dax_region->res.start, alloc); + break; + } - free = 0; + alloc = 0; /* space between allocations */ if (next && next->start > res->end + 1) - free = next->start - res->end + 1; + alloc = min(next->start - (res->end + 1), to_alloc); /* space at the end of the region */ - if (free < to_alloc && !next && res->end < region_res->end) - free = region_res->end - res->end; + if (!alloc && !next && res->end < region_res->end) + alloc = min(region_res->end - res->end, to_alloc); - if (free >= to_alloc && strcmp(name, res->name) == 0) - return adjust_dev_dax_range(dev_dax, res, resource_size(res) + to_alloc); - else if (free >= to_alloc && dev_size == 0) - return alloc_dev_dax_range(dev_dax, res->end + 1, to_alloc); + if (!alloc) + continue; + + if (adjust_ok(dev_dax, res)) { + rc = adjust_dev_dax_range(dev_dax, res, resource_size(res) + alloc); + break; + } + rc = alloc_dev_dax_range(dev_dax, res->end + 1, alloc); + break; } - return -ENOSPC; + if (rc) + return rc; + to_alloc -= alloc; + if (to_alloc) + goto retry; + return 0; } static ssize_t size_store(struct device *dev, struct device_attribute *attr, @@ -767,8 +884,15 @@ static ssize_t resource_show(struct devi struct device_attribute *attr, char *buf) { struct dev_dax *dev_dax = to_dev_dax(dev); + struct dax_region *dax_region = dev_dax->region; + unsigned long long start; + + if (dev_dax->nr_range < 1) + start = dax_region->res.start; + else + start = dev_dax->ranges[0].range.start; - return sprintf(buf, "%#llx\n", dev_dax->range.start); + return sprintf(buf, "%#llx\n", start); } static DEVICE_ATTR(resource, 0400, resource_show, NULL); @@ -833,6 +957,7 @@ static void dev_dax_release(struct devic put_dax(dax_dev); free_dev_dax_id(dev_dax); dax_region_put(dax_region); + kfree(dev_dax->ranges); kfree(dev_dax->pgmap); kfree(dev_dax); } @@ -941,7 +1066,7 @@ struct dev_dax *devm_create_dev_dax(stru err_alloc_dax: kfree(dev_dax->pgmap); err_pgmap: - free_dev_dax_range(dev_dax); + free_dev_dax_ranges(dev_dax); err_range: free_dev_dax_id(dev_dax); err_id: --- a/drivers/dax/dax-private.h~device-dax-add-dis-contiguous-resource-support +++ a/drivers/dax/dax-private.h @@ -49,7 +49,8 @@ struct dax_region { * @id: ida allocated id * @dev - device core * @pgmap - pgmap for memmap setup / lifetime (driver owned) - * @range: resource range for the instance + * @nr_range: size of @ranges + * @ranges: resource-span + pgoff tuples for the instance */ struct dev_dax { struct dax_region *region; @@ -58,7 +59,11 @@ struct dev_dax { int id; struct device dev; struct dev_pagemap *pgmap; - struct range range; + int nr_range; + struct dev_dax_range { + unsigned long pgoff; + struct range range; + } *ranges; }; static inline struct dev_dax *to_dev_dax(struct device *dev) --- a/drivers/dax/device.c~device-dax-add-dis-contiguous-resource-support +++ a/drivers/dax/device.c @@ -55,15 +55,22 @@ static int check_vma(struct dev_dax *dev __weak phys_addr_t dax_pgoff_to_phys(struct dev_dax *dev_dax, pgoff_t pgoff, unsigned long size) { - struct range *range = &dev_dax->range; - phys_addr_t phys; + int i; - phys = pgoff * PAGE_SIZE + range->start; - if (phys >= range->start && phys <= range->end) { + for (i = 0; i < dev_dax->nr_range; i++) { + struct dev_dax_range *dax_range = &dev_dax->ranges[i]; + struct range *range = &dax_range->range; + unsigned long long pgoff_end; + phys_addr_t phys; + + pgoff_end = dax_range->pgoff + PHYS_PFN(range_len(range)) - 1; + if (pgoff < dax_range->pgoff || pgoff > pgoff_end) + continue; + phys = PFN_PHYS(pgoff - dax_range->pgoff) + range->start; if (phys + size - 1 <= range->end) return phys; + break; } - return -1; } @@ -395,30 +402,40 @@ static void dev_dax_kill(void *dev_dax) int dev_dax_probe(struct dev_dax *dev_dax) { struct dax_device *dax_dev = dev_dax->dax_dev; - struct range *range = &dev_dax->range; struct device *dev = &dev_dax->dev; struct dev_pagemap *pgmap; struct inode *inode; struct cdev *cdev; void *addr; - int rc; - - /* 1:1 map region resource range to device-dax instance range */ - if (!devm_request_mem_region(dev, range->start, range_len(range), - dev_name(dev))) { - dev_warn(dev, "could not reserve range: %#llx - %#llx\n", - range->start, range->end); - return -EBUSY; - } + int rc, i; pgmap = dev_dax->pgmap; + if (dev_WARN_ONCE(dev, pgmap && dev_dax->nr_range > 1, + "static pgmap / multi-range device conflict\n")) + return -EINVAL; + if (!pgmap) { - pgmap = devm_kzalloc(dev, sizeof(*pgmap), GFP_KERNEL); + pgmap = devm_kzalloc(dev, sizeof(*pgmap) + sizeof(struct range) + * (dev_dax->nr_range - 1), GFP_KERNEL); if (!pgmap) return -ENOMEM; - pgmap->range = *range; - pgmap->nr_range = 1; + pgmap->nr_range = dev_dax->nr_range; + } + + for (i = 0; i < dev_dax->nr_range; i++) { + struct range *range = &dev_dax->ranges[i].range; + + if (!devm_request_mem_region(dev, range->start, + range_len(range), dev_name(dev))) { + dev_warn(dev, "mapping%d: %#llx-%#llx could not reserve range\n", + i, range->start, range->end); + return -EBUSY; + } + /* don't update the range for static pgmap */ + if (!dev_dax->pgmap) + pgmap->ranges[i] = *range; } + pgmap->type = MEMORY_DEVICE_GENERIC; addr = devm_memremap_pages(dev, pgmap); if (IS_ERR(addr)) --- a/drivers/dax/kmem.c~device-dax-add-dis-contiguous-resource-support +++ a/drivers/dax/kmem.c @@ -19,24 +19,28 @@ static const char *kmem_name; /* Set if any memory will remain added when the driver will be unloaded. */ static bool any_hotremove_failed; -static struct range dax_kmem_range(struct dev_dax *dev_dax) +static int dax_kmem_range(struct dev_dax *dev_dax, int i, struct range *r) { - struct range range; + struct dev_dax_range *dax_range = &dev_dax->ranges[i]; + struct range *range = &dax_range->range; /* memory-block align the hotplug range */ - range.start = ALIGN(dev_dax->range.start, memory_block_size_bytes()); - range.end = ALIGN_DOWN(dev_dax->range.end + 1, memory_block_size_bytes()) - 1; - return range; + r->start = ALIGN(range->start, memory_block_size_bytes()); + r->end = ALIGN_DOWN(range->end + 1, memory_block_size_bytes()) - 1; + if (r->start >= r->end) { + r->start = range->start; + r->end = range->end; + return -ENOSPC; + } + return 0; } static int dev_dax_kmem_probe(struct dev_dax *dev_dax) { - struct range range = dax_kmem_range(dev_dax); struct device *dev = &dev_dax->dev; - struct resource *res; + int i, mapped = 0; char *res_name; int numa_node; - int rc; /* * Ensure good NUMA information for the persistent memory. @@ -55,31 +59,58 @@ static int dev_dax_kmem_probe(struct dev if (!res_name) return -ENOMEM; - /* Region is permanently reserved if hotremove fails. */ - res = request_mem_region(range.start, range_len(&range), res_name); - if (!res) { - dev_warn(dev, "could not reserve region [%#llx-%#llx]\n", range.start, range.end); - kfree(res_name); - return -EBUSY; - } - - /* - * Set flags appropriate for System RAM. Leave ..._BUSY clear - * so that add_memory() can add a child resource. Do not - * inherit flags from the parent since it may set new flags - * unknown to us that will break add_memory() below. - */ - res->flags = IORESOURCE_SYSTEM_RAM; - - /* - * Ensure that future kexec'd kernels will not treat this as RAM - * automatically. - */ - rc = add_memory_driver_managed(numa_node, range.start, range_len(&range), kmem_name); - if (rc) { - release_mem_region(range.start, range_len(&range)); - kfree(res_name); - return rc; + for (i = 0; i < dev_dax->nr_range; i++) { + struct resource *res; + struct range range; + int rc; + + rc = dax_kmem_range(dev_dax, i, &range); + if (rc) { + dev_info(dev, "mapping%d: %#llx-%#llx too small after alignment\n", + i, range.start, range.end); + continue; + } + + /* Region is permanently reserved if hotremove fails. */ + res = request_mem_region(range.start, range_len(&range), res_name); + if (!res) { + dev_warn(dev, "mapping%d: %#llx-%#llx could not reserve region\n", + i, range.start, range.end); + /* + * Once some memory has been onlined we can't + * assume that it can be un-onlined safely. + */ + if (mapped) + continue; + kfree(res_name); + return -EBUSY; + } + + /* + * Set flags appropriate for System RAM. Leave ..._BUSY clear + * so that add_memory() can add a child resource. Do not + * inherit flags from the parent since it may set new flags + * unknown to us that will break add_memory() below. + */ + res->flags = IORESOURCE_SYSTEM_RAM; + + /* + * Ensure that future kexec'd kernels will not treat + * this as RAM automatically. + */ + rc = add_memory_driver_managed(numa_node, range.start, + range_len(&range), kmem_name); + + if (rc) { + dev_warn(dev, "mapping%d: %#llx-%#llx memory add failed\n", + i, range.start, range.end); + release_mem_region(range.start, range_len(&range)); + if (mapped) + continue; + kfree(res_name); + return rc; + } + mapped++; } dev_set_drvdata(dev, res_name); @@ -90,9 +121,8 @@ static int dev_dax_kmem_probe(struct dev #ifdef CONFIG_MEMORY_HOTREMOVE static int dev_dax_kmem_remove(struct dev_dax *dev_dax) { - int rc; + int i, success = 0; struct device *dev = &dev_dax->dev; - struct range range = dax_kmem_range(dev_dax); const char *res_name = dev_get_drvdata(dev); /* @@ -101,17 +131,31 @@ static int dev_dax_kmem_remove(struct de * there is no way to hotremove this memory until reboot because device * unbind will succeed even if we return failure. */ - rc = remove_memory(dev_dax->target_node, range.start, range_len(&range)); - if (rc) { + for (i = 0; i < dev_dax->nr_range; i++) { + struct range range; + int rc; + + rc = dax_kmem_range(dev_dax, i, &range); + if (rc) + continue; + + rc = remove_memory(dev_dax->target_node, range.start, + range_len(&range)); + if (rc == 0) { + release_mem_region(range.start, range_len(&range)); + success++; + continue; + } any_hotremove_failed = true; - dev_err(dev, "%#llx-%#llx cannot be hotremoved until the next reboot\n", - range.start, range.end); - return rc; + dev_err(dev, + "mapping%d: %#llx-%#llx cannot be hotremoved until the next reboot\n", + i, range.start, range.end); } - /* Release and free dax resources */ - release_mem_region(range.start, range_len(&range)); - kfree(res_name); + if (success >= dev_dax->nr_range) { + kfree(res_name); + dev_set_drvdata(dev, NULL); + } return 0; } --- a/tools/testing/nvdimm/dax-dev.c~device-dax-add-dis-contiguous-resource-support +++ a/tools/testing/nvdimm/dax-dev.c @@ -9,11 +9,18 @@ phys_addr_t dax_pgoff_to_phys(struct dev_dax *dev_dax, pgoff_t pgoff, unsigned long size) { - struct range *range = &dev_dax->range; - phys_addr_t addr; + int i; - addr = pgoff * PAGE_SIZE + range->start; - if (addr >= range->start && addr <= range->end) { + for (i = 0; i < dev_dax->nr_range; i++) { + struct dev_dax_range *dax_range = &dev_dax->ranges[i]; + struct range *range = &dax_range->range; + unsigned long long pgoff_end; + phys_addr_t addr; + + pgoff_end = dax_range->pgoff + PHYS_PFN(range_len(range)) - 1; + if (pgoff < dax_range->pgoff || pgoff > pgoff_end) + continue; + addr = PFN_PHYS(pgoff - dax_range->pgoff) + range->start; if (addr + size - 1 <= range->end) { if (get_nfit_res(addr)) { struct page *page; @@ -23,9 +30,10 @@ phys_addr_t dax_pgoff_to_phys(struct dev page = vmalloc_to_page((void *)addr); return PFN_PHYS(page_to_pfn(page)); - } else - return addr; + } + return addr; } + break; } return -1; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 047/181] device-dax: introduce 'mapping' devices 2020-10-13 23:46 incoming Andrew Morton ` (45 preceding siblings ...) 2020-10-13 23:50 ` [patch 046/181] device-dax: add dis-contiguous resource support Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 048/181] device-dax: make align a per-device property Andrew Morton ` (133 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: introduce 'mapping' devices In support of interrogating the physical address layout of a device with dis-contiguous ranges, introduce a sysfs directory with 'start', 'end', and 'page_offset' attributes. The alternative is trying to parse /proc/iomem, and that file will not reflect the extent layout until the device is enabled. Link: https://lkml.kernel.org/r/159643104819.4062302.13691281391423291589.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lkml.kernel.org/r/160106117446.30709.2751020815463722537.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Joao Martins <joao.m.martins@oracle.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 191 +++++++++++++++++++++++++++++++++++- drivers/dax/dax-private.h | 14 ++ 2 files changed, 203 insertions(+), 2 deletions(-) --- a/drivers/dax/bus.c~device-dax-introduce-mapping-devices +++ a/drivers/dax/bus.c @@ -579,6 +579,167 @@ struct dax_region *alloc_dax_region(stru } EXPORT_SYMBOL_GPL(alloc_dax_region); +static void dax_mapping_release(struct device *dev) +{ + struct dax_mapping *mapping = to_dax_mapping(dev); + struct dev_dax *dev_dax = to_dev_dax(dev->parent); + + ida_free(&dev_dax->ida, mapping->id); + kfree(mapping); +} + +static void unregister_dax_mapping(void *data) +{ + struct device *dev = data; + struct dax_mapping *mapping = to_dax_mapping(dev); + struct dev_dax *dev_dax = to_dev_dax(dev->parent); + struct dax_region *dax_region = dev_dax->region; + + dev_dbg(dev, "%s\n", __func__); + + device_lock_assert(dax_region->dev); + + dev_dax->ranges[mapping->range_id].mapping = NULL; + mapping->range_id = -1; + + device_del(dev); + put_device(dev); +} + +static struct dev_dax_range *get_dax_range(struct device *dev) +{ + struct dax_mapping *mapping = to_dax_mapping(dev); + struct dev_dax *dev_dax = to_dev_dax(dev->parent); + struct dax_region *dax_region = dev_dax->region; + + device_lock(dax_region->dev); + if (mapping->range_id < 0) { + device_unlock(dax_region->dev); + return NULL; + } + + return &dev_dax->ranges[mapping->range_id]; +} + +static void put_dax_range(struct dev_dax_range *dax_range) +{ + struct dax_mapping *mapping = dax_range->mapping; + struct dev_dax *dev_dax = to_dev_dax(mapping->dev.parent); + struct dax_region *dax_region = dev_dax->region; + + device_unlock(dax_region->dev); +} + +static ssize_t start_show(struct device *dev, + struct device_attribute *attr, char *buf) +{ + struct dev_dax_range *dax_range; + ssize_t rc; + + dax_range = get_dax_range(dev); + if (!dax_range) + return -ENXIO; + rc = sprintf(buf, "%#llx\n", dax_range->range.start); + put_dax_range(dax_range); + + return rc; +} +static DEVICE_ATTR(start, 0400, start_show, NULL); + +static ssize_t end_show(struct device *dev, + struct device_attribute *attr, char *buf) +{ + struct dev_dax_range *dax_range; + ssize_t rc; + + dax_range = get_dax_range(dev); + if (!dax_range) + return -ENXIO; + rc = sprintf(buf, "%#llx\n", dax_range->range.end); + put_dax_range(dax_range); + + return rc; +} +static DEVICE_ATTR(end, 0400, end_show, NULL); + +static ssize_t pgoff_show(struct device *dev, + struct device_attribute *attr, char *buf) +{ + struct dev_dax_range *dax_range; + ssize_t rc; + + dax_range = get_dax_range(dev); + if (!dax_range) + return -ENXIO; + rc = sprintf(buf, "%#lx\n", dax_range->pgoff); + put_dax_range(dax_range); + + return rc; +} +static DEVICE_ATTR(page_offset, 0400, pgoff_show, NULL); + +static struct attribute *dax_mapping_attributes[] = { + &dev_attr_start.attr, + &dev_attr_end.attr, + &dev_attr_page_offset.attr, + NULL, +}; + +static const struct attribute_group dax_mapping_attribute_group = { + .attrs = dax_mapping_attributes, +}; + +static const struct attribute_group *dax_mapping_attribute_groups[] = { + &dax_mapping_attribute_group, + NULL, +}; + +static struct device_type dax_mapping_type = { + .release = dax_mapping_release, + .groups = dax_mapping_attribute_groups, +}; + +static int devm_register_dax_mapping(struct dev_dax *dev_dax, int range_id) +{ + struct dax_region *dax_region = dev_dax->region; + struct dax_mapping *mapping; + struct device *dev; + int rc; + + device_lock_assert(dax_region->dev); + + if (dev_WARN_ONCE(&dev_dax->dev, !dax_region->dev->driver, + "region disabled\n")) + return -ENXIO; + + mapping = kzalloc(sizeof(*mapping), GFP_KERNEL); + if (!mapping) + return -ENOMEM; + mapping->range_id = range_id; + mapping->id = ida_alloc(&dev_dax->ida, GFP_KERNEL); + if (mapping->id < 0) { + kfree(mapping); + return -ENOMEM; + } + dev_dax->ranges[range_id].mapping = mapping; + dev = &mapping->dev; + device_initialize(dev); + dev->parent = &dev_dax->dev; + dev->type = &dax_mapping_type; + dev_set_name(dev, "mapping%d", mapping->id); + rc = device_add(dev); + if (rc) { + put_device(dev); + return rc; + } + + rc = devm_add_action_or_reset(dax_region->dev, unregister_dax_mapping, + dev); + if (rc) + return rc; + return 0; +} + static int alloc_dev_dax_range(struct dev_dax *dev_dax, u64 start, resource_size_t size) { @@ -588,7 +749,7 @@ static int alloc_dev_dax_range(struct de struct dev_dax_range *ranges; unsigned long pgoff = 0; struct resource *alloc; - int i; + int i, rc; device_lock_assert(dax_region->dev); @@ -633,6 +794,22 @@ static int alloc_dev_dax_range(struct de dev_dbg(dev, "alloc range[%d]: %pa:%pa\n", dev_dax->nr_range - 1, &alloc->start, &alloc->end); + /* + * A dev_dax instance must be registered before mapping device + * children can be added. Defer to devm_create_dev_dax() to add + * the initial mapping device. + */ + if (!device_is_registered(&dev_dax->dev)) + return 0; + + rc = devm_register_dax_mapping(dev_dax, dev_dax->nr_range - 1); + if (rc) { + dev_dbg(dev, "delete range[%d]: %pa:%pa\n", dev_dax->nr_range - 1, + &alloc->start, &alloc->end); + dev_dax->nr_range--; + __release_region(res, alloc->start, resource_size(alloc)); + return rc; + } return 0; } @@ -701,11 +878,14 @@ static int dev_dax_shrink(struct dev_dax for (i = dev_dax->nr_range - 1; i >= 0; i--) { struct range *range = &dev_dax->ranges[i].range; + struct dax_mapping *mapping = dev_dax->ranges[i].mapping; struct resource *adjust = NULL, *res; resource_size_t shrink; shrink = min_t(u64, to_shrink, range_len(range)); if (shrink >= range_len(range)) { + devm_release_action(dax_region->dev, + unregister_dax_mapping, &mapping->dev); __release_region(&dax_region->res, range->start, range_len(range)); dev_dax->nr_range--; @@ -1036,9 +1216,9 @@ struct dev_dax *devm_create_dev_dax(stru /* a device_dax instance is dead while the driver is not attached */ kill_dax(dax_dev); - /* from here on we're committed to teardown via dev_dax_release() */ dev_dax->dax_dev = dax_dev; dev_dax->target_node = dax_region->target_node; + ida_init(&dev_dax->ida); kref_get(&dax_region->kref); inode = dax_inode(dax_dev); @@ -1061,6 +1241,13 @@ struct dev_dax *devm_create_dev_dax(stru if (rc) return ERR_PTR(rc); + /* register mapping device for the initial allocation range */ + if (dev_dax->nr_range && range_len(&dev_dax->ranges[0].range)) { + rc = devm_register_dax_mapping(dev_dax, 0); + if (rc) + return ERR_PTR(rc); + } + return dev_dax; err_alloc_dax: --- a/drivers/dax/dax-private.h~device-dax-introduce-mapping-devices +++ a/drivers/dax/dax-private.h @@ -40,6 +40,12 @@ struct dax_region { struct device *youngest; }; +struct dax_mapping { + struct device dev; + int range_id; + int id; +}; + /** * struct dev_dax - instance data for a subdivision of a dax region, and * data while the device is activated in the driver. @@ -47,6 +53,7 @@ struct dax_region { * @dax_dev - core dax functionality * @target_node: effective numa node if dev_dax memory range is onlined * @id: ida allocated id + * @ida: mapping id allocator * @dev - device core * @pgmap - pgmap for memmap setup / lifetime (driver owned) * @nr_range: size of @ranges @@ -57,12 +64,14 @@ struct dev_dax { struct dax_device *dax_dev; int target_node; int id; + struct ida ida; struct device dev; struct dev_pagemap *pgmap; int nr_range; struct dev_dax_range { unsigned long pgoff; struct range range; + struct dax_mapping *mapping; } *ranges; }; @@ -70,4 +79,9 @@ static inline struct dev_dax *to_dev_dax { return container_of(dev, struct dev_dax, dev); } + +static inline struct dax_mapping *to_dax_mapping(struct device *dev) +{ + return container_of(dev, struct dax_mapping, dev); +} #endif _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 048/181] device-dax: make align a per-device property 2020-10-13 23:46 incoming Andrew Morton ` (46 preceding siblings ...) 2020-10-13 23:50 ` [patch 047/181] device-dax: introduce 'mapping' devices Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:50 ` [patch 049/181] device-dax: add an 'align' attribute Andrew Morton ` (132 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Joao Martins <joao.m.martins@oracle.com> Subject: device-dax: make align a per-device property Introduce @align to struct dev_dax. When creating a new device, we still initialize to the default dax_region @align. Child devices belonging to a region may wish to keep a different alignment property instead of a global region-defined one. Link: https://lkml.kernel.org/r/159643105377.4062302.4159447829955683131.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lore.kernel.org/r/20200716172913.19658-2-joao.m.martins@oracle.com Link: https://lkml.kernel.org/r/160106117957.30709.1142303024324655705.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Joao Martins <joao.m.martins@oracle.com> Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 1 drivers/dax/dax-private.h | 3 ++ drivers/dax/device.c | 41 +++++++++++++----------------------- 3 files changed, 19 insertions(+), 26 deletions(-) --- a/drivers/dax/bus.c~device-dax-make-align-a-per-device-property +++ a/drivers/dax/bus.c @@ -1218,6 +1218,7 @@ struct dev_dax *devm_create_dev_dax(stru dev_dax->dax_dev = dax_dev; dev_dax->target_node = dax_region->target_node; + dev_dax->align = dax_region->align; ida_init(&dev_dax->ida); kref_get(&dax_region->kref); --- a/drivers/dax/dax-private.h~device-dax-make-align-a-per-device-property +++ a/drivers/dax/dax-private.h @@ -62,6 +62,7 @@ struct dax_mapping { struct dev_dax { struct dax_region *region; struct dax_device *dax_dev; + unsigned int align; int target_node; int id; struct ida ida; @@ -84,4 +85,6 @@ static inline struct dax_mapping *to_dax { return container_of(dev, struct dax_mapping, dev); } + +phys_addr_t dax_pgoff_to_phys(struct dev_dax *dev_dax, pgoff_t pgoff, unsigned long size); #endif --- a/drivers/dax/device.c~device-dax-make-align-a-per-device-property +++ a/drivers/dax/device.c @@ -17,7 +17,6 @@ static int check_vma(struct dev_dax *dev_dax, struct vm_area_struct *vma, const char *func) { - struct dax_region *dax_region = dev_dax->region; struct device *dev = &dev_dax->dev; unsigned long mask; @@ -32,7 +31,7 @@ static int check_vma(struct dev_dax *dev return -EINVAL; } - mask = dax_region->align - 1; + mask = dev_dax->align - 1; if (vma->vm_start & mask || vma->vm_end & mask) { dev_info_ratelimited(dev, "%s: %s: fail, unaligned vma (%#lx - %#lx, %#lx)\n", @@ -78,21 +77,19 @@ static vm_fault_t __dev_dax_pte_fault(st struct vm_fault *vmf, pfn_t *pfn) { struct device *dev = &dev_dax->dev; - struct dax_region *dax_region; phys_addr_t phys; unsigned int fault_size = PAGE_SIZE; if (check_vma(dev_dax, vmf->vma, __func__)) return VM_FAULT_SIGBUS; - dax_region = dev_dax->region; - if (dax_region->align > PAGE_SIZE) { + if (dev_dax->align > PAGE_SIZE) { dev_dbg(dev, "alignment (%#x) > fault size (%#x)\n", - dax_region->align, fault_size); + dev_dax->align, fault_size); return VM_FAULT_SIGBUS; } - if (fault_size != dax_region->align) + if (fault_size != dev_dax->align) return VM_FAULT_SIGBUS; phys = dax_pgoff_to_phys(dev_dax, vmf->pgoff, PAGE_SIZE); @@ -111,7 +108,6 @@ static vm_fault_t __dev_dax_pmd_fault(st { unsigned long pmd_addr = vmf->address & PMD_MASK; struct device *dev = &dev_dax->dev; - struct dax_region *dax_region; phys_addr_t phys; pgoff_t pgoff; unsigned int fault_size = PMD_SIZE; @@ -119,16 +115,15 @@ static vm_fault_t __dev_dax_pmd_fault(st if (check_vma(dev_dax, vmf->vma, __func__)) return VM_FAULT_SIGBUS; - dax_region = dev_dax->region; - if (dax_region->align > PMD_SIZE) { + if (dev_dax->align > PMD_SIZE) { dev_dbg(dev, "alignment (%#x) > fault size (%#x)\n", - dax_region->align, fault_size); + dev_dax->align, fault_size); return VM_FAULT_SIGBUS; } - if (fault_size < dax_region->align) + if (fault_size < dev_dax->align) return VM_FAULT_SIGBUS; - else if (fault_size > dax_region->align) + else if (fault_size > dev_dax->align) return VM_FAULT_FALLBACK; /* if we are outside of the VMA */ @@ -154,7 +149,6 @@ static vm_fault_t __dev_dax_pud_fault(st { unsigned long pud_addr = vmf->address & PUD_MASK; struct device *dev = &dev_dax->dev; - struct dax_region *dax_region; phys_addr_t phys; pgoff_t pgoff; unsigned int fault_size = PUD_SIZE; @@ -163,16 +157,15 @@ static vm_fault_t __dev_dax_pud_fault(st if (check_vma(dev_dax, vmf->vma, __func__)) return VM_FAULT_SIGBUS; - dax_region = dev_dax->region; - if (dax_region->align > PUD_SIZE) { + if (dev_dax->align > PUD_SIZE) { dev_dbg(dev, "alignment (%#x) > fault size (%#x)\n", - dax_region->align, fault_size); + dev_dax->align, fault_size); return VM_FAULT_SIGBUS; } - if (fault_size < dax_region->align) + if (fault_size < dev_dax->align) return VM_FAULT_SIGBUS; - else if (fault_size > dax_region->align) + else if (fault_size > dev_dax->align) return VM_FAULT_FALLBACK; /* if we are outside of the VMA */ @@ -267,9 +260,8 @@ static int dev_dax_split(struct vm_area_ { struct file *filp = vma->vm_file; struct dev_dax *dev_dax = filp->private_data; - struct dax_region *dax_region = dev_dax->region; - if (!IS_ALIGNED(addr, dax_region->align)) + if (!IS_ALIGNED(addr, dev_dax->align)) return -EINVAL; return 0; } @@ -278,9 +270,8 @@ static unsigned long dev_dax_pagesize(st { struct file *filp = vma->vm_file; struct dev_dax *dev_dax = filp->private_data; - struct dax_region *dax_region = dev_dax->region; - return dax_region->align; + return dev_dax->align; } static const struct vm_operations_struct dax_vm_ops = { @@ -319,13 +310,11 @@ static unsigned long dax_get_unmapped_ar { unsigned long off, off_end, off_align, len_align, addr_align, align; struct dev_dax *dev_dax = filp ? filp->private_data : NULL; - struct dax_region *dax_region; if (!dev_dax || addr) goto out; - dax_region = dev_dax->region; - align = dax_region->align; + align = dev_dax->align; off = pgoff << PAGE_SHIFT; off_end = off + len; off_align = round_up(off, align); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 049/181] device-dax: add an 'align' attribute 2020-10-13 23:46 incoming Andrew Morton ` (47 preceding siblings ...) 2020-10-13 23:50 ` [patch 048/181] device-dax: make align a per-device property Andrew Morton @ 2020-10-13 23:50 ` Andrew Morton 2020-10-13 23:51 ` [patch 050/181] dax/hmem: introduce dax_hmem.region_idle parameter Andrew Morton ` (131 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:50 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Dan Williams <dan.j.williams@intel.com> Subject: device-dax: add an 'align' attribute Introduce a device align attribute. While doing so, rename the region align attribute to be more explicitly named as so, but keep it named as @align to retain the API for tools like daxctl. Changes on align may not always be valid, when say certain mappings were created with 2M and then we switch to 1G. So, we validate all ranges against the new value being attempted, post resizing. Link: https://lkml.kernel.org/r/159643105944.4062302.3131761052969132784.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lore.kernel.org/r/20200716172913.19658-3-joao.m.martins@oracle.com Link: https://lkml.kernel.org/r/160106118486.30709.13012322227204800596.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Joao Martins <joao.m.martins@oracle.com> Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 93 ++++++++++++++++++++++++++++++++---- drivers/dax/dax-private.h | 18 ++++++ 2 files changed, 101 insertions(+), 10 deletions(-) --- a/drivers/dax/bus.c~device-dax-add-an-align-attribute +++ a/drivers/dax/bus.c @@ -230,14 +230,15 @@ static ssize_t region_size_show(struct d static struct device_attribute dev_attr_region_size = __ATTR(size, 0444, region_size_show, NULL); -static ssize_t align_show(struct device *dev, +static ssize_t region_align_show(struct device *dev, struct device_attribute *attr, char *buf) { struct dax_region *dax_region = dev_get_drvdata(dev); return sprintf(buf, "%u\n", dax_region->align); } -static DEVICE_ATTR_RO(align); +static struct device_attribute dev_attr_region_align = + __ATTR(align, 0400, region_align_show, NULL); #define for_each_dax_region_resource(dax_region, res) \ for (res = (dax_region)->res.child; res; res = res->sibling) @@ -488,7 +489,7 @@ static umode_t dax_region_visible(struct static struct attribute *dax_region_attributes[] = { &dev_attr_available_size.attr, &dev_attr_region_size.attr, - &dev_attr_align.attr, + &dev_attr_region_align.attr, &dev_attr_create.attr, &dev_attr_seed.attr, &dev_attr_delete.attr, @@ -858,15 +859,13 @@ static ssize_t size_show(struct device * return sprintf(buf, "%llu\n", size); } -static bool alloc_is_aligned(struct dax_region *dax_region, - resource_size_t size) +static bool alloc_is_aligned(struct dev_dax *dev_dax, resource_size_t size) { /* * The minimum mapping granularity for a device instance is a * single subsection, unless the arch says otherwise. */ - return IS_ALIGNED(size, max_t(unsigned long, dax_region->align, - memremap_compat_align())); + return IS_ALIGNED(size, max_t(unsigned long, dev_dax->align, memremap_compat_align())); } static int dev_dax_shrink(struct dev_dax *dev_dax, resource_size_t size) @@ -961,7 +960,7 @@ static ssize_t dev_dax_resize(struct dax return dev_dax_shrink(dev_dax, size); to_alloc = size - dev_size; - if (dev_WARN_ONCE(dev, !alloc_is_aligned(dax_region, to_alloc), + if (dev_WARN_ONCE(dev, !alloc_is_aligned(dev_dax, to_alloc), "resize of %pa misaligned\n", &to_alloc)) return -ENXIO; @@ -1025,7 +1024,7 @@ static ssize_t size_store(struct device if (rc) return rc; - if (!alloc_is_aligned(dax_region, val)) { + if (!alloc_is_aligned(dev_dax, val)) { dev_dbg(dev, "%s: size: %lld misaligned\n", __func__, val); return -EINVAL; } @@ -1044,6 +1043,78 @@ static ssize_t size_store(struct device } static DEVICE_ATTR_RW(size); +static ssize_t align_show(struct device *dev, + struct device_attribute *attr, char *buf) +{ + struct dev_dax *dev_dax = to_dev_dax(dev); + + return sprintf(buf, "%d\n", dev_dax->align); +} + +static ssize_t dev_dax_validate_align(struct dev_dax *dev_dax) +{ + resource_size_t dev_size = dev_dax_size(dev_dax); + struct device *dev = &dev_dax->dev; + int i; + + if (dev_size > 0 && !alloc_is_aligned(dev_dax, dev_size)) { + dev_dbg(dev, "%s: align %u invalid for size %pa\n", + __func__, dev_dax->align, &dev_size); + return -EINVAL; + } + + for (i = 0; i < dev_dax->nr_range; i++) { + size_t len = range_len(&dev_dax->ranges[i].range); + + if (!alloc_is_aligned(dev_dax, len)) { + dev_dbg(dev, "%s: align %u invalid for range %d\n", + __func__, dev_dax->align, i); + return -EINVAL; + } + } + + return 0; +} + +static ssize_t align_store(struct device *dev, struct device_attribute *attr, + const char *buf, size_t len) +{ + struct dev_dax *dev_dax = to_dev_dax(dev); + struct dax_region *dax_region = dev_dax->region; + unsigned long val, align_save; + ssize_t rc; + + rc = kstrtoul(buf, 0, &val); + if (rc) + return -ENXIO; + + if (!dax_align_valid(val)) + return -EINVAL; + + device_lock(dax_region->dev); + if (!dax_region->dev->driver) { + device_unlock(dax_region->dev); + return -ENXIO; + } + + device_lock(dev); + if (dev->driver) { + rc = -EBUSY; + goto out_unlock; + } + + align_save = dev_dax->align; + dev_dax->align = val; + rc = dev_dax_validate_align(dev_dax); + if (rc) + dev_dax->align = align_save; +out_unlock: + device_unlock(dev); + device_unlock(dax_region->dev); + return rc == 0 ? len : rc; +} +static DEVICE_ATTR_RW(align); + static int dev_dax_target_node(struct dev_dax *dev_dax) { struct dax_region *dax_region = dev_dax->region; @@ -1104,7 +1175,8 @@ static umode_t dev_dax_visible(struct ko return 0; if (a == &dev_attr_numa_node.attr && !IS_ENABLED(CONFIG_NUMA)) return 0; - if (a == &dev_attr_size.attr && is_static(dax_region)) + if ((a == &dev_attr_align.attr || + a == &dev_attr_size.attr) && is_static(dax_region)) return 0444; return a->mode; } @@ -1113,6 +1185,7 @@ static struct attribute *dev_dax_attribu &dev_attr_modalias.attr, &dev_attr_size.attr, &dev_attr_target_node.attr, + &dev_attr_align.attr, &dev_attr_resource.attr, &dev_attr_numa_node.attr, NULL, --- a/drivers/dax/dax-private.h~device-dax-add-an-align-attribute +++ a/drivers/dax/dax-private.h @@ -87,4 +87,22 @@ static inline struct dax_mapping *to_dax } phys_addr_t dax_pgoff_to_phys(struct dev_dax *dev_dax, pgoff_t pgoff, unsigned long size); + +#ifdef CONFIG_TRANSPARENT_HUGEPAGE +static inline bool dax_align_valid(unsigned long align) +{ + if (align == PUD_SIZE && IS_ENABLED(CONFIG_HAVE_ARCH_TRANSPARENT_HUGEPAGE_PUD)) + return true; + if (align == PMD_SIZE && has_transparent_hugepage()) + return true; + if (align == PAGE_SIZE) + return true; + return false; +} +#else +static inline bool dax_align_valid(unsigned long align) +{ + return align == PAGE_SIZE; +} +#endif /* CONFIG_TRANSPARENT_HUGEPAGE */ #endif _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 050/181] dax/hmem: introduce dax_hmem.region_idle parameter 2020-10-13 23:46 incoming Andrew Morton ` (48 preceding siblings ...) 2020-10-13 23:50 ` [patch 049/181] device-dax: add an 'align' attribute Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 051/181] device-dax: add a range mapping allocation attribute Andrew Morton ` (130 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Joao Martins <joao.m.martins@oracle.com> Subject: dax/hmem: introduce dax_hmem.region_idle parameter Introduce a new module parameter for dax_hmem which initializes all region devices as free, rather than allocating a pagemap for the region by default. All hmem devices created with dax_hmem.region_idle=1 will have full available size for creating dynamic dax devices. Link: https://lkml.kernel.org/r/159643106460.4062302.5868522341307530091.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lore.kernel.org/r/20200716172913.19658-4-joao.m.martins@oracle.com Link: https://lkml.kernel.org/r/160106119033.30709.11249962152222193448.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Joao Martins <joao.m.martins@oracle.com> Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/hmem/hmem.c | 5 ++++- 1 file changed, 4 insertions(+), 1 deletion(-) --- a/drivers/dax/hmem/hmem.c~dax-hmem-introduce-dax_hmemregion_idle-parameter +++ a/drivers/dax/hmem/hmem.c @@ -5,6 +5,9 @@ #include <linux/pfn_t.h> #include "../bus.h" +static bool region_idle; +module_param_named(region_idle, region_idle, bool, 0644); + static int dax_hmem_probe(struct platform_device *pdev) { struct device *dev = &pdev->dev; @@ -30,7 +33,7 @@ static int dax_hmem_probe(struct platfor data = (struct dev_dax_data) { .dax_region = dax_region, .id = -1, - .size = resource_size(res), + .size = region_idle ? 0 : resource_size(res), }; dev_dax = devm_create_dev_dax(&data); if (IS_ERR(dev_dax)) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 051/181] device-dax: add a range mapping allocation attribute 2020-10-13 23:46 incoming Andrew Morton ` (49 preceding siblings ...) 2020-10-13 23:51 ` [patch 050/181] dax/hmem: introduce dax_hmem.region_idle parameter Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 052/181] mm/debug.c: do not dereference i_ino blindly Andrew Morton ` (129 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: airlied, akpm, ard.biesheuvel, ardb, benh, bhelgaas, boris.ostrovsky, bp, Brice.Goglin, bskeggs, catalin.marinas, dan.j.williams, daniel, dave.hansen, dave.jiang, david, gregkh, hpa, hulkci, ira.weiny, jgg, jglisse, jgross, jmoyer, joao.m.martins, Jonathan.Cameron, justin.he, linux-mm, lkp, luto, mingo, mm-commits, mpe, pasha.tatashin, paulus, peterz, rafael.j.wysocki, rdunlap, richard.weiyang, rppt, sstabellini, tglx, thomas.lendacky, torvalds, vgoyal, vishal.l.verma, will, yanaijie From: Joao Martins <joao.m.martins@oracle.com> Subject: device-dax: add a range mapping allocation attribute Add a sysfs attribute which denotes a range from the dax region to be allocated. It's an write only @mapping sysfs attribute in the format of '<start>-<end>' to allocate a range. @start and @end use hexadecimal values and the @pgoff is implicitly ordered wrt to previous writes to @mapping sysfs e.g. a write of a range of length 1G the pgoff is 0..1G(-4K), a second write will use @pgoff for 1G+4K..<size>. This range mapping interface is useful for: 1) Application which want to implement its own allocation logic, and thus pick the desired ranges from dax_region. 2) For use cases like VMM fast restart[0] where after kexec we want to the same gpa<->phys mappings (as originally created before kexec). [0] https://static.sched.com/hosted_files/kvmforum2019/66/VMM-fast-restart_kvmforum2019.pdf Link: https://lkml.kernel.org/r/159643106970.4062302.10402616567780784722.stgit@dwillia2-desk3.amr.corp.intel.com Link: https://lore.kernel.org/r/20200716172913.19658-5-joao.m.martins@oracle.com Link: https://lkml.kernel.org/r/160106119570.30709.4548889722645210610.stgit@dwillia2-desk3.amr.corp.intel.com Signed-off-by: Joao Martins <joao.m.martins@oracle.com> Signed-off-by: Dan Williams <dan.j.williams@intel.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Ard Biesheuvel <ard.biesheuvel@linaro.org> Cc: Ard Biesheuvel <ardb@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Ben Skeggs <bskeggs@redhat.com> Cc: Bjorn Helgaas <bhelgaas@google.com> Cc: Borislav Petkov <bp@alien8.de> Cc: Boris Ostrovsky <boris.ostrovsky@oracle.com> Cc: Brice Goglin <Brice.Goglin@inria.fr> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Vetter <daniel@ffwll.ch> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Dave Jiang <dave.jiang@intel.com> Cc: David Airlie <airlied@linux.ie> Cc: David Hildenbrand <david@redhat.com> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Hulk Robot <hulkci@huawei.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Jason Gunthorpe <jgg@mellanox.com> Cc: Jason Yan <yanaijie@huawei.com> Cc: Jeff Moyer <jmoyer@redhat.com> Cc: "Jérôme Glisse" <jglisse@redhat.com> Cc: Jia He <justin.he@arm.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Juergen Gross <jgross@suse.com> Cc: kernel test robot <lkp@intel.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: Paul Mackerras <paulus@ozlabs.org> Cc: Pavel Tatashin <pasha.tatashin@soleen.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Rafael J. Wysocki" <rafael.j.wysocki@intel.com> Cc: Randy Dunlap <rdunlap@infradead.org> Cc: Stefano Stabellini <sstabellini@kernel.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Tom Lendacky <thomas.lendacky@amd.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Cc: Vivek Goyal <vgoyal@redhat.com> Cc: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Will Deacon <will@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/dax/bus.c | 64 ++++++++++++++++++++++++++++++++++++++++++++ 1 file changed, 64 insertions(+) --- a/drivers/dax/bus.c~device-dax-add-a-range-mapping-allocation-attribute +++ a/drivers/dax/bus.c @@ -1043,6 +1043,67 @@ static ssize_t size_store(struct device } static DEVICE_ATTR_RW(size); +static ssize_t range_parse(const char *opt, size_t len, struct range *range) +{ + unsigned long long addr = 0; + char *start, *end, *str; + ssize_t rc = EINVAL; + + str = kstrdup(opt, GFP_KERNEL); + if (!str) + return rc; + + end = str; + start = strsep(&end, "-"); + if (!start || !end) + goto err; + + rc = kstrtoull(start, 16, &addr); + if (rc) + goto err; + range->start = addr; + + rc = kstrtoull(end, 16, &addr); + if (rc) + goto err; + range->end = addr; + +err: + kfree(str); + return rc; +} + +static ssize_t mapping_store(struct device *dev, struct device_attribute *attr, + const char *buf, size_t len) +{ + struct dev_dax *dev_dax = to_dev_dax(dev); + struct dax_region *dax_region = dev_dax->region; + size_t to_alloc; + struct range r; + ssize_t rc; + + rc = range_parse(buf, len, &r); + if (rc) + return rc; + + rc = -ENXIO; + device_lock(dax_region->dev); + if (!dax_region->dev->driver) { + device_unlock(dax_region->dev); + return rc; + } + device_lock(dev); + + to_alloc = range_len(&r); + if (alloc_is_aligned(dev_dax, to_alloc)) + rc = alloc_dev_dax_range(dev_dax, r.start, to_alloc); + device_unlock(dev); + device_unlock(dax_region->dev); + + return rc == 0 ? len : rc; +} +static DEVICE_ATTR_WO(mapping); + static ssize_t align_show(struct device *dev, struct device_attribute *attr, char *buf) { @@ -1175,6 +1236,8 @@ static umode_t dev_dax_visible(struct ko return 0; if (a == &dev_attr_numa_node.attr && !IS_ENABLED(CONFIG_NUMA)) return 0; + if (a == &dev_attr_mapping.attr && is_static(dax_region)) + return 0; if ((a == &dev_attr_align.attr || a == &dev_attr_size.attr) && is_static(dax_region)) return 0444; @@ -1184,6 +1247,7 @@ static umode_t dev_dax_visible(struct ko static struct attribute *dev_dax_attributes[] = { &dev_attr_modalias.attr, &dev_attr_size.attr, + &dev_attr_mapping.attr, &dev_attr_target_node.attr, &dev_attr_align.attr, &dev_attr_resource.attr, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 052/181] mm/debug.c: do not dereference i_ino blindly 2020-10-13 23:46 incoming Andrew Morton ` (50 preceding siblings ...) 2020-10-13 23:51 ` [patch 051/181] device-dax: add a range mapping allocation attribute Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 053/181] mm, dump_page: rename head_mapcount() --> head_compound_mapcount() Andrew Morton ` (128 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: akpm, jhubbard, linux-mm, mm-commits, rppt, torvalds, vbabka, willy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm/debug.c: do not dereference i_ino blindly __dump_page() checks i_dentry is fetchable and i_ino is earlier in the struct than i_ino, so it ought to work fine, but it's possible that struct randomisation has reordered i_ino after i_dentry and the pointer is just wild enough that i_dentry is fetchable and i_ino isn't. Also print the inode number if the dentry is invalid. Link: https://lkml.kernel.org/r/20200819185710.28180-1-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Reported-by: Vlastimil Babka <vbabka@suse.cz> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Reviewed-by: Mike Rapoport <rppt@linux.ibm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/debug.c | 12 +++++++----- 1 file changed, 7 insertions(+), 5 deletions(-) --- a/mm/debug.c~mm-debug-do-not-dereference-i_ino-blindly +++ a/mm/debug.c @@ -120,6 +120,7 @@ void __dump_page(struct page *page, cons struct hlist_node *dentry_first; struct dentry *dentry_ptr; struct dentry dentry; + unsigned long ino; /* * mapping can be invalid pointer and we don't want to crash @@ -136,21 +137,22 @@ void __dump_page(struct page *page, cons goto out_mapping; } - if (get_kernel_nofault(dentry_first, &host->i_dentry.first)) { + if (get_kernel_nofault(dentry_first, &host->i_dentry.first) || + get_kernel_nofault(ino, &host->i_ino)) { pr_warn("aops:%ps with invalid host inode %px\n", a_ops, host); goto out_mapping; } if (!dentry_first) { - pr_warn("aops:%ps ino:%lx\n", a_ops, host->i_ino); + pr_warn("aops:%ps ino:%lx\n", a_ops, ino); goto out_mapping; } dentry_ptr = container_of(dentry_first, struct dentry, d_u.d_alias); if (get_kernel_nofault(dentry, dentry_ptr)) { - pr_warn("aops:%ps with invalid dentry %px\n", a_ops, - dentry_ptr); + pr_warn("aops:%ps ino:%lx with invalid dentry %px\n", + a_ops, ino, dentry_ptr); } else { /* * if dentry is corrupted, the %pd handler may still @@ -158,7 +160,7 @@ void __dump_page(struct page *page, cons * corrupted struct page */ pr_warn("aops:%ps ino:%lx dentry name:\"%pd\"\n", - a_ops, host->i_ino, &dentry); + a_ops, ino, &dentry); } } out_mapping: _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 053/181] mm, dump_page: rename head_mapcount() --> head_compound_mapcount() 2020-10-13 23:46 incoming Andrew Morton ` (51 preceding siblings ...) 2020-10-13 23:51 ` [patch 052/181] mm/debug.c: do not dereference i_ino blindly Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 054/181] mm: factor find_get_incore_page out of mincore_page Andrew Morton ` (127 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: akpm, cai, jhubbard, kirill.shutemov, linux-mm, mm-commits, rppt, torvalds, vbabka, william.kucharski, willy From: John Hubbard <jhubbard@nvidia.com> Subject: mm, dump_page: rename head_mapcount() --> head_compound_mapcount() Rename head_pincount() --> head_compound_pincount(). These names are more accurate (or less misleading) than the original ones. Link: https://lkml.kernel.org/r/20200807183358.105097-1-jhubbard@nvidia.com Signed-off-by: John Hubbard <jhubbard@nvidia.com> Cc: Qian Cai <cai@lca.pw> Cc: Matthew Wilcox <willy@infradead.org> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: Mike Rapoport <rppt@linux.ibm.com> Cc: William Kucharski <william.kucharski@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/mm.h | 8 ++++---- mm/debug.c | 6 +++--- 2 files changed, 7 insertions(+), 7 deletions(-) --- a/include/linux/mm.h~mm-dump_page-rename-head_mapcount-head_compound_mapcount +++ a/include/linux/mm.h @@ -791,7 +791,7 @@ static inline void *kvcalloc(size_t n, s extern void kvfree(const void *addr); extern void kvfree_sensitive(const void *addr, size_t len); -static inline int head_mapcount(struct page *head) +static inline int head_compound_mapcount(struct page *head) { return atomic_read(compound_mapcount_ptr(head)) + 1; } @@ -805,7 +805,7 @@ static inline int compound_mapcount(stru { VM_BUG_ON_PAGE(!PageCompound(page), page); page = compound_head(page); - return head_mapcount(page); + return head_compound_mapcount(page); } /* @@ -918,7 +918,7 @@ static inline bool hpage_pincount_availa return PageCompound(page) && compound_order(page) > 1; } -static inline int head_pincount(struct page *head) +static inline int head_compound_pincount(struct page *head) { return atomic_read(compound_pincount_ptr(head)); } @@ -927,7 +927,7 @@ static inline int compound_pincount(stru { VM_BUG_ON_PAGE(!hpage_pincount_available(page), page); page = compound_head(page); - return head_pincount(page); + return head_compound_pincount(page); } static inline void set_compound_order(struct page *page, unsigned int order) --- a/mm/debug.c~mm-dump_page-rename-head_mapcount-head_compound_mapcount +++ a/mm/debug.c @@ -102,12 +102,12 @@ void __dump_page(struct page *page, cons if (hpage_pincount_available(page)) { pr_warn("head:%p order:%u compound_mapcount:%d compound_pincount:%d\n", head, compound_order(head), - head_mapcount(head), - head_pincount(head)); + head_compound_mapcount(head), + head_compound_pincount(head)); } else { pr_warn("head:%p order:%u compound_mapcount:%d\n", head, compound_order(head), - head_mapcount(head)); + head_compound_mapcount(head)); } } if (PageKsm(page)) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 054/181] mm: factor find_get_incore_page out of mincore_page 2020-10-13 23:46 incoming Andrew Morton ` (52 preceding siblings ...) 2020-10-13 23:51 ` [patch 053/181] mm, dump_page: rename head_mapcount() --> head_compound_mapcount() Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 055/181] mm: use find_get_incore_page in memcontrol Andrew Morton ` (126 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: adobriyan, akpm, chris, hannes, hughd, jani.nikula, linux-mm, matthew.auld, mm-commits, torvalds, william.kucharski, willy, ying.huang From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: factor find_get_incore_page out of mincore_page Patch series "Return head pages from find_*_entry", v2. This patch series started out as part of the THP patch set, but it has some nice effects along the way and it seems worth splitting it out and submitting separately. Currently find_get_entry() and find_lock_entry() return the page corresponding to the requested index, but the first thing most callers do is find the head page, which we just threw away. As part of auditing all the callers, I found some misuses of the APIs and some plain inefficiencies that I've fixed. The diffstat is unflattering, but I added more kernel-doc and a new wrapper. This patch (of 8); Provide this functionality from the swap cache. It's useful for more than just mincore(). Link: https://lkml.kernel.org/r/20200910183318.20139-1-willy@infradead.org Link: https://lkml.kernel.org/r/20200910183318.20139-2-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Hugh Dickins <hughd@google.com> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Jani Nikula <jani.nikula@linux.intel.com> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Chris Wilson <chris@chris-wilson.co.uk> Cc: Matthew Auld <matthew.auld@intel.com> Cc: Huang Ying <ying.huang@intel.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/swap.h | 7 +++++++ mm/mincore.c | 28 ++-------------------------- mm/swap_state.c | 32 ++++++++++++++++++++++++++++++++ 3 files changed, 41 insertions(+), 26 deletions(-) --- a/include/linux/swap.h~mm-factor-find_get_incore_page-out-of-mincore_page +++ a/include/linux/swap.h @@ -427,6 +427,7 @@ extern void free_pages_and_swap_cache(st extern struct page *lookup_swap_cache(swp_entry_t entry, struct vm_area_struct *vma, unsigned long addr); +struct page *find_get_incore_page(struct address_space *mapping, pgoff_t index); extern struct page *read_swap_cache_async(swp_entry_t, gfp_t, struct vm_area_struct *vma, unsigned long addr, bool do_poll); @@ -570,6 +571,12 @@ static inline struct page *lookup_swap_c return NULL; } +static inline +struct page *find_get_incore_page(struct address_space *mapping, pgoff_t index) +{ + return find_get_page(mapping, index); +} + static inline int add_to_swap(struct page *page) { return 0; --- a/mm/mincore.c~mm-factor-find_get_incore_page-out-of-mincore_page +++ a/mm/mincore.c @@ -48,7 +48,7 @@ static int mincore_hugetlb(pte_t *pte, u * and is up to date; i.e. that no page-in operation would be required * at this time if an application were to map and access this page. */ -static unsigned char mincore_page(struct address_space *mapping, pgoff_t pgoff) +static unsigned char mincore_page(struct address_space *mapping, pgoff_t index) { unsigned char present = 0; struct page *page; @@ -59,31 +59,7 @@ static unsigned char mincore_page(struct * any other file mapping (ie. marked !present and faulted in with * tmpfs's .fault). So swapped out tmpfs mappings are tested here. */ -#ifdef CONFIG_SWAP - if (shmem_mapping(mapping)) { - page = find_get_entry(mapping, pgoff); - /* - * shmem/tmpfs may return swap: account for swapcache - * page too. - */ - if (xa_is_value(page)) { - swp_entry_t swp = radix_to_swp_entry(page); - struct swap_info_struct *si; - - /* Prevent swap device to being swapoff under us */ - si = get_swap_device(swp); - if (si) { - page = find_get_page(swap_address_space(swp), - swp_offset(swp)); - put_swap_device(si); - } else - page = NULL; - } - } else - page = find_get_page(mapping, pgoff); -#else - page = find_get_page(mapping, pgoff); -#endif + page = find_get_incore_page(mapping, index); if (page) { present = PageUptodate(page); put_page(page); --- a/mm/swap_state.c~mm-factor-find_get_incore_page-out-of-mincore_page +++ a/mm/swap_state.c @@ -21,6 +21,7 @@ #include <linux/vmalloc.h> #include <linux/swap_slots.h> #include <linux/huge_mm.h> +#include <linux/shmem_fs.h> #include "internal.h" /* @@ -414,6 +415,37 @@ struct page *lookup_swap_cache(swp_entry return page; } +/** + * find_get_incore_page - Find and get a page from the page or swap caches. + * @mapping: The address_space to search. + * @index: The page cache index. + * + * This differs from find_get_page() in that it will also look for the + * page in the swap cache. + * + * Return: The found page or %NULL. + */ +struct page *find_get_incore_page(struct address_space *mapping, pgoff_t index) +{ + swp_entry_t swp; + struct swap_info_struct *si; + struct page *page = find_get_entry(mapping, index); + + if (!xa_is_value(page)) + return page; + if (!shmem_mapping(mapping)) + return NULL; + + swp = radix_to_swp_entry(page); + /* Prevent swapoff from happening to us */ + si = get_swap_device(swp); + if (!si) + return NULL; + page = find_get_page(swap_address_space(swp), swp_offset(swp)); + put_swap_device(si); + return page; +} + struct page *__read_swap_cache_async(swp_entry_t entry, gfp_t gfp_mask, struct vm_area_struct *vma, unsigned long addr, bool *new_page_allocated) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 055/181] mm: use find_get_incore_page in memcontrol 2020-10-13 23:46 incoming Andrew Morton ` (53 preceding siblings ...) 2020-10-13 23:51 ` [patch 054/181] mm: factor find_get_incore_page out of mincore_page Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 056/181] mm: optimise madvise WILLNEED Andrew Morton ` (125 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: adobriyan, akpm, chris, hannes, hughd, jani.nikula, linux-mm, matthew.auld, mm-commits, torvalds, william.kucharski, willy, ying.huang From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: use find_get_incore_page in memcontrol The current code does not protect against swapoff of the underlying swap device, so this is a bug fix as well as a worthwhile reduction in code complexity. Link: https://lkml.kernel.org/r/20200910183318.20139-3-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Chris Wilson <chris@chris-wilson.co.uk> Cc: Huang Ying <ying.huang@intel.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jani Nikula <jani.nikula@linux.intel.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Matthew Auld <matthew.auld@intel.com> Cc: William Kucharski <william.kucharski@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 24 ++---------------------- 1 file changed, 2 insertions(+), 22 deletions(-) --- a/mm/memcontrol.c~mm-use-find_get_incore_page-in-memcontrol +++ a/mm/memcontrol.c @@ -5539,35 +5539,15 @@ static struct page *mc_handle_swap_pte(s static struct page *mc_handle_file_pte(struct vm_area_struct *vma, unsigned long addr, pte_t ptent, swp_entry_t *entry) { - struct page *page = NULL; - struct address_space *mapping; - pgoff_t pgoff; - if (!vma->vm_file) /* anonymous vma */ return NULL; if (!(mc.flags & MOVE_FILE)) return NULL; - mapping = vma->vm_file->f_mapping; - pgoff = linear_page_index(vma, addr); - /* page is moved even if it's not RSS of this task(page-faulted). */ -#ifdef CONFIG_SWAP /* shmem/tmpfs may report page out on swap: account for that too. */ - if (shmem_mapping(mapping)) { - page = find_get_entry(mapping, pgoff); - if (xa_is_value(page)) { - swp_entry_t swp = radix_to_swp_entry(page); - *entry = swp; - page = find_get_page(swap_address_space(swp), - swp_offset(swp)); - } - } else - page = find_get_page(mapping, pgoff); -#else - page = find_get_page(mapping, pgoff); -#endif - return page; + return find_get_incore_page(vma->vm_file->f_mapping, + linear_page_index(vma, addr)); } /** _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 056/181] mm: optimise madvise WILLNEED 2020-10-13 23:46 incoming Andrew Morton ` (54 preceding siblings ...) 2020-10-13 23:51 ` [patch 055/181] mm: use find_get_incore_page in memcontrol Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 057/181] proc: optimise smaps for shmem entries Andrew Morton ` (124 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: adobriyan, akpm, cai, chris, hannes, hughd, jani.nikula, linux-mm, matthew.auld, mm-commits, torvalds, william.kucharski, willy, ying.huang From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: optimise madvise WILLNEED Instead of calling find_get_entry() for every page index, use an XArray iterator to skip over NULL entries, and avoid calling get_page(), because we only want the swap entries. [willy@infradead.org: fix LTP soft lockups] Link: https://lkml.kernel.org/r/20200914165032.GS6583@casper.infradead.org Link: https://lkml.kernel.org/r/20200910183318.20139-4-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Chris Wilson <chris@chris-wilson.co.uk> Cc: Huang Ying <ying.huang@intel.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jani Nikula <jani.nikula@linux.intel.com> Cc: Matthew Auld <matthew.auld@intel.com> Cc: William Kucharski <william.kucharski@oracle.com> Cc: Qian Cai <cai@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/madvise.c | 21 ++++++++++++--------- 1 file changed, 12 insertions(+), 9 deletions(-) --- a/mm/madvise.c~mm-optimise-madvise-willneed +++ a/mm/madvise.c @@ -224,25 +224,28 @@ static void force_shm_swapin_readahead(s unsigned long start, unsigned long end, struct address_space *mapping) { - pgoff_t index; + XA_STATE(xas, &mapping->i_pages, linear_page_index(vma, start)); + pgoff_t end_index = end / PAGE_SIZE; struct page *page; - swp_entry_t swap; - for (; start < end; start += PAGE_SIZE) { - index = ((start - vma->vm_start) >> PAGE_SHIFT) + vma->vm_pgoff; + rcu_read_lock(); + xas_for_each(&xas, page, end_index) { + swp_entry_t swap; - page = find_get_entry(mapping, index); - if (!xa_is_value(page)) { - if (page) - put_page(page); + if (!xa_is_value(page)) continue; - } + xas_pause(&xas); + rcu_read_unlock(); + swap = radix_to_swp_entry(page); page = read_swap_cache_async(swap, GFP_HIGHUSER_MOVABLE, NULL, 0, false); if (page) put_page(page); + + rcu_read_lock(); } + rcu_read_unlock(); lru_add_drain(); /* Push any new pages onto the LRU now */ } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 057/181] proc: optimise smaps for shmem entries 2020-10-13 23:46 incoming Andrew Morton ` (55 preceding siblings ...) 2020-10-13 23:51 ` [patch 056/181] mm: optimise madvise WILLNEED Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 058/181] i915: use find_lock_page instead of find_lock_entry Andrew Morton ` (123 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: adobriyan, akpm, chris, hannes, hughd, jani.nikula, linux-mm, matthew.auld, mm-commits, torvalds, william.kucharski, willy, ying.huang From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: proc: optimise smaps for shmem entries Avoid bumping the refcount on pages when we're only interested in the swap entries. Link: https://lkml.kernel.org/r/20200910183318.20139-5-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Chris Wilson <chris@chris-wilson.co.uk> Cc: Huang Ying <ying.huang@intel.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jani Nikula <jani.nikula@linux.intel.com> Cc: Matthew Auld <matthew.auld@intel.com> Cc: William Kucharski <william.kucharski@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/proc/task_mmu.c | 8 +------- 1 file changed, 1 insertion(+), 7 deletions(-) --- a/fs/proc/task_mmu.c~proc-optimise-smaps-for-shmem-entries +++ a/fs/proc/task_mmu.c @@ -520,16 +520,10 @@ static void smaps_pte_entry(pte_t *pte, page = device_private_entry_to_page(swpent); } else if (unlikely(IS_ENABLED(CONFIG_SHMEM) && mss->check_shmem_swap && pte_none(*pte))) { - page = find_get_entry(vma->vm_file->f_mapping, + page = xa_load(&vma->vm_file->f_mapping->i_pages, linear_page_index(vma, addr)); - if (!page) - return; - if (xa_is_value(page)) mss->swap += PAGE_SIZE; - else - put_page(page); - return; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 058/181] i915: use find_lock_page instead of find_lock_entry 2020-10-13 23:46 incoming Andrew Morton ` (56 preceding siblings ...) 2020-10-13 23:51 ` [patch 057/181] proc: optimise smaps for shmem entries Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 059/181] mm: convert find_get_entry to return the head page Andrew Morton ` (122 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: adobriyan, akpm, chris, hannes, hughd, jani.nikula, linux-mm, matthew.auld, mm-commits, torvalds, william.kucharski, willy, ying.huang From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: i915: use find_lock_page instead of find_lock_entry i915 does not want to see value entries. Switch it to use find_lock_page() instead, and remove the export of find_lock_entry(). Move find_lock_entry() and find_get_entry() to mm/internal.h to discourage any future use. Link: https://lkml.kernel.org/r/20200910183318.20139-6-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Chris Wilson <chris@chris-wilson.co.uk> Cc: Huang Ying <ying.huang@intel.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jani Nikula <jani.nikula@linux.intel.com> Cc: Matthew Auld <matthew.auld@intel.com> Cc: William Kucharski <william.kucharski@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/gpu/drm/i915/gem/i915_gem_shmem.c | 4 ++-- include/linux/pagemap.h | 2 -- mm/filemap.c | 1 - mm/internal.h | 3 +++ 4 files changed, 5 insertions(+), 5 deletions(-) --- a/drivers/gpu/drm/i915/gem/i915_gem_shmem.c~i915-use-find_lock_page-instead-of-find_lock_entry +++ a/drivers/gpu/drm/i915/gem/i915_gem_shmem.c @@ -258,8 +258,8 @@ shmem_writeback(struct drm_i915_gem_obje for (i = 0; i < obj->base.size >> PAGE_SHIFT; i++) { struct page *page; - page = find_lock_entry(mapping, i); - if (!page || xa_is_value(page)) + page = find_lock_page(mapping, i); + if (!page) continue; if (!page_mapped(page) && clear_page_dirty_for_io(page)) { --- a/include/linux/pagemap.h~i915-use-find_lock_page-instead-of-find_lock_entry +++ a/include/linux/pagemap.h @@ -385,8 +385,6 @@ static inline struct page *find_subpage( return head + (index & (thp_nr_pages(head) - 1)); } -struct page *find_get_entry(struct address_space *mapping, pgoff_t offset); -struct page *find_lock_entry(struct address_space *mapping, pgoff_t offset); unsigned find_get_entries(struct address_space *mapping, pgoff_t start, unsigned int nr_entries, struct page **entries, pgoff_t *indices); --- a/mm/filemap.c~i915-use-find_lock_page-instead-of-find_lock_entry +++ a/mm/filemap.c @@ -1726,7 +1726,6 @@ repeat: } return page; } -EXPORT_SYMBOL(find_lock_entry); /** * pagecache_get_page - Find and get a reference to a page. --- a/mm/internal.h~i915-use-find_lock_page-instead-of-find_lock_entry +++ a/mm/internal.h @@ -65,6 +65,9 @@ static inline void ra_submit(struct file ra->start, ra->size, ra->async_size); } +struct page *find_get_entry(struct address_space *mapping, pgoff_t index); +struct page *find_lock_entry(struct address_space *mapping, pgoff_t index); + /** * page_evictable - test whether a page is evictable * @page: the page to test _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 059/181] mm: convert find_get_entry to return the head page 2020-10-13 23:46 incoming Andrew Morton ` (57 preceding siblings ...) 2020-10-13 23:51 ` [patch 058/181] i915: use find_lock_page instead of find_lock_entry Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 060/181] mm/shmem: return head page from find_lock_entry Andrew Morton ` (121 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: adobriyan, akpm, chris, hannes, hughd, jani.nikula, linux-mm, matthew.auld, mm-commits, torvalds, william.kucharski, willy, ying.huang From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: convert find_get_entry to return the head page There are only four callers remaining of find_get_entry(). get_shadow_from_swap_cache() only wants to see shadow entries and doesn't care about which page is returned. Push the find_subpage() call into find_lock_entry(), find_get_incore_page() and pagecache_get_page(). [willy@infradead.org: fix oops] Link: https://lkml.kernel.org/r/20200914112738.GM6583@casper.infradead.org Link: https://lkml.kernel.org/r/20200910183318.20139-7-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Chris Wilson <chris@chris-wilson.co.uk> Cc: Huang Ying <ying.huang@intel.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jani Nikula <jani.nikula@linux.intel.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Matthew Auld <matthew.auld@intel.com> Cc: William Kucharski <william.kucharski@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/filemap.c | 13 +++++++------ mm/swap_state.c | 4 +++- 2 files changed, 10 insertions(+), 7 deletions(-) --- a/mm/filemap.c~mm-convert-find_get_entry-to-return-the-head-page +++ a/mm/filemap.c @@ -1645,19 +1645,19 @@ EXPORT_SYMBOL(page_cache_prev_miss); /** * find_get_entry - find and get a page cache entry * @mapping: the address_space to search - * @offset: the page cache index + * @index: The page cache index. * * Looks up the page cache slot at @mapping & @offset. If there is a - * page cache page, it is returned with an increased refcount. + * page cache page, the head page is returned with an increased refcount. * * If the slot holds a shadow entry of a previously evicted page, or a * swap entry from shmem/tmpfs, it is returned. * - * Return: the found page or shadow entry, %NULL if nothing is found. + * Return: The head page or shadow entry, %NULL if nothing is found. */ -struct page *find_get_entry(struct address_space *mapping, pgoff_t offset) +struct page *find_get_entry(struct address_space *mapping, pgoff_t index) { - XA_STATE(xas, &mapping->i_pages, offset); + XA_STATE(xas, &mapping->i_pages, index); struct page *page; rcu_read_lock(); @@ -1685,7 +1685,6 @@ repeat: put_page(page); goto repeat; } - page = find_subpage(page, offset); out: rcu_read_unlock(); @@ -1722,6 +1721,7 @@ repeat: put_page(page); goto repeat; } + page = find_subpage(page, offset); VM_BUG_ON_PAGE(page_to_pgoff(page) != offset, page); } return page; @@ -1768,6 +1768,7 @@ repeat: page = NULL; if (!page) goto no_page; + page = find_subpage(page, index); if (fgp_flags & FGP_LOCK) { if (fgp_flags & FGP_NOWAIT) { --- a/mm/swap_state.c~mm-convert-find_get_entry-to-return-the-head-page +++ a/mm/swap_state.c @@ -431,8 +431,10 @@ struct page *find_get_incore_page(struct struct swap_info_struct *si; struct page *page = find_get_entry(mapping, index); - if (!xa_is_value(page)) + if (!page) return page; + if (!xa_is_value(page)) + return find_subpage(page, index); if (!shmem_mapping(mapping)) return NULL; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 060/181] mm/shmem: return head page from find_lock_entry 2020-10-13 23:46 incoming Andrew Morton ` (58 preceding siblings ...) 2020-10-13 23:51 ` [patch 059/181] mm: convert find_get_entry to return the head page Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 061/181] mm: add find_lock_head Andrew Morton ` (120 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: adobriyan, akpm, chris, hannes, hughd, jani.nikula, linux-mm, matthew.auld, mm-commits, torvalds, william.kucharski, willy, ying.huang From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm/shmem: return head page from find_lock_entry Convert shmem_getpage_gfp() (the only remaining caller of find_lock_entry()) to cope with a head page being returned instead of the subpage for the index. [willy@infradead.org: fix BUG()s] Link https://lore.kernel.org/linux-mm/20200912032042.GA6583@casper.infradead.org/ Link: https://lkml.kernel.org/r/20200910183318.20139-8-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Chris Wilson <chris@chris-wilson.co.uk> Cc: Huang Ying <ying.huang@intel.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jani Nikula <jani.nikula@linux.intel.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Matthew Auld <matthew.auld@intel.com> Cc: William Kucharski <william.kucharski@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/pagemap.h | 9 +++++++++ mm/filemap.c | 25 +++++++++++-------------- mm/shmem.c | 19 ++++++++++--------- 3 files changed, 30 insertions(+), 23 deletions(-) --- a/include/linux/pagemap.h~mm-shmem-return-head-page-from-find_lock_entry +++ a/include/linux/pagemap.h @@ -372,6 +372,15 @@ static inline struct page *grab_cache_pa mapping_gfp_mask(mapping)); } +/* Does this page contain this index? */ +static inline bool thp_contains(struct page *head, pgoff_t index) +{ + /* HugeTLBfs indexes the page cache in units of hpage_size */ + if (PageHuge(head)) + return head->index == index; + return page_index(head) == (index & ~(thp_nr_pages(head) - 1UL)); +} + /* * Given the page we found in the page cache, return the page corresponding * to this index in the file --- a/mm/filemap.c~mm-shmem-return-head-page-from-find_lock_entry +++ a/mm/filemap.c @@ -1692,37 +1692,34 @@ out: } /** - * find_lock_entry - locate, pin and lock a page cache entry - * @mapping: the address_space to search - * @offset: the page cache index + * find_lock_entry - Locate and lock a page cache entry. + * @mapping: The address_space to search. + * @index: The page cache index. * - * Looks up the page cache slot at @mapping & @offset. If there is a - * page cache page, it is returned locked and with an increased - * refcount. + * Looks up the page at @mapping & @index. If there is a page in the + * cache, the head page is returned locked and with an increased refcount. * * If the slot holds a shadow entry of a previously evicted page, or a * swap entry from shmem/tmpfs, it is returned. * - * find_lock_entry() may sleep. - * - * Return: the found page or shadow entry, %NULL if nothing is found. + * Context: May sleep. + * Return: The head page or shadow entry, %NULL if nothing is found. */ -struct page *find_lock_entry(struct address_space *mapping, pgoff_t offset) +struct page *find_lock_entry(struct address_space *mapping, pgoff_t index) { struct page *page; repeat: - page = find_get_entry(mapping, offset); + page = find_get_entry(mapping, index); if (page && !xa_is_value(page)) { lock_page(page); /* Has the page been truncated? */ - if (unlikely(page_mapping(page) != mapping)) { + if (unlikely(page->mapping != mapping)) { unlock_page(page); put_page(page); goto repeat; } - page = find_subpage(page, offset); - VM_BUG_ON_PAGE(page_to_pgoff(page) != offset, page); + VM_BUG_ON_PAGE(!thp_contains(page, index), page); } return page; } --- a/mm/shmem.c~mm-shmem-return-head-page-from-find_lock_entry +++ a/mm/shmem.c @@ -1830,6 +1830,8 @@ repeat: return error; } + if (page) + hindex = page->index; if (page && sgp == SGP_WRITE) mark_page_accessed(page); @@ -1840,11 +1842,10 @@ repeat: unlock_page(page); put_page(page); page = NULL; + hindex = index; } - if (page || sgp == SGP_READ) { - *pagep = page; - return 0; - } + if (page || sgp == SGP_READ) + goto out; /* * Fast cache lookup did not find it: @@ -1969,14 +1970,13 @@ clear: * it now, lest undo on failure cancel our earlier guarantee. */ if (sgp != SGP_WRITE && !PageUptodate(page)) { - struct page *head = compound_head(page); int i; - for (i = 0; i < compound_nr(head); i++) { - clear_highpage(head + i); - flush_dcache_page(head + i); + for (i = 0; i < compound_nr(page); i++) { + clear_highpage(page + i); + flush_dcache_page(page + i); } - SetPageUptodate(head); + SetPageUptodate(page); } /* Perhaps the file has been truncated since we checked */ @@ -1992,6 +1992,7 @@ clear: error = -EINVAL; goto unlock; } +out: *pagep = page + index - hindex; return 0; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 061/181] mm: add find_lock_head 2020-10-13 23:46 incoming Andrew Morton ` (59 preceding siblings ...) 2020-10-13 23:51 ` [patch 060/181] mm/shmem: return head page from find_lock_entry Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 062/181] mm/filemap: fix filemap_map_pages for THP Andrew Morton ` (119 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: adobriyan, akpm, chris, hannes, hughd, jani.nikula, linux-mm, matthew.auld, mm-commits, torvalds, william.kucharski, willy, ying.huang From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: add find_lock_head Add a new FGP_HEAD flag which avoids calling find_subpage() and add a convenience wrapper for it. Link: https://lkml.kernel.org/r/20200910183318.20139-9-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Chris Wilson <chris@chris-wilson.co.uk> Cc: Huang Ying <ying.huang@intel.com> Cc: Hugh Dickins <hughd@google.com> Cc: Jani Nikula <jani.nikula@linux.intel.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Matthew Auld <matthew.auld@intel.com> Cc: William Kucharski <william.kucharski@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/pagemap.h | 32 ++++++++++++++++++++++++++------ mm/filemap.c | 9 ++++++--- 2 files changed, 32 insertions(+), 9 deletions(-) --- a/include/linux/pagemap.h~mm-add-find_lock_head +++ a/include/linux/pagemap.h @@ -279,6 +279,7 @@ pgoff_t page_cache_prev_miss(struct addr #define FGP_NOFS 0x00000010 #define FGP_NOWAIT 0x00000020 #define FGP_FOR_MMAP 0x00000040 +#define FGP_HEAD 0x00000080 struct page *pagecache_get_page(struct address_space *mapping, pgoff_t offset, int fgp_flags, gfp_t cache_gfp_mask); @@ -310,18 +311,37 @@ static inline struct page *find_get_page * @mapping: the address_space to search * @offset: the page index * - * Looks up the page cache slot at @mapping & @offset. If there is a + * Looks up the page cache entry at @mapping & @offset. If there is a * page cache page, it is returned locked and with an increased * refcount. * - * Otherwise, %NULL is returned. - * - * find_lock_page() may sleep. + * Context: May sleep. + * Return: A struct page or %NULL if there is no page in the cache for this + * index. */ static inline struct page *find_lock_page(struct address_space *mapping, - pgoff_t offset) + pgoff_t index) +{ + return pagecache_get_page(mapping, index, FGP_LOCK, 0); +} + +/** + * find_lock_head - Locate, pin and lock a pagecache page. + * @mapping: The address_space to search. + * @offset: The page index. + * + * Looks up the page cache entry at @mapping & @offset. If there is a + * page cache page, its head page is returned locked and with an increased + * refcount. + * + * Context: May sleep. + * Return: A struct page which is !PageTail, or %NULL if there is no page + * in the cache for this index. + */ +static inline struct page *find_lock_head(struct address_space *mapping, + pgoff_t index) { - return pagecache_get_page(mapping, offset, FGP_LOCK, 0); + return pagecache_get_page(mapping, index, FGP_LOCK | FGP_HEAD, 0); } /** --- a/mm/filemap.c~mm-add-find_lock_head +++ a/mm/filemap.c @@ -1737,6 +1737,8 @@ repeat: * * * %FGP_ACCESSED - The page will be marked accessed. * * %FGP_LOCK - The page is returned locked. + * * %FGP_HEAD - If the page is present and a THP, return the head page + * rather than the exact page specified by the index. * * %FGP_CREAT - If no page is present then a new page is allocated using * @gfp_mask and added to the page cache and the VM's LRU list. * The page is returned locked and with an increased refcount. @@ -1765,7 +1767,6 @@ repeat: page = NULL; if (!page) goto no_page; - page = find_subpage(page, index); if (fgp_flags & FGP_LOCK) { if (fgp_flags & FGP_NOWAIT) { @@ -1778,12 +1779,12 @@ repeat: } /* Has the page been truncated? */ - if (unlikely(compound_head(page)->mapping != mapping)) { + if (unlikely(page->mapping != mapping)) { unlock_page(page); put_page(page); goto repeat; } - VM_BUG_ON_PAGE(page->index != index, page); + VM_BUG_ON_PAGE(!thp_contains(page, index), page); } if (fgp_flags & FGP_ACCESSED) @@ -1793,6 +1794,8 @@ repeat: if (page_is_idle(page)) clear_page_idle(page); } + if (!(fgp_flags & FGP_HEAD)) + page = find_subpage(page, index); no_page: if (!page && (fgp_flags & FGP_CREAT)) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 062/181] mm/filemap: fix filemap_map_pages for THP 2020-10-13 23:46 incoming Andrew Morton ` (60 preceding siblings ...) 2020-10-13 23:51 ` [patch 061/181] mm: add find_lock_head Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 063/181] mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED Andrew Morton ` (118 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: akpm, kirill.shutemov, linux-mm, mm-commits, torvalds, william.kucharski, willy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm/filemap: fix filemap_map_pages for THP We dereference page->mapping and page->index directly after calling find_subpage() and these fields are not valid for tail pages. While commit 4101196b19d7 ("mm: page cache: store only head pages in i_pages") introduced the call to find_subpage(), the problem existed prior to this; I'm going to suggest all the way back to when THPs first existed. The user-visible effects of this are almost negligible. To hit it, you have to mmap a tmpfs file at an unaligned address and then it's only a disabled optimisation causing page faults to happen more frequently than they otherwise would. Fix this by keeping both head and page pointers and checking the appropriate one. We could use page_mapping() and page_to_index(), but that's higher overhead. Link: https://lkml.kernel.org/r/20200911012532.24761-1-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Cc: William Kucharski <william.kucharski@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/filemap.c | 30 +++++++++++++++--------------- 1 file changed, 15 insertions(+), 15 deletions(-) --- a/mm/filemap.c~mm-filemap-fix-filemap_map_pages-for-thp +++ a/mm/filemap.c @@ -2793,42 +2793,42 @@ void filemap_map_pages(struct vm_fault * pgoff_t last_pgoff = start_pgoff; unsigned long max_idx; XA_STATE(xas, &mapping->i_pages, start_pgoff); - struct page *page; + struct page *head, *page; unsigned int mmap_miss = READ_ONCE(file->f_ra.mmap_miss); rcu_read_lock(); - xas_for_each(&xas, page, end_pgoff) { - if (xas_retry(&xas, page)) + xas_for_each(&xas, head, end_pgoff) { + if (xas_retry(&xas, head)) continue; - if (xa_is_value(page)) + if (xa_is_value(head)) goto next; /* * Check for a locked page first, as a speculative * reference may adversely influence page migration. */ - if (PageLocked(page)) + if (PageLocked(head)) goto next; - if (!page_cache_get_speculative(page)) + if (!page_cache_get_speculative(head)) goto next; /* Has the page moved or been split? */ - if (unlikely(page != xas_reload(&xas))) + if (unlikely(head != xas_reload(&xas))) goto skip; - page = find_subpage(page, xas.xa_index); + page = find_subpage(head, xas.xa_index); - if (!PageUptodate(page) || + if (!PageUptodate(head) || PageReadahead(page) || PageHWPoison(page)) goto skip; - if (!trylock_page(page)) + if (!trylock_page(head)) goto skip; - if (page->mapping != mapping || !PageUptodate(page)) + if (head->mapping != mapping || !PageUptodate(head)) goto unlock; max_idx = DIV_ROUND_UP(i_size_read(mapping->host), PAGE_SIZE); - if (page->index >= max_idx) + if (xas.xa_index >= max_idx) goto unlock; if (mmap_miss > 0) @@ -2840,12 +2840,12 @@ void filemap_map_pages(struct vm_fault * last_pgoff = xas.xa_index; if (alloc_set_pte(vmf, page)) goto unlock; - unlock_page(page); + unlock_page(head); goto next; unlock: - unlock_page(page); + unlock_page(head); skip: - put_page(page); + put_page(head); next: /* Huge page is mapped? No need to proceed. */ if (pmd_trans_huge(*vmf->pmd)) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 063/181] mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED 2020-10-13 23:46 incoming Andrew Morton ` (61 preceding siblings ...) 2020-10-13 23:51 ` [patch 062/181] mm/filemap: fix filemap_map_pages for THP Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 064/181] mm/gup_benchmark: update the documentation in Kconfig Andrew Morton ` (117 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: akpm, hannes, laoar.shao, linux-mm, mgorman, mm-commits, torvalds From: Yafang Shao <laoar.shao@gmail.com> Subject: mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED Our users reported that there're some random latency spikes when their RT process is running. Finally we found that latency spike is caused by FADV_DONTNEED. Which may call lru_add_drain_all() to drain LRU cache on remote CPUs, and then waits the per-cpu work to complete. The wait time is uncertain, which may be tens millisecond. That behavior is unreasonable, because this process is bound to a specific CPU and the file is only accessed by itself, IOW, there should be no pagecache pages on a per-cpu pagevec of a remote CPU. That unreasonable behavior is partially caused by the wrong comparation of the number of invalidated pages and the number of the target. For example, if (count < (end_index - start_index + 1)) The count above is how many pages were invalidated in the local CPU, and (end_index - start_index + 1) is how many pages should be invalidated. The usage of (end_index - start_index + 1) is incorrect, because they are virtual addresses, which may not mapped to pages. Besides that, there may be holes between start and end. So we'd better check whether there are still pages on per-cpu pagevec after drain the local cpu, and then decide whether or not to call lru_add_drain_all(). After I applied it with a hotfix to our production environment, most of the lru_add_drain_all() can be avoided. Link: https://lkml.kernel.org/r/20200923133318.14373-1-laoar.shao@gmail.com Signed-off-by: Yafang Shao <laoar.shao@gmail.com> Suggested-by: Mel Gorman <mgorman@suse.de> Acked-by: Mel Gorman <mgorman@suse.de> Cc: Johannes Weiner <hannes@cmpxchg.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/fs.h | 4 ++ mm/fadvise.c | 9 +++--- mm/truncate.c | 58 +++++++++++++++++++++++++++++-------------- 3 files changed, 49 insertions(+), 22 deletions(-) --- a/include/linux/fs.h~mm-fadvise-improve-the-expensive-remote-lru-cache-draining-after-fadv_dontneed +++ a/include/linux/fs.h @@ -2581,6 +2581,10 @@ extern bool is_bad_inode(struct inode *) unsigned long invalidate_mapping_pages(struct address_space *mapping, pgoff_t start, pgoff_t end); +void invalidate_mapping_pagevec(struct address_space *mapping, + pgoff_t start, pgoff_t end, + unsigned long *nr_pagevec); + static inline void invalidate_remote_inode(struct inode *inode) { if (S_ISREG(inode->i_mode) || S_ISDIR(inode->i_mode) || --- a/mm/fadvise.c~mm-fadvise-improve-the-expensive-remote-lru-cache-draining-after-fadv_dontneed +++ a/mm/fadvise.c @@ -141,7 +141,7 @@ int generic_fadvise(struct file *file, l } if (end_index >= start_index) { - unsigned long count; + unsigned long nr_pagevec = 0; /* * It's common to FADV_DONTNEED right after @@ -154,8 +154,9 @@ int generic_fadvise(struct file *file, l */ lru_add_drain(); - count = invalidate_mapping_pages(mapping, - start_index, end_index); + invalidate_mapping_pagevec(mapping, + start_index, end_index, + &nr_pagevec); /* * If fewer pages were invalidated than expected then @@ -163,7 +164,7 @@ int generic_fadvise(struct file *file, l * a per-cpu pagevec for a remote CPU. Drain all * pagevecs and try again. */ - if (count < (end_index - start_index + 1)) { + if (nr_pagevec) { lru_add_drain_all(); invalidate_mapping_pages(mapping, start_index, end_index); --- a/mm/truncate.c~mm-fadvise-improve-the-expensive-remote-lru-cache-draining-after-fadv_dontneed +++ a/mm/truncate.c @@ -528,23 +528,8 @@ void truncate_inode_pages_final(struct a } EXPORT_SYMBOL(truncate_inode_pages_final); -/** - * invalidate_mapping_pages - Invalidate all the unlocked pages of one inode - * @mapping: the address_space which holds the pages to invalidate - * @start: the offset 'from' which to invalidate - * @end: the offset 'to' which to invalidate (inclusive) - * - * This function only removes the unlocked pages, if you want to - * remove all the pages of one inode, you must call truncate_inode_pages. - * - * invalidate_mapping_pages() will not block on IO activity. It will not - * invalidate pages which are dirty, locked, under writeback or mapped into - * pagetables. - * - * Return: the number of the pages that were invalidated - */ -unsigned long invalidate_mapping_pages(struct address_space *mapping, - pgoff_t start, pgoff_t end) +unsigned long __invalidate_mapping_pages(struct address_space *mapping, + pgoff_t start, pgoff_t end, unsigned long *nr_pagevec) { pgoff_t indices[PAGEVEC_SIZE]; struct pagevec pvec; @@ -610,8 +595,13 @@ unsigned long invalidate_mapping_pages(s * Invalidation is a hint that the page is no longer * of interest and try to speed up its reclaim. */ - if (!ret) + if (!ret) { deactivate_file_page(page); + /* It is likely on the pagevec of a remote CPU */ + if (nr_pagevec) + (*nr_pagevec)++; + } + if (PageTransHuge(page)) put_page(page); count += ret; @@ -623,8 +613,40 @@ unsigned long invalidate_mapping_pages(s } return count; } + +/** + * invalidate_mapping_pages - Invalidate all the unlocked pages of one inode + * @mapping: the address_space which holds the pages to invalidate + * @start: the offset 'from' which to invalidate + * @end: the offset 'to' which to invalidate (inclusive) + * + * This function only removes the unlocked pages, if you want to + * remove all the pages of one inode, you must call truncate_inode_pages. + * + * invalidate_mapping_pages() will not block on IO activity. It will not + * invalidate pages which are dirty, locked, under writeback or mapped into + * pagetables. + * + * Return: the number of the pages that were invalidated + */ +unsigned long invalidate_mapping_pages(struct address_space *mapping, + pgoff_t start, pgoff_t end) +{ + return __invalidate_mapping_pages(mapping, start, end, NULL); +} EXPORT_SYMBOL(invalidate_mapping_pages); +/** + * This helper is similar with the above one, except that it accounts for pages + * that are likely on a pagevec and count them in @nr_pagevec, which will used by + * the caller. + */ +void invalidate_mapping_pagevec(struct address_space *mapping, + pgoff_t start, pgoff_t end, unsigned long *nr_pagevec) +{ + __invalidate_mapping_pages(mapping, start, end, nr_pagevec); +} + /* * This is like invalidate_complete_page(), except it ignores the page's * refcount. We do this because invalidate_inode_pages2() needs stronger _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 064/181] mm/gup_benchmark: update the documentation in Kconfig 2020-10-13 23:46 incoming Andrew Morton ` (62 preceding siblings ...) 2020-10-13 23:51 ` [patch 063/181] mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 065/181] mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag Andrew Morton ` (116 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: akpm, ira.weiny, jhubbard, keith.busch, kirill.shutemov, linux-mm, mm-commits, song.bao.hua, torvalds From: Barry Song <song.bao.hua@hisilicon.com> Subject: mm/gup_benchmark: update the documentation in Kconfig In the beginning, mm/gup_benchmark.c supported get_user_pages_fast() only, but right now, it supports the benchmarking of a couple of get_user_pages() related calls like: * get_user_pages_fast() * get_user_pages() * pin_user_pages_fast() * pin_user_pages() The documentation is confusing and needs update. Link: https://lkml.kernel.org/r/20200821032546.19992-1-song.bao.hua@hisilicon.com Signed-off-by: Barry Song <song.bao.hua@hisilicon.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Keith Busch <keith.busch@intel.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/Kconfig | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/mm/Kconfig~mm-gup_benchmark-update-the-documentation-in-kconfig +++ a/mm/Kconfig @@ -831,10 +831,10 @@ config PERCPU_STATS be used to help understand percpu memory usage. config GUP_BENCHMARK - bool "Enable infrastructure for get_user_pages_fast() benchmarking" + bool "Enable infrastructure for get_user_pages() and related calls benchmarking" help Provides /sys/kernel/debug/gup_benchmark that helps with testing - performance of get_user_pages_fast(). + performance of get_user_pages() and related calls. See tools/testing/selftests/vm/gup_benchmark.c _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 065/181] mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag 2020-10-13 23:46 incoming Andrew Morton ` (63 preceding siblings ...) 2020-10-13 23:51 ` [patch 064/181] mm/gup_benchmark: update the documentation in Kconfig Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:51 ` [patch 066/181] mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM Andrew Morton ` (115 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: akpm, corbet, dan.j.williams, david, hch, jack, jgg, jglisse, jhubbard, linux-mm, mhocko, mike.kravetz, mm-commits, shuah, song.bao.hua, torvalds, vbabka, viro, willy From: Barry Song <song.bao.hua@hisilicon.com> Subject: mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag According to Documentation/core-api/pin_user_pages.rst, FOLL_PIN is a prerequisite to FOLL_LONGTERM. Another way of saying that is, FOLL_LONGTERM is a specific case, more restrictive case of FOLL_PIN. Almost all kernel modules are using pin_user_pages() with FOLL_LONGTERM, mm/gup_benchmark.c seems to the only exception in which FOLL_PIN is not a prerequisite to FOLL_LONGTERM. Link: http://lkml.kernel.org/r/20200815122056.29508-1-song.bao.hua@hisilicon.com Signed-off-by: Barry Song <song.bao.hua@hisilicon.com> Reviewed-by: John Hubbard <jhubbard@nvidia.com> Cc: Jan Kara <jack@suse.cz> Cc: Jérôme Glisse <jglisse@redhat.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Al Viro <viro@zeniv.linux.org.uk> Cc: Christoph Hellwig <hch@infradead.org> Cc: Dan Williams <dan.j.williams@intel.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Jonathan Corbet <corbet@lwn.net> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Shuah Khan <shuah@kernel.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup_benchmark.c | 23 +++++++++---------- tools/testing/selftests/vm/gup_benchmark.c | 14 +++++------ 2 files changed, 19 insertions(+), 18 deletions(-) --- a/mm/gup_benchmark.c~mm-gup_benchmark-use-pin_user_pages-for-foll_longterm-flag +++ a/mm/gup_benchmark.c @@ -6,10 +6,10 @@ #include <linux/debugfs.h> #define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_benchmark) -#define GUP_LONGTERM_BENCHMARK _IOWR('g', 2, struct gup_benchmark) -#define GUP_BENCHMARK _IOWR('g', 3, struct gup_benchmark) -#define PIN_FAST_BENCHMARK _IOWR('g', 4, struct gup_benchmark) -#define PIN_BENCHMARK _IOWR('g', 5, struct gup_benchmark) +#define GUP_BENCHMARK _IOWR('g', 2, struct gup_benchmark) +#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_benchmark) +#define PIN_BENCHMARK _IOWR('g', 4, struct gup_benchmark) +#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_benchmark) struct gup_benchmark { __u64 get_delta_usec; @@ -28,7 +28,6 @@ static void put_back_pages(unsigned int switch (cmd) { case GUP_FAST_BENCHMARK: - case GUP_LONGTERM_BENCHMARK: case GUP_BENCHMARK: for (i = 0; i < nr_pages; i++) put_page(pages[i]); @@ -36,6 +35,7 @@ static void put_back_pages(unsigned int case PIN_FAST_BENCHMARK: case PIN_BENCHMARK: + case PIN_LONGTERM_BENCHMARK: unpin_user_pages(pages, nr_pages); break; } @@ -50,6 +50,7 @@ static void verify_dma_pinned(unsigned i switch (cmd) { case PIN_FAST_BENCHMARK: case PIN_BENCHMARK: + case PIN_LONGTERM_BENCHMARK: for (i = 0; i < nr_pages; i++) { page = pages[i]; if (WARN(!page_maybe_dma_pinned(page), @@ -101,11 +102,6 @@ static int __gup_benchmark_ioctl(unsigne nr = get_user_pages_fast(addr, nr, gup->flags, pages + i); break; - case GUP_LONGTERM_BENCHMARK: - nr = get_user_pages(addr, nr, - gup->flags | FOLL_LONGTERM, - pages + i, NULL); - break; case GUP_BENCHMARK: nr = get_user_pages(addr, nr, gup->flags, pages + i, NULL); @@ -118,6 +114,11 @@ static int __gup_benchmark_ioctl(unsigne nr = pin_user_pages(addr, nr, gup->flags, pages + i, NULL); break; + case PIN_LONGTERM_BENCHMARK: + nr = pin_user_pages(addr, nr, + gup->flags | FOLL_LONGTERM, + pages + i, NULL); + break; default: kvfree(pages); ret = -EINVAL; @@ -162,10 +163,10 @@ static long gup_benchmark_ioctl(struct f switch (cmd) { case GUP_FAST_BENCHMARK: - case GUP_LONGTERM_BENCHMARK: case GUP_BENCHMARK: case PIN_FAST_BENCHMARK: case PIN_BENCHMARK: + case PIN_LONGTERM_BENCHMARK: break; default: return -EINVAL; --- a/tools/testing/selftests/vm/gup_benchmark.c~mm-gup_benchmark-use-pin_user_pages-for-foll_longterm-flag +++ a/tools/testing/selftests/vm/gup_benchmark.c @@ -15,12 +15,12 @@ #define PAGE_SIZE sysconf(_SC_PAGESIZE) #define GUP_FAST_BENCHMARK _IOWR('g', 1, struct gup_benchmark) -#define GUP_LONGTERM_BENCHMARK _IOWR('g', 2, struct gup_benchmark) -#define GUP_BENCHMARK _IOWR('g', 3, struct gup_benchmark) +#define GUP_BENCHMARK _IOWR('g', 2, struct gup_benchmark) /* Similar to above, but use FOLL_PIN instead of FOLL_GET. */ -#define PIN_FAST_BENCHMARK _IOWR('g', 4, struct gup_benchmark) -#define PIN_BENCHMARK _IOWR('g', 5, struct gup_benchmark) +#define PIN_FAST_BENCHMARK _IOWR('g', 3, struct gup_benchmark) +#define PIN_BENCHMARK _IOWR('g', 4, struct gup_benchmark) +#define PIN_LONGTERM_BENCHMARK _IOWR('g', 5, struct gup_benchmark) /* Just the flags we need, copied from mm.h: */ #define FOLL_WRITE 0x01 /* check pte is writable */ @@ -52,6 +52,9 @@ int main(int argc, char **argv) case 'b': cmd = PIN_BENCHMARK; break; + case 'L': + cmd = PIN_LONGTERM_BENCHMARK; + break; case 'm': size = atoi(optarg) * MB; break; @@ -67,9 +70,6 @@ int main(int argc, char **argv) case 'T': thp = 0; break; - case 'L': - cmd = GUP_LONGTERM_BENCHMARK; - break; case 'U': cmd = GUP_BENCHMARK; break; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 066/181] mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM 2020-10-13 23:46 incoming Andrew Morton ` (64 preceding siblings ...) 2020-10-13 23:51 ` [patch 065/181] mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag Andrew Morton @ 2020-10-13 23:51 ` Andrew Morton 2020-10-13 23:52 ` [patch 067/181] mm/gup: protect unpin_user_pages() against npages==-ERRNO Andrew Morton ` (114 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:51 UTC (permalink / raw) To: akpm, corbet, dan.j.williams, david, hch, ira.weiny, jack, jgg, jglisse, jhubbard, linux-mm, mhocko, mike.kravetz, mm-commits, naresh.kamboju, shuah, song.bao.hua, torvalds, vbabka, viro, willy From: Barry Song <song.bao.hua@hisilicon.com> Subject: mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM gup prohibits users from calling get_user_pages() with FOLL_PIN. But it allows users to call get_user_pages() with FOLL_LONGTERM only. It seems insensible. Since FOLL_LONGTERM is a stricter case of FOLL_PIN, we should prohibit users from calling get_user_pages() with FOLL_LONGTERM while not with FOLL_PIN. mm/gup_benchmark.c used to be the only user who did this improperly. But it has been fixed by moving to use pin_user_pages(). [akpm@linux-foundation.org: fix CONFIG_MMU=n build] Link: https://lkml.kernel.org/r/CA+G9fYuNS3k0DVT62twfV746pfNhCSrk5sVMcOcQ1PGGnEseyw@mail.gmail.com Link: http://lkml.kernel.org/r/20200819110100.23504-1-song.bao.hua@hisilicon.com Signed-off-by: Barry Song <song.bao.hua@hisilicon.com> Reviewed-by: Ira Weiny <ira.weiny@intel.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Jan Kara <jack@suse.cz> Cc: Jérôme Glisse <jglisse@redhat.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Al Viro <viro@zeniv.linux.org.uk> Cc: Christoph Hellwig <hch@infradead.org> Cc: Dan Williams <dan.j.williams@intel.com> Cc: Dave Chinner <david@fromorbit.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Jonathan Corbet <corbet@lwn.net> Cc: Michal Hocko <mhocko@suse.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Shuah Khan <shuah@kernel.org> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Naresh Kamboju <naresh.kamboju@linaro.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup.c | 37 ++++++++++++++++++++++--------------- 1 file changed, 22 insertions(+), 15 deletions(-) --- a/mm/gup.c~mm-gup-dont-permit-users-to-call-get_user_pages-with-foll_longterm +++ a/mm/gup.c @@ -1747,6 +1747,25 @@ static __always_inline long __gup_longte } #endif /* CONFIG_FS_DAX || CONFIG_CMA */ +static bool is_valid_gup_flags(unsigned int gup_flags) +{ + /* + * FOLL_PIN must only be set internally by the pin_user_pages*() APIs, + * never directly by the caller, so enforce that with an assertion: + */ + if (WARN_ON_ONCE(gup_flags & FOLL_PIN)) + return false; + /* + * FOLL_PIN is a prerequisite to FOLL_LONGTERM. Another way of saying + * that is, FOLL_LONGTERM is a specific case, more restrictive case of + * FOLL_PIN. + */ + if (WARN_ON_ONCE(gup_flags & FOLL_LONGTERM)) + return false; + + return true; +} + #ifdef CONFIG_MMU static long __get_user_pages_remote(struct mm_struct *mm, unsigned long start, unsigned long nr_pages, @@ -1842,11 +1861,7 @@ long get_user_pages_remote(struct mm_str unsigned int gup_flags, struct page **pages, struct vm_area_struct **vmas, int *locked) { - /* - * FOLL_PIN must only be set internally by the pin_user_pages*() APIs, - * never directly by the caller, so enforce that with an assertion: - */ - if (WARN_ON_ONCE(gup_flags & FOLL_PIN)) + if (!is_valid_gup_flags(gup_flags)) return -EINVAL; return __get_user_pages_remote(mm, start, nr_pages, gup_flags, @@ -1892,11 +1907,7 @@ long get_user_pages(unsigned long start, unsigned int gup_flags, struct page **pages, struct vm_area_struct **vmas) { - /* - * FOLL_PIN must only be set internally by the pin_user_pages*() APIs, - * never directly by the caller, so enforce that with an assertion: - */ - if (WARN_ON_ONCE(gup_flags & FOLL_PIN)) + if (!is_valid_gup_flags(gup_flags)) return -EINVAL; return __gup_longterm_locked(current->mm, start, nr_pages, @@ -2786,11 +2797,7 @@ EXPORT_SYMBOL_GPL(get_user_pages_fast_on int get_user_pages_fast(unsigned long start, int nr_pages, unsigned int gup_flags, struct page **pages) { - /* - * FOLL_PIN must only be set internally by the pin_user_pages*() APIs, - * never directly by the caller, so enforce that: - */ - if (WARN_ON_ONCE(gup_flags & FOLL_PIN)) + if (!is_valid_gup_flags(gup_flags)) return -EINVAL; /* _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 067/181] mm/gup: protect unpin_user_pages() against npages==-ERRNO 2020-10-13 23:46 incoming Andrew Morton ` (65 preceding siblings ...) 2020-10-13 23:51 ` [patch 066/181] mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 068/181] swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity Andrew Morton ` (113 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, dan.carpenter, ira.weiny, jhubbard, jrdr.linux, linux-mm, mm-commits, torvalds From: John Hubbard <jhubbard@nvidia.com> Subject: mm/gup: protect unpin_user_pages() against npages==-ERRNO As suggested by Dan Carpenter, fortify unpin_user_pages() just a bit, against a typical caller mistake: check if the npages arg is really a -ERRNO value, which would blow up the unpinning loop: WARN and return. If this new WARN_ON() fires, then the system *might* be leaking pages (by leaving them pinned), but probably not. More likely, gup/pup returned a hard -ERRNO error to the caller, who erroneously passed it here. Link: https://lkml.kernel.org/r/20200917065706.409079-1-jhubbard@nvidia.com Signed-off-by: John Hubbard <jhubbard@nvidia.com> Signed-off-by: Dan Carpenter <dan.carpenter@oracle.com> Cc: Ira Weiny <ira.weiny@intel.com> Cc: Souptick Joarder <jrdr.linux@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/gup.c | 7 +++++++ 1 file changed, 7 insertions(+) --- a/mm/gup.c~mm-gup-protect-unpin_user_pages-against-npages==-errno +++ a/mm/gup.c @@ -329,6 +329,13 @@ void unpin_user_pages(struct page **page unsigned long index; /* + * If this WARN_ON() fires, then the system *might* be leaking pages (by + * leaving them pinned), but probably not. More likely, gup/pup returned + * a hard -ERRNO error to the caller, who erroneously passed it here. + */ + if (WARN_ON(IS_ERR_VALUE(npages))) + return; + /* * TODO: this can be optimized for huge pages: if a series of pages is * physically contiguous and part of the same compound page, then a * single operation to the head page should suffice. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 068/181] swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity 2020-10-13 23:46 incoming Andrew Morton ` (66 preceding siblings ...) 2020-10-13 23:52 ` [patch 067/181] mm/gup: protect unpin_user_pages() against npages==-ERRNO Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 069/181] mm: remove activate_page() from unuse_pte() Andrew Morton ` (112 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, hsiangkao, linux-mm, mm-commits, torvalds, willy From: Gao Xiang <hsiangkao@redhat.com> Subject: swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity SWP_FS is used to make swap_{read,write}page() go through the filesystem, and it's only used for swap files over NFS for now. Otherwise it will directly submit IO to blockdev according to swapfile extents reported by filesystems in advance. As Matthew pointed out [1], SWP_FS naming is somewhat confusing, so let's rename to SWP_FS_OPS. [1] https://lore.kernel.org/r/20200820113448.GM17456@casper.infradead.org Link: https://lkml.kernel.org/r/20200822113019.11319-1-hsiangkao@redhat.com Signed-off-by: Gao Xiang <hsiangkao@redhat.com> Suggested-by: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/swap.h | 2 +- mm/page_io.c | 6 +++--- mm/swap_state.c | 2 +- mm/swapfile.c | 2 +- 4 files changed, 6 insertions(+), 6 deletions(-) --- a/include/linux/swap.h~swap-rename-swp_fs-to-swap_fs_ops-to-avoid-ambiguity +++ a/include/linux/swap.h @@ -170,7 +170,7 @@ enum { SWP_CONTINUED = (1 << 5), /* swap_map has count continuation */ SWP_BLKDEV = (1 << 6), /* its a block device */ SWP_ACTIVATED = (1 << 7), /* set after swap_activate success */ - SWP_FS = (1 << 8), /* swap file goes through fs */ + SWP_FS_OPS = (1 << 8), /* swapfile operations go through fs */ SWP_AREA_DISCARD = (1 << 9), /* single-time swap area discards */ SWP_PAGE_DISCARD = (1 << 10), /* freed swap page-cluster discards */ SWP_STABLE_WRITES = (1 << 11), /* no overwrite PG_writeback pages */ --- a/mm/page_io.c~swap-rename-swp_fs-to-swap_fs_ops-to-avoid-ambiguity +++ a/mm/page_io.c @@ -312,7 +312,7 @@ int __swap_writepage(struct page *page, struct swap_info_struct *sis = page_swap_info(page); VM_BUG_ON_PAGE(!PageSwapCache(page), page); - if (data_race(sis->flags & SWP_FS)) { + if (data_race(sis->flags & SWP_FS_OPS)) { struct kiocb kiocb; struct file *swap_file = sis->swap_file; struct address_space *mapping = swap_file->f_mapping; @@ -403,7 +403,7 @@ int swap_readpage(struct page *page, boo goto out; } - if (data_race(sis->flags & SWP_FS)) { + if (data_race(sis->flags & SWP_FS_OPS)) { struct file *swap_file = sis->swap_file; struct address_space *mapping = swap_file->f_mapping; @@ -467,7 +467,7 @@ int swap_set_page_dirty(struct page *pag { struct swap_info_struct *sis = page_swap_info(page); - if (data_race(sis->flags & SWP_FS)) { + if (data_race(sis->flags & SWP_FS_OPS)) { struct address_space *mapping = sis->swap_file->f_mapping; VM_BUG_ON_PAGE(!PageSwapCache(page), page); --- a/mm/swapfile.c~swap-rename-swp_fs-to-swap_fs_ops-to-avoid-ambiguity +++ a/mm/swapfile.c @@ -2437,7 +2437,7 @@ static int setup_swap_extents(struct swa if (ret >= 0) sis->flags |= SWP_ACTIVATED; if (!ret) { - sis->flags |= SWP_FS; + sis->flags |= SWP_FS_OPS; ret = add_swap_extent(sis, 0, sis->max, 0); *span = sis->pages; } --- a/mm/swap_state.c~swap-rename-swp_fs-to-swap_fs_ops-to-avoid-ambiguity +++ a/mm/swap_state.c @@ -665,7 +665,7 @@ struct page *swap_cluster_readahead(swp_ goto skip; /* Test swap type to make sure the dereference is safe */ - if (likely(si->flags & (SWP_BLKDEV | SWP_FS))) { + if (likely(si->flags & (SWP_BLKDEV | SWP_FS_OPS))) { struct inode *inode = si->swap_file->f_mapping->host; if (inode_read_congested(inode)) goto skip; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 069/181] mm: remove activate_page() from unuse_pte() 2020-10-13 23:46 incoming Andrew Morton ` (67 preceding siblings ...) 2020-10-13 23:52 ` [patch 068/181] swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 070/181] mm: remove superfluous __ClearPageActive() Andrew Morton ` (111 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, alexander.h.duyck, cai, david, hughd, iamjoonsoo.kim, linux-mm, mgorman, mhocko, mm-commits, npiggin, shy828301, torvalds, ying.huang, yuzhao From: Yu Zhao <yuzhao@google.com> Subject: mm: remove activate_page() from unuse_pte() We don't initially add anon pages to active lruvec after commit b518154e59aa ("mm/vmscan: protect the workingset on anonymous LRU"). Remove activate_page() from unuse_pte(), which seems to be missed by the commit. And make the function static while we are at it. Before the commit, we called lru_cache_add_active_or_unevictable() to add new ksm pages to active lruvec. Therefore, activate_page() wasn't necessary for them in the first place. Link: http://lkml.kernel.org/r/20200818184704.3625199-1-yuzhao@google.com Signed-off-by: Yu Zhao <yuzhao@google.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: Alexander Duyck <alexander.h.duyck@linux.intel.com> Cc: Huang Ying <ying.huang@intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Qian Cai <cai@lca.pw> Cc: Mel Gorman <mgorman@techsingularity.net> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Hugh Dickins <hughd@google.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/swap.h | 1 - mm/swap.c | 4 ++-- mm/swapfile.c | 5 ----- 3 files changed, 2 insertions(+), 8 deletions(-) --- a/include/linux/swap.h~mm-remove-activate_page-from-unuse_pte +++ a/include/linux/swap.h @@ -340,7 +340,6 @@ extern void lru_note_cost_page(struct pa extern void lru_cache_add(struct page *); extern void lru_add_page_tail(struct page *page, struct page *page_tail, struct lruvec *lruvec, struct list_head *head); -extern void activate_page(struct page *); extern void mark_page_accessed(struct page *); extern void lru_add_drain(void); extern void lru_add_drain_cpu(int cpu); --- a/mm/swap.c~mm-remove-activate_page-from-unuse_pte +++ a/mm/swap.c @@ -348,7 +348,7 @@ static bool need_activate_page_drain(int return pagevec_count(&per_cpu(lru_pvecs.activate_page, cpu)) != 0; } -void activate_page(struct page *page) +static void activate_page(struct page *page) { page = compound_head(page); if (PageLRU(page) && !PageActive(page) && !PageUnevictable(page)) { @@ -368,7 +368,7 @@ static inline void activate_page_drain(i { } -void activate_page(struct page *page) +static void activate_page(struct page *page) { pg_data_t *pgdat = page_pgdat(page); --- a/mm/swapfile.c~mm-remove-activate_page-from-unuse_pte +++ a/mm/swapfile.c @@ -1929,11 +1929,6 @@ static int unuse_pte(struct vm_area_stru lru_cache_add_inactive_or_unevictable(page, vma); } swap_free(entry); - /* - * Move the page to the active list so it is not - * immediately swapped out again after swapon. - */ - activate_page(page); out: pte_unmap_unlock(pte, ptl); if (page != swapcache) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 070/181] mm: remove superfluous __ClearPageActive() 2020-10-13 23:46 incoming Andrew Morton ` (68 preceding siblings ...) 2020-10-13 23:52 ` [patch 069/181] mm: remove activate_page() from unuse_pte() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 071/181] mm/swap.c: fix confusing comment in release_pages() Andrew Morton ` (110 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, alexander.h.duyck, cai, david, hughd, iamjoonsoo.kim, linux-mm, mgorman, mhocko, mm-commits, npiggin, shy828301, torvalds, ying.huang, yuzhao From: Yu Zhao <yuzhao@google.com> Subject: mm: remove superfluous __ClearPageActive() To activate a page, mark_page_accessed() always holds a reference on it. It either gets a new reference when adding a page to lru_pvecs.activate_page or reuses an existing one it previously got when it added a page to lru_pvecs.lru_add. So it doesn't call SetPageActive() on a page that doesn't have any reference left. Therefore, the race is impossible these days (I didn't brother to dig into its history). For other paths, namely reclaim and migration, a reference count is always held while calling SetPageActive() on a page. SetPageSlabPfmemalloc() also uses SetPageActive(), but it's irrelevant to LRU pages. Link: http://lkml.kernel.org/r/20200818184704.3625199-2-yuzhao@google.com Signed-off-by: Yu Zhao <yuzhao@google.com> Reviewed-by: Yang Shi <shy828301@gmail.com> Cc: Alexander Duyck <alexander.h.duyck@linux.intel.com> Cc: David Hildenbrand <david@redhat.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Hugh Dickins <hughd@google.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Mel Gorman <mgorman@techsingularity.net> Cc: Michal Hocko <mhocko@suse.com> Cc: Nicholas Piggin <npiggin@gmail.com> Cc: Qian Cai <cai@lca.pw> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memremap.c | 2 -- mm/swap.c | 2 -- 2 files changed, 4 deletions(-) --- a/mm/memremap.c~mm-remove-superfluous-__clearpageactive +++ a/mm/memremap.c @@ -494,8 +494,6 @@ void free_devmap_managed_page(struct pag return; } - /* Clear Active bit in case of parallel mark_page_accessed */ - __ClearPageActive(page); __ClearPageWaiters(page); mem_cgroup_uncharge(page); --- a/mm/swap.c~mm-remove-superfluous-__clearpageactive +++ a/mm/swap.c @@ -943,8 +943,6 @@ void release_pages(struct page **pages, del_page_from_lru_list(page, lruvec, page_off_lru(page)); } - /* Clear Active bit in case of parallel mark_page_accessed */ - __ClearPageActive(page); __ClearPageWaiters(page); list_add(&page->lru, &pages_to_free); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 071/181] mm/swap.c: fix confusing comment in release_pages() 2020-10-13 23:46 incoming Andrew Morton ` (69 preceding siblings ...) 2020-10-13 23:52 ` [patch 070/181] mm: remove superfluous __ClearPageActive() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 072/181] mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache() Andrew Morton ` (109 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, jhubbard, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/swap.c: fix confusing comment in release_pages() Since commit 07d802699528 ("mm: devmap: refactor 1-based refcounting for ZONE_DEVICE pages"), we have renamed the func put_devmap_managed_page() to page_is_devmap_managed(). Link: https://lkml.kernel.org/r/20200905084453.19353-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: John Hubbard <jhubbard@nvidia.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/swap.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/swap.c~mm-swap-fix-confusing-comment-in-release_pages +++ a/mm/swap.c @@ -902,7 +902,7 @@ void release_pages(struct page **pages, } /* * ZONE_DEVICE pages that return 'false' from - * put_devmap_managed_page() do not require special + * page_is_devmap_managed() do not require special * processing, and instead, expect a call to * put_page_testzero(). */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 072/181] mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache() 2020-10-13 23:46 incoming Andrew Morton ` (70 preceding siblings ...) 2020-10-13 23:52 ` [patch 071/181] mm/swap.c: fix confusing comment in release_pages() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 073/181] mm/page_io.c: remove useless out label in __swap_writepage() Andrew Morton ` (108 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache() enable_swap_slots_cache() always return zero and its return value is just ignored by the caller. So make enable_swap_slots_cache() void. Link: https://lkml.kernel.org/r/20200924113554.50614-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/swap_slots.h | 2 +- mm/swap_slots.c | 3 +-- 2 files changed, 2 insertions(+), 3 deletions(-) --- a/include/linux/swap_slots.h~mm-swap_slotsc-remove-always-zero-and-unused-return-value-of-enable_swap_slots_cache +++ a/include/linux/swap_slots.h @@ -23,7 +23,7 @@ struct swap_slots_cache { void disable_swap_slots_cache_lock(void); void reenable_swap_slots_cache_unlock(void); -int enable_swap_slots_cache(void); +void enable_swap_slots_cache(void); int free_swap_slot(swp_entry_t entry); extern bool swap_slot_cache_enabled; --- a/mm/swap_slots.c~mm-swap_slotsc-remove-always-zero-and-unused-return-value-of-enable_swap_slots_cache +++ a/mm/swap_slots.c @@ -237,7 +237,7 @@ static int free_slot_cache(unsigned int return 0; } -int enable_swap_slots_cache(void) +void enable_swap_slots_cache(void) { mutex_lock(&swap_slots_cache_enable_mutex); if (!swap_slot_cache_initialized) { @@ -255,7 +255,6 @@ int enable_swap_slots_cache(void) __reenable_swap_slots_cache(); out_unlock: mutex_unlock(&swap_slots_cache_enable_mutex); - return 0; } /* called with swap slot cache's alloc lock held */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 073/181] mm/page_io.c: remove useless out label in __swap_writepage() 2020-10-13 23:46 incoming Andrew Morton ` (71 preceding siblings ...) 2020-10-13 23:52 ` [patch 072/181] mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 074/181] mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable() Andrew Morton ` (107 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/page_io.c: remove useless out label in __swap_writepage() The out label is only used in one place and return ret directly without something like resource cleanup or lock release and so on. So we should remove this jump label and do some cleanup. Link: https://lkml.kernel.org/r/20200927124032.22521-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_io.c | 8 +++----- 1 file changed, 3 insertions(+), 5 deletions(-) --- a/mm/page_io.c~mm-remove-useless-out-label-in-__swap_writepage +++ a/mm/page_io.c @@ -359,13 +359,11 @@ int __swap_writepage(struct page *page, return 0; } - ret = 0; bio = get_swap_bio(GFP_NOIO, page, end_write_func); if (bio == NULL) { set_page_dirty(page); unlock_page(page); - ret = -ENOMEM; - goto out; + return -ENOMEM; } bio->bi_opf = REQ_OP_WRITE | REQ_SWAP | wbc_to_write_flags(wbc); bio_associate_blkg_from_page(bio, page); @@ -373,8 +371,8 @@ int __swap_writepage(struct page *page, set_page_writeback(page); unlock_page(page); submit_bio(bio); -out: - return ret; + + return 0; } int swap_readpage(struct page *page, bool synchronous) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 074/181] mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable() 2020-10-13 23:46 incoming Andrew Morton ` (72 preceding siblings ...) 2020-10-13 23:52 ` [patch 073/181] mm/page_io.c: remove useless out label in __swap_writepage() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 075/181] mm/swapfile.c: remove unnecessary goto out in _swap_info_get() Andrew Morton ` (106 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mm-commits, shakeelb, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable() Since commit 9c4e6b1a7027 ("mm, mlock, vmscan: no more skipping pagevecs"), unevictable pages do not goes directly back onto zone's unevictable list. Link: https://lkml.kernel.org/r/20200927122209.59328-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Shakeel Butt <shakeelb@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/swap.c | 4 +--- 1 file changed, 1 insertion(+), 3 deletions(-) --- a/mm/swap.c~mm-fix-incomplete-comment-in-lru_cache_add_inactive_or_unevictable +++ a/mm/swap.c @@ -481,9 +481,7 @@ EXPORT_SYMBOL(lru_cache_add); * @vma: vma in which page is mapped for determining reclaimability * * Place @page on the inactive or unevictable LRU list, depending on its - * evictability. Note that if the page is not evictable, it goes - * directly back onto it's zone's unevictable list, it does NOT use a - * per cpu pagevec. + * evictability. */ void lru_cache_add_inactive_or_unevictable(struct page *page, struct vm_area_struct *vma) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 075/181] mm/swapfile.c: remove unnecessary goto out in _swap_info_get() 2020-10-13 23:46 incoming Andrew Morton ` (73 preceding siblings ...) 2020-10-13 23:52 ` [patch 074/181] mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 076/181] mm/swapfile.c: fix potential memory leak in sys_swapon Andrew Morton ` (105 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/swapfile.c: remove unnecessary goto out in _swap_info_get() It's unnecessary to goto the out label while out label is just below. Link: https://lkml.kernel.org/r/20200930102549.1885-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/swapfile.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/swapfile.c~mm-remove-unnecessary-goto-out-in-_swap_info_get +++ a/mm/swapfile.c @@ -1184,7 +1184,6 @@ static struct swap_info_struct *_swap_in bad_free: pr_err("swap_info_get: %s%08lx\n", Unused_offset, entry.val); - goto out; out: return NULL; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 076/181] mm/swapfile.c: fix potential memory leak in sys_swapon 2020-10-13 23:46 incoming Andrew Morton ` (74 preceding siblings ...) 2020-10-13 23:52 ` [patch 075/181] mm/swapfile.c: remove unnecessary goto out in _swap_info_get() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 077/181] mm/memremap.c: convert devmap static branch to {inc,dec} Andrew Morton ` (104 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, darrick.wong, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/swapfile.c: fix potential memory leak in sys_swapon If we failed to drain inode, we would forget to free the swap address space allocated by init_swap_address_space() above. Link: https://lkml.kernel.org/r/20200930101803.53884-1-linmiaohe@huawei.com Fixes: dc617f29dbe5 ("vfs: don't allow writes to swap files") Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Reviewed-by: Darrick J. Wong <darrick.wong@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/swapfile.c | 4 +++- 1 file changed, 3 insertions(+), 1 deletion(-) --- a/mm/swapfile.c~mm-fix-potential-memory-leak-in-sys_swapon +++ a/mm/swapfile.c @@ -3342,7 +3342,7 @@ SYSCALL_DEFINE2(swapon, const char __use error = inode_drain_writes(inode); if (error) { inode->i_flags &= ~S_SWAPFILE; - goto bad_swap_unlock_inode; + goto free_swap_address_space; } mutex_lock(&swapon_mutex); @@ -3367,6 +3367,8 @@ SYSCALL_DEFINE2(swapon, const char __use error = 0; goto out; +free_swap_address_space: + exit_swap_address_space(p->type); bad_swap_unlock_inode: inode_unlock(inode); bad_swap: _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 077/181] mm/memremap.c: convert devmap static branch to {inc,dec} 2020-10-13 23:46 incoming Andrew Morton ` (75 preceding siblings ...) 2020-10-13 23:52 ` [patch 076/181] mm/swapfile.c: fix potential memory leak in sys_swapon Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 078/181] mm: memcontrol: use flex_array_size() helper in memcpy() Andrew Morton ` (103 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, dan.j.williams, ira.weiny, linux-mm, mm-commits, torvalds, vishal.l.verma, william.kucharski From: Ira Weiny <ira.weiny@intel.com> Subject: mm/memremap.c: convert devmap static branch to {inc,dec} While reviewing Protection Key Supervisor support it was pointed out that using a counter to track static branch enable was an anti-pattern which was better solved using the provided static_branch_{inc,dec} functions.[1] Fix up devmap_managed_key to work the same way. Also this should be safer because there is a very small (very unlikely) race when multiple callers try to enable at the same time. [1] https://lore.kernel.org/lkml/20200714194031.GI5523@worktop.programming.kicks-ass.net/ Link: https://lkml.kernel.org/r/20200810235319.2796597-1-ira.weiny@intel.com Signed-off-by: Ira Weiny <ira.weiny@intel.com> Reviewed-by: William Kucharski <william.kucharski@oracle.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: Vishal Verma <vishal.l.verma@intel.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memremap.c | 7 ++----- 1 file changed, 2 insertions(+), 5 deletions(-) --- a/mm/memremap.c~memremap-convert-devmap-static-branch-to-incdec +++ a/mm/memremap.c @@ -40,12 +40,10 @@ EXPORT_SYMBOL_GPL(memremap_compat_align) #ifdef CONFIG_DEV_PAGEMAP_OPS DEFINE_STATIC_KEY_FALSE(devmap_managed_key); EXPORT_SYMBOL(devmap_managed_key); -static atomic_t devmap_managed_enable; static void devmap_managed_enable_put(void) { - if (atomic_dec_and_test(&devmap_managed_enable)) - static_branch_disable(&devmap_managed_key); + static_branch_dec(&devmap_managed_key); } static int devmap_managed_enable_get(struct dev_pagemap *pgmap) @@ -56,8 +54,7 @@ static int devmap_managed_enable_get(str return -EINVAL; } - if (atomic_inc_return(&devmap_managed_enable) == 1) - static_branch_enable(&devmap_managed_key); + static_branch_inc(&devmap_managed_key); return 0; } #else _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 078/181] mm: memcontrol: use flex_array_size() helper in memcpy() 2020-10-13 23:46 incoming Andrew Morton ` (76 preceding siblings ...) 2020-10-13 23:52 ` [patch 077/181] mm/memremap.c: convert devmap static branch to {inc,dec} Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 079/181] mm: memcontrol: use the preferred form for passing the size of a structure type Andrew Morton ` (102 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, gustavoars, hannes, linux-mm, mhocko, mm-commits, torvalds, vdavydov.dev From: "Gustavo A. R. Silva" <gustavoars@kernel.org> Subject: mm: memcontrol: use flex_array_size() helper in memcpy() Make use of the flex_array_size() helper to calculate the size of a flexible array member within an enclosing structure. This helper offers defense-in-depth against potential integer overflows, while at the same time makes it explicitly clear that we are dealing with a flexible array member. Also, remove unnecessary braces. Link: https://lkml.kernel.org/r/ddd60dae2d9aea1ccdd2be66634815c93696125e.1596214831.git.gustavoars@kernel.org Signed-off-by: Gustavo A. R. Silva <gustavoars@kernel.org> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 7 +++---- 1 file changed, 3 insertions(+), 4 deletions(-) --- a/mm/memcontrol.c~mm-memcontrol-use-flex_array_size-helper-in-memcpy +++ a/mm/memcontrol.c @@ -4255,10 +4255,9 @@ static int __mem_cgroup_usage_register_e new->size = size; /* Copy thresholds (if any) to new array */ - if (thresholds->primary) { - memcpy(new->entries, thresholds->primary->entries, (size - 1) * - sizeof(struct mem_cgroup_threshold)); - } + if (thresholds->primary) + memcpy(new->entries, thresholds->primary->entries, + flex_array_size(new, entries, size - 1)); /* Add new threshold */ new->entries[size - 1].eventfd = eventfd; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 079/181] mm: memcontrol: use the preferred form for passing the size of a structure type 2020-10-13 23:46 incoming Andrew Morton ` (77 preceding siblings ...) 2020-10-13 23:52 ` [patch 078/181] mm: memcontrol: use flex_array_size() helper in memcpy() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 080/181] mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj() Andrew Morton ` (101 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, gustavoars, hannes, linux-mm, mhocko, mm-commits, torvalds, vdavydov.dev From: "Gustavo A. R. Silva" <gustavoars@kernel.org> Subject: mm: memcontrol: use the preferred form for passing the size of a structure type Use the preferred form for passing the size of a structure type. The alternative form where the structure type is spelled out hurts readability and introduces an opportunity for a bug when the object type is changed but the corresponding object identifier to which the sizeof operator is applied is not. Link: https://lkml.kernel.org/r/773e013ff2f07fe2a0b47153f14dea054c0c04f1.1596214831.git.gustavoars@kernel.org Signed-off-by: Gustavo A. R. Silva <gustavoars@kernel.org> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/memcontrol.c~mm-memcontrol-use-the-preferred-form-for-passing-the-size-of-a-structure-type +++ a/mm/memcontrol.c @@ -4264,7 +4264,7 @@ static int __mem_cgroup_usage_register_e new->entries[size - 1].threshold = threshold; /* Sort thresholds. Registering of new threshold isn't time-critical */ - sort(new->entries, size, sizeof(struct mem_cgroup_threshold), + sort(new->entries, size, sizeof(*new->entries), compare_thresholds, NULL); /* Find current threshold */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 080/181] mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj() 2020-10-13 23:46 incoming Andrew Morton ` (78 preceding siblings ...) 2020-10-13 23:52 ` [patch 079/181] mm: memcontrol: use the preferred form for passing the size of a structure type Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 081/181] mm: memcontrol: correct the comment of mem_cgroup_iter() Andrew Morton ` (100 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, guro, hannes, linux-mm, mm-commits, shakeelb, torvalds, vbabka From: Roman Gushchin <guro@fb.com> Subject: mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj() mem_cgroup_from_obj() checks the lowest bit of the page->mem_cgroup pointer to determine if the page has an attached obj_cgroup vector instead of a regular memcg pointer. If it's not set, it simple returns the page->mem_cgroup value as a struct mem_cgroup pointer. The commit 10befea91b61 ("mm: memcg/slab: use a single set of kmem_caches for all allocations") changed the moment when this bit is set: if previously it was set on the allocation of the slab page, now it can be set well after, when the first accounted object is allocated on this page. It opened a race: if page->mem_cgroup is set concurrently after the first page_has_obj_cgroups(page) check, a pointer to the obj_cgroups array can be returned as a memory cgroup pointer. A simple check for page->mem_cgroup pointer for NULL before the page_has_obj_cgroups() check fixes the race. Indeed, if the pointer is not NULL, it's either a simple mem_cgroup pointer or a pointer to obj_cgroup vector. The pointer can be asynchronously changed from NULL to (obj_cgroup_vec | 0x1UL), but can't be changed from a valid memcg pointer to objcg vector or back. If the object passed to mem_cgroup_from_obj() is a slab object and page->mem_cgroup is NULL, it means that the object is not accounted, so the function must return NULL. I've discovered the race looking at the code, so far I haven't seen it in the wild. Link: https://lkml.kernel.org/r/20200910022435.2773735-1-guro@fb.com Fixes: 10befea91b61 ("mm: memcg/slab: use a single set of kmem_caches for all allocations") Signed-off-by: Roman Gushchin <guro@fb.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 11 +++++++++++ 1 file changed, 11 insertions(+) --- a/mm/memcontrol.c~mm-memcg-slab-fix-racy-access-to-page-mem_cgroup-in-mem_cgroup_from_obj +++ a/mm/memcontrol.c @@ -2888,6 +2888,17 @@ struct mem_cgroup *mem_cgroup_from_obj(v page = virt_to_head_page(p); /* + * If page->mem_cgroup is set, it's either a simple mem_cgroup pointer + * or a pointer to obj_cgroup vector. In the latter case the lowest + * bit of the pointer is set. + * The page->mem_cgroup pointer can be asynchronously changed + * from NULL to (obj_cgroup_vec | 0x1UL), but can't be changed + * from a valid memcg pointer to objcg vector or back. + */ + if (!page->mem_cgroup) + return NULL; + + /* * Slab objects are accounted individually, not per-page. * Memcg membership data for each individual object is saved in * the page->obj_cgroups. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 081/181] mm: memcontrol: correct the comment of mem_cgroup_iter() 2020-10-13 23:46 incoming Andrew Morton ` (79 preceding siblings ...) 2020-10-13 23:52 ` [patch 080/181] mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 082/181] mm/memcg: clean up obsolete enum charge_type Andrew Morton ` (99 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, hannes, linmiaohe, linux-mm, mhocko, mm-commits, torvalds, vdavydov.dev From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm: memcontrol: correct the comment of mem_cgroup_iter() Since commit bbec2e15170a ("mm: rename page_counter's count/limit into usage/max"), the arg @reclaim has no priority field anymore. Link: https://lkml.kernel.org/r/20200913094129.44558-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) --- a/mm/memcontrol.c~mm-memcontrol-correct-the-comment-of-mem_cgroup_iter +++ a/mm/memcontrol.c @@ -1102,9 +1102,9 @@ static __always_inline struct mem_cgroup * invocations for reference counting, or use mem_cgroup_iter_break() * to cancel a hierarchy walk before the round-trip is complete. * - * Reclaimers can specify a node and a priority level in @reclaim to - * divide up the memcgs in the hierarchy among all concurrent - * reclaimers operating on the same node and priority. + * Reclaimers can specify a node in @reclaim to divide up the memcgs + * in the hierarchy among all concurrent reclaimers operating on the + * same node. */ struct mem_cgroup *mem_cgroup_iter(struct mem_cgroup *root, struct mem_cgroup *prev, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 082/181] mm/memcg: clean up obsolete enum charge_type 2020-10-13 23:46 incoming Andrew Morton ` (80 preceding siblings ...) 2020-10-13 23:52 ` [patch 081/181] mm: memcontrol: correct the comment of mem_cgroup_iter() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 083/181] mm/memcg: simplify mem_cgroup_get_max() Andrew Morton ` (98 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, chris, guro, hannes, laoar.shao, linux-mm, longman, mhocko, mm-commits, shakeelb, tj, torvalds, vdavydov.dev From: Waiman Long <longman@redhat.com> Subject: mm/memcg: clean up obsolete enum charge_type Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2. This patch (of 3): Since commit 0a31bc97c80c ("mm: memcontrol: rewrite uncharge API") and commit 00501b531c47 ("mm: memcontrol: rewrite charge API") in v3.17, the enum charge_type was no longer used anywhere. However, the enum itself was not removed at that time. Remove the obsolete enum charge_type now. Link: https://lkml.kernel.org/r/20200914024452.19167-1-longman@redhat.com Link: https://lkml.kernel.org/r/20200914024452.19167-2-longman@redhat.com Signed-off-by: Waiman Long <longman@redhat.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Acked-by: Michal Hocko <mhocko@suse.com> Acked-by: Chris Down <chris@chrisdown.name> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Cc: Tejun Heo <tj@kernel.org> Cc: Roman Gushchin <guro@fb.com> Cc: Yafang Shao <laoar.shao@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 8 -------- 1 file changed, 8 deletions(-) --- a/mm/memcontrol.c~mm-memcg-clean-up-obsolete-enum-charge_type +++ a/mm/memcontrol.c @@ -197,14 +197,6 @@ static struct move_charge_struct { #define MEM_CGROUP_MAX_RECLAIM_LOOPS 100 #define MEM_CGROUP_MAX_SOFT_LIMIT_RECLAIM_LOOPS 2 -enum charge_type { - MEM_CGROUP_CHARGE_TYPE_CACHE = 0, - MEM_CGROUP_CHARGE_TYPE_ANON, - MEM_CGROUP_CHARGE_TYPE_SWAPOUT, /* for accounting swapcache */ - MEM_CGROUP_CHARGE_TYPE_DROP, /* a page was unused swap cache */ - NR_CHARGE_TYPE, -}; - /* for encoding cft->private value on file */ enum res_type { _MEM, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 083/181] mm/memcg: simplify mem_cgroup_get_max() 2020-10-13 23:46 incoming Andrew Morton ` (81 preceding siblings ...) 2020-10-13 23:52 ` [patch 082/181] mm/memcg: clean up obsolete enum charge_type Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 084/181] mm/memcg: unify swap and memsw page counters Andrew Morton ` (97 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, chris, guro, hannes, laoar.shao, linux-mm, longman, mhocko, mm-commits, shakeelb, tj, torvalds, vdavydov.dev From: Waiman Long <longman@redhat.com> Subject: mm/memcg: simplify mem_cgroup_get_max() mem_cgroup_get_max() used to get memory+swap max from both the v1 memsw and v2 memory+swap page counters & return the maximum of these 2 values. This is redundant and it is more efficient to just get either the v1 or the v2 values depending on which one is currently in use. [longman@redhat.com: v4] Link: https://lkml.kernel.org/r/20200914150928.7841-1-longman@redhat.com Link: https://lkml.kernel.org/r/20200914024452.19167-3-longman@redhat.com Signed-off-by: Waiman Long <longman@redhat.com> Acked-by: Michal Hocko <mhocko@suse.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Chris Down <chris@chrisdown.name> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Roman Gushchin <guro@fb.com> Cc: Tejun Heo <tj@kernel.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Cc: Yafang Shao <laoar.shao@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 20 +++++++++++--------- 1 file changed, 11 insertions(+), 9 deletions(-) --- a/mm/memcontrol.c~mm-memcg-simplify-mem_cgroup_get_max +++ a/mm/memcontrol.c @@ -1633,17 +1633,19 @@ void mem_cgroup_print_oom_meminfo(struct */ unsigned long mem_cgroup_get_max(struct mem_cgroup *memcg) { - unsigned long max; + unsigned long max = READ_ONCE(memcg->memory.max); - max = READ_ONCE(memcg->memory.max); - if (mem_cgroup_swappiness(memcg)) { - unsigned long memsw_max; - unsigned long swap_max; + if (cgroup_subsys_on_dfl(memory_cgrp_subsys)) { + if (mem_cgroup_swappiness(memcg)) + max += min(READ_ONCE(memcg->swap.max), + (unsigned long)total_swap_pages); + } else { /* v1 */ + if (mem_cgroup_swappiness(memcg)) { + /* Calculate swap excess capacity from memsw limit */ + unsigned long swap = READ_ONCE(memcg->memsw.max) - max; - memsw_max = memcg->memsw.max; - swap_max = READ_ONCE(memcg->swap.max); - swap_max = min(swap_max, (unsigned long)total_swap_pages); - max = min(max + swap_max, memsw_max); + max += min(swap, (unsigned long)total_swap_pages); + } } return max; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 084/181] mm/memcg: unify swap and memsw page counters 2020-10-13 23:46 incoming Andrew Morton ` (82 preceding siblings ...) 2020-10-13 23:52 ` [patch 083/181] mm/memcg: simplify mem_cgroup_get_max() Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:52 ` [patch 085/181] mm: memcontrol: add the missing numa_stat interface for cgroup v2 Andrew Morton ` (96 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, chris, guro, hannes, laoar.shao, linux-mm, longman, mhocko, mm-commits, shakeelb, tj, torvalds, vdavydov.dev From: Waiman Long <longman@redhat.com> Subject: mm/memcg: unify swap and memsw page counters The swap page counter is v2 only while memsw is v1 only. As v1 and v2 controllers cannot be active at the same time, there is no point to keep both swap and memsw page counters in mem_cgroup. The previous patch has made sure that memsw page counter is updated and accessed only when in v1 code paths. So it is now safe to alias the v1 memsw page counter to v2 swap page counter. This saves 14 long's in the size of mem_cgroup. This is a saving of 112 bytes for 64-bit archs. While at it, also document which page counters are used in v1 and/or v2. Link: https://lkml.kernel.org/r/20200914024452.19167-4-longman@redhat.com Signed-off-by: Waiman Long <longman@redhat.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Chris Down <chris@chrisdown.name> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Roman Gushchin <guro@fb.com> Cc: Tejun Heo <tj@kernel.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Cc: Yafang Shao <laoar.shao@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/memcontrol.h | 13 ++++++++----- mm/memcontrol.c | 3 --- 2 files changed, 8 insertions(+), 8 deletions(-) --- a/include/linux/memcontrol.h~mm-memcg-unify-swap-and-memsw-page-counters +++ a/include/linux/memcontrol.h @@ -215,13 +215,16 @@ struct mem_cgroup { struct mem_cgroup_id id; /* Accounted resources */ - struct page_counter memory; - struct page_counter swap; + struct page_counter memory; /* Both v1 & v2 */ + + union { + struct page_counter swap; /* v2 only */ + struct page_counter memsw; /* v1 only */ + }; /* Legacy consumer-oriented counters */ - struct page_counter memsw; - struct page_counter kmem; - struct page_counter tcpmem; + struct page_counter kmem; /* v1 only */ + struct page_counter tcpmem; /* v1 only */ /* Range enforcement for interrupt charges */ struct work_struct high_work; --- a/mm/memcontrol.c~mm-memcg-unify-swap-and-memsw-page-counters +++ a/mm/memcontrol.c @@ -5295,13 +5295,11 @@ mem_cgroup_css_alloc(struct cgroup_subsy memcg->use_hierarchy = true; page_counter_init(&memcg->memory, &parent->memory); page_counter_init(&memcg->swap, &parent->swap); - page_counter_init(&memcg->memsw, &parent->memsw); page_counter_init(&memcg->kmem, &parent->kmem); page_counter_init(&memcg->tcpmem, &parent->tcpmem); } else { page_counter_init(&memcg->memory, NULL); page_counter_init(&memcg->swap, NULL); - page_counter_init(&memcg->memsw, NULL); page_counter_init(&memcg->kmem, NULL); page_counter_init(&memcg->tcpmem, NULL); /* @@ -5430,7 +5428,6 @@ static void mem_cgroup_css_reset(struct page_counter_set_max(&memcg->memory, PAGE_COUNTER_MAX); page_counter_set_max(&memcg->swap, PAGE_COUNTER_MAX); - page_counter_set_max(&memcg->memsw, PAGE_COUNTER_MAX); page_counter_set_max(&memcg->kmem, PAGE_COUNTER_MAX); page_counter_set_max(&memcg->tcpmem, PAGE_COUNTER_MAX); page_counter_set_min(&memcg->memory, 0); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 085/181] mm: memcontrol: add the missing numa_stat interface for cgroup v2 2020-10-13 23:46 incoming Andrew Morton ` (83 preceding siblings ...) 2020-10-13 23:52 ` [patch 084/181] mm/memcg: unify swap and memsw page counters Andrew Morton @ 2020-10-13 23:52 ` Andrew Morton 2020-10-13 23:53 ` [patch 086/181] mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge() Andrew Morton ` (95 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:52 UTC (permalink / raw) To: akpm, corbet, guro, hannes, linux-mm, lizefan, mhocko, mm-commits, rdunlap, shakeelb, songmuchun, torvalds, vdavydov.dev From: Muchun Song <songmuchun@bytedance.com> Subject: mm: memcontrol: add the missing numa_stat interface for cgroup v2 In the cgroup v1, we have a numa_stat interface. This is useful for providing visibility into the numa locality information within an memcg since the pages are allowed to be allocated from any physical node. One of the use cases is evaluating application performance by combining this information with the application's CPU allocation. But the cgroup v2 does not. So this patch adds the missing information. Link: https://lkml.kernel.org/r/20200916100030.71698-2-songmuchun@bytedance.com Signed-off-by: Muchun Song <songmuchun@bytedance.com> Suggested-by: Shakeel Butt <shakeelb@google.com> Reviewed-by: Shakeel Butt <shakeelb@google.com> Cc: Zefan Li <lizefan@huawei.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Jonathan Corbet <corbet@lwn.net> Cc: Michal Hocko <mhocko@kernel.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Cc: Roman Gushchin <guro@fb.com> Cc: Randy Dunlap <rdunlap@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/admin-guide/cgroup-v2.rst | 69 ++++++-- mm/memcontrol.c | 172 ++++++++++++++-------- 2 files changed, 160 insertions(+), 81 deletions(-) --- a/Documentation/admin-guide/cgroup-v2.rst~mm-memcontrol-add-the-missing-numa_stat-interface-for-cgroup-v2 +++ a/Documentation/admin-guide/cgroup-v2.rst @@ -1259,6 +1259,10 @@ PAGE_SIZE multiple when read back. can show up in the middle. Don't rely on items remaining in a fixed position; use the keys to look up specific values! + If the entry has no per-node counter(or not show in the + mempry.numa_stat). We use 'npn'(non-per-node) as the tag + to indicate that it will not show in the mempry.numa_stat. + anon Amount of memory used in anonymous mappings such as brk(), sbrk(), and mmap(MAP_ANONYMOUS) @@ -1270,15 +1274,11 @@ PAGE_SIZE multiple when read back. kernel_stack Amount of memory allocated to kernel stacks. - slab - Amount of memory used for storing in-kernel data - structures. - - percpu + percpu(npn) Amount of memory used for storing per-cpu kernel data structures. - sock + sock(npn) Amount of memory used in network transmission buffers shmem @@ -1318,11 +1318,9 @@ PAGE_SIZE multiple when read back. Part of "slab" that cannot be reclaimed on memory pressure. - pgfault - Total number of page faults incurred - - pgmajfault - Number of major page faults incurred + slab(npn) + Amount of memory used for storing in-kernel data + structures. workingset_refault_anon Number of refaults of previously evicted anonymous pages. @@ -1348,37 +1346,68 @@ PAGE_SIZE multiple when read back. workingset_nodereclaim Number of times a shadow node has been reclaimed - pgrefill + pgfault(npn) + Total number of page faults incurred + + pgmajfault(npn) + Number of major page faults incurred + + pgrefill(npn) Amount of scanned pages (in an active LRU list) - pgscan + pgscan(npn) Amount of scanned pages (in an inactive LRU list) - pgsteal + pgsteal(npn) Amount of reclaimed pages - pgactivate + pgactivate(npn) Amount of pages moved to the active LRU list - pgdeactivate + pgdeactivate(npn) Amount of pages moved to the inactive LRU list - pglazyfree + pglazyfree(npn) Amount of pages postponed to be freed under memory pressure - pglazyfreed + pglazyfreed(npn) Amount of reclaimed lazyfree pages - thp_fault_alloc + thp_fault_alloc(npn) Number of transparent hugepages which were allocated to satisfy a page fault. This counter is not present when CONFIG_TRANSPARENT_HUGEPAGE is not set. - thp_collapse_alloc + thp_collapse_alloc(npn) Number of transparent hugepages which were allocated to allow collapsing an existing range of pages. This counter is not present when CONFIG_TRANSPARENT_HUGEPAGE is not set. + memory.numa_stat + A read-only nested-keyed file which exists on non-root cgroups. + + This breaks down the cgroup's memory footprint into different + types of memory, type-specific details, and other information + per node on the state of the memory management system. + + This is useful for providing visibility into the NUMA locality + information within an memcg since the pages are allowed to be + allocated from any physical node. One of the use case is evaluating + application performance by combining this information with the + application's CPU allocation. + + All memory amounts are in bytes. + + The output format of memory.numa_stat is:: + + type N0=<bytes in node 0> N1=<bytes in node 1> ... + + The entries are ordered to be human readable, and new entries + can show up in the middle. Don't rely on items remaining in a + fixed position; use the keys to look up specific values! + + The entries can refer to the memory.stat. + memory.swap.current A read-only single value file which exists on non-root cgroups. --- a/mm/memcontrol.c~mm-memcontrol-add-the-missing-numa_stat-interface-for-cgroup-v2 +++ a/mm/memcontrol.c @@ -1448,6 +1448,70 @@ static bool mem_cgroup_wait_acct_move(st return false; } +struct memory_stat { + const char *name; + unsigned int ratio; + unsigned int idx; +}; + +static struct memory_stat memory_stats[] = { + { "anon", PAGE_SIZE, NR_ANON_MAPPED }, + { "file", PAGE_SIZE, NR_FILE_PAGES }, + { "kernel_stack", 1024, NR_KERNEL_STACK_KB }, + { "percpu", 1, MEMCG_PERCPU_B }, + { "sock", PAGE_SIZE, MEMCG_SOCK }, + { "shmem", PAGE_SIZE, NR_SHMEM }, + { "file_mapped", PAGE_SIZE, NR_FILE_MAPPED }, + { "file_dirty", PAGE_SIZE, NR_FILE_DIRTY }, + { "file_writeback", PAGE_SIZE, NR_WRITEBACK }, +#ifdef CONFIG_TRANSPARENT_HUGEPAGE + /* + * The ratio will be initialized in memory_stats_init(). Because + * on some architectures, the macro of HPAGE_PMD_SIZE is not + * constant(e.g. powerpc). + */ + { "anon_thp", 0, NR_ANON_THPS }, +#endif + { "inactive_anon", PAGE_SIZE, NR_INACTIVE_ANON }, + { "active_anon", PAGE_SIZE, NR_ACTIVE_ANON }, + { "inactive_file", PAGE_SIZE, NR_INACTIVE_FILE }, + { "active_file", PAGE_SIZE, NR_ACTIVE_FILE }, + { "unevictable", PAGE_SIZE, NR_UNEVICTABLE }, + + /* + * Note: The slab_reclaimable and slab_unreclaimable must be + * together and slab_reclaimable must be in front. + */ + { "slab_reclaimable", 1, NR_SLAB_RECLAIMABLE_B }, + { "slab_unreclaimable", 1, NR_SLAB_UNRECLAIMABLE_B }, + + /* The memory events */ + { "workingset_refault_anon", 1, WORKINGSET_REFAULT_ANON }, + { "workingset_refault_file", 1, WORKINGSET_REFAULT_FILE }, + { "workingset_activate_anon", 1, WORKINGSET_ACTIVATE_ANON }, + { "workingset_activate_file", 1, WORKINGSET_ACTIVATE_FILE }, + { "workingset_restore_anon", 1, WORKINGSET_RESTORE_ANON }, + { "workingset_restore_file", 1, WORKINGSET_RESTORE_FILE }, + { "workingset_nodereclaim", 1, WORKINGSET_NODERECLAIM }, +}; + +static int __init memory_stats_init(void) +{ + int i; + + for (i = 0; i < ARRAY_SIZE(memory_stats); i++) { +#ifdef CONFIG_TRANSPARENT_HUGEPAGE + if (memory_stats[i].idx == NR_ANON_THPS) + memory_stats[i].ratio = HPAGE_PMD_SIZE; +#endif + VM_BUG_ON(!memory_stats[i].ratio); + VM_BUG_ON(memory_stats[i].idx >= MEMCG_NR_STAT); + } + + return 0; +} +pure_initcall(memory_stats_init); + static char *memory_stat_format(struct mem_cgroup *memcg) { struct seq_buf s; @@ -1468,52 +1532,19 @@ static char *memory_stat_format(struct m * Current memory state: */ - seq_buf_printf(&s, "anon %llu\n", - (u64)memcg_page_state(memcg, NR_ANON_MAPPED) * - PAGE_SIZE); - seq_buf_printf(&s, "file %llu\n", - (u64)memcg_page_state(memcg, NR_FILE_PAGES) * - PAGE_SIZE); - seq_buf_printf(&s, "kernel_stack %llu\n", - (u64)memcg_page_state(memcg, NR_KERNEL_STACK_KB) * - 1024); - seq_buf_printf(&s, "slab %llu\n", - (u64)(memcg_page_state(memcg, NR_SLAB_RECLAIMABLE_B) + - memcg_page_state(memcg, NR_SLAB_UNRECLAIMABLE_B))); - seq_buf_printf(&s, "percpu %llu\n", - (u64)memcg_page_state(memcg, MEMCG_PERCPU_B)); - seq_buf_printf(&s, "sock %llu\n", - (u64)memcg_page_state(memcg, MEMCG_SOCK) * - PAGE_SIZE); - - seq_buf_printf(&s, "shmem %llu\n", - (u64)memcg_page_state(memcg, NR_SHMEM) * - PAGE_SIZE); - seq_buf_printf(&s, "file_mapped %llu\n", - (u64)memcg_page_state(memcg, NR_FILE_MAPPED) * - PAGE_SIZE); - seq_buf_printf(&s, "file_dirty %llu\n", - (u64)memcg_page_state(memcg, NR_FILE_DIRTY) * - PAGE_SIZE); - seq_buf_printf(&s, "file_writeback %llu\n", - (u64)memcg_page_state(memcg, NR_WRITEBACK) * - PAGE_SIZE); - -#ifdef CONFIG_TRANSPARENT_HUGEPAGE - seq_buf_printf(&s, "anon_thp %llu\n", - (u64)memcg_page_state(memcg, NR_ANON_THPS) * - HPAGE_PMD_SIZE); -#endif + for (i = 0; i < ARRAY_SIZE(memory_stats); i++) { + u64 size; - for (i = 0; i < NR_LRU_LISTS; i++) - seq_buf_printf(&s, "%s %llu\n", lru_list_name(i), - (u64)memcg_page_state(memcg, NR_LRU_BASE + i) * - PAGE_SIZE); - - seq_buf_printf(&s, "slab_reclaimable %llu\n", - (u64)memcg_page_state(memcg, NR_SLAB_RECLAIMABLE_B)); - seq_buf_printf(&s, "slab_unreclaimable %llu\n", - (u64)memcg_page_state(memcg, NR_SLAB_UNRECLAIMABLE_B)); + size = memcg_page_state(memcg, memory_stats[i].idx); + size *= memory_stats[i].ratio; + seq_buf_printf(&s, "%s %llu\n", memory_stats[i].name, size); + + if (unlikely(memory_stats[i].idx == NR_SLAB_UNRECLAIMABLE_B)) { + size = memcg_page_state(memcg, NR_SLAB_RECLAIMABLE_B) + + memcg_page_state(memcg, NR_SLAB_UNRECLAIMABLE_B); + seq_buf_printf(&s, "slab %llu\n", size); + } + } /* Accumulated memory events */ @@ -1521,22 +1552,6 @@ static char *memory_stat_format(struct m memcg_events(memcg, PGFAULT)); seq_buf_printf(&s, "%s %lu\n", vm_event_name(PGMAJFAULT), memcg_events(memcg, PGMAJFAULT)); - - seq_buf_printf(&s, "workingset_refault_anon %lu\n", - memcg_page_state(memcg, WORKINGSET_REFAULT_ANON)); - seq_buf_printf(&s, "workingset_refault_file %lu\n", - memcg_page_state(memcg, WORKINGSET_REFAULT_FILE)); - seq_buf_printf(&s, "workingset_activate_anon %lu\n", - memcg_page_state(memcg, WORKINGSET_ACTIVATE_ANON)); - seq_buf_printf(&s, "workingset_activate_file %lu\n", - memcg_page_state(memcg, WORKINGSET_ACTIVATE_FILE)); - seq_buf_printf(&s, "workingset_restore_anon %lu\n", - memcg_page_state(memcg, WORKINGSET_RESTORE_ANON)); - seq_buf_printf(&s, "workingset_restore_file %lu\n", - memcg_page_state(memcg, WORKINGSET_RESTORE_FILE)); - seq_buf_printf(&s, "workingset_nodereclaim %lu\n", - memcg_page_state(memcg, WORKINGSET_NODERECLAIM)); - seq_buf_printf(&s, "%s %lu\n", vm_event_name(PGREFILL), memcg_events(memcg, PGREFILL)); seq_buf_printf(&s, "pgscan %lu\n", @@ -6374,6 +6389,35 @@ static int memory_stat_show(struct seq_f return 0; } +#ifdef CONFIG_NUMA +static int memory_numa_stat_show(struct seq_file *m, void *v) +{ + int i; + struct mem_cgroup *memcg = mem_cgroup_from_seq(m); + + for (i = 0; i < ARRAY_SIZE(memory_stats); i++) { + int nid; + + if (memory_stats[i].idx >= NR_VM_NODE_STAT_ITEMS) + continue; + + seq_printf(m, "%s", memory_stats[i].name); + for_each_node_state(nid, N_MEMORY) { + u64 size; + struct lruvec *lruvec; + + lruvec = mem_cgroup_lruvec(memcg, NODE_DATA(nid)); + size = lruvec_page_state(lruvec, memory_stats[i].idx); + size *= memory_stats[i].ratio; + seq_printf(m, " N%d=%llu", nid, size); + } + seq_putc(m, '\n'); + } + + return 0; +} +#endif + static int memory_oom_group_show(struct seq_file *m, void *v) { struct mem_cgroup *memcg = mem_cgroup_from_seq(m); @@ -6451,6 +6495,12 @@ static struct cftype memory_files[] = { .name = "stat", .seq_show = memory_stat_show, }, +#ifdef CONFIG_NUMA + { + .name = "numa_stat", + .seq_show = memory_numa_stat_show, + }, +#endif { .name = "oom.group", .flags = CFTYPE_NOT_ON_ROOT | CFTYPE_NS_DELEGATABLE, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 086/181] mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge() 2020-10-13 23:46 incoming Andrew Morton ` (84 preceding siblings ...) 2020-10-13 23:52 ` [patch 085/181] mm: memcontrol: add the missing numa_stat interface for cgroup v2 Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 087/181] mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom() Andrew Morton ` (94 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, guro, hannes, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge() Since commit bbec2e15170a ("mm: rename page_counter's count/limit into usage/max"), page_counter_limit() is renamed to page_counter_set_max(). So replace page_counter_limit with page_counter_set_max in comment. Link: https://lkml.kernel.org/r/20200917113629.14382-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Roman Gushchin <guro@fb.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_counter.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/page_counter.c~mm-page_counter-correct-the-obsolete-func-name-in-the-comment-of-page_counter_try_charge +++ a/mm/page_counter.c @@ -109,7 +109,7 @@ bool page_counter_try_charge(struct page * * The atomic_long_add_return() implies a full memory * barrier between incrementing the count and reading - * the limit. When racing with page_counter_limit(), + * the limit. When racing with page_counter_set_max(), * we either see the new limit or the setter sees the * counter has changed and retries. */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 087/181] mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom() 2020-10-13 23:46 incoming Andrew Morton ` (85 preceding siblings ...) 2020-10-13 23:53 ` [patch 086/181] mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge() Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 088/181] mm: memcg/slab: uncharge during kmem_cache_free_bulk() Andrew Morton ` (93 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, hannes, linmiaohe, linux-mm, mhocko, mm-commits, torvalds, vdavydov.dev From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom() Since commit 79dfdaccd1d5 ("memcg: make oom_lock 0 and 1 based rather than counter"), the mem_cgroup_unmark_under_oom() is added and the comment of the mem_cgroup_oom_unlock() is moved here. But this comment make no sense here because mem_cgroup_oom_lock() does not operate on under_oom field. So we reword the comment as this would be helpful. [Thanks Michal Hocko for rewording this comment.] Link: https://lkml.kernel.org/r/20200930095336.21323-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/mm/memcontrol.c~mm-memcontrol-reword-obsolete-comment-of-mem_cgroup_unmark_under_oom +++ a/mm/memcontrol.c @@ -1826,8 +1826,8 @@ static void mem_cgroup_unmark_under_oom( struct mem_cgroup *iter; /* - * When a new child is created while the hierarchy is under oom, - * mem_cgroup_oom_lock() may not be called. Watch for underflow. + * Be careful about under_oom underflows becase a child memcg + * could have been added after mem_cgroup_mark_under_oom. */ spin_lock(&memcg_oom_lock); for_each_mem_cgroup_tree(iter, memcg) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 088/181] mm: memcg/slab: uncharge during kmem_cache_free_bulk() 2020-10-13 23:46 incoming Andrew Morton ` (86 preceding siblings ...) 2020-10-13 23:53 ` [patch 087/181] mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom() Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 089/181] mm/memcg: fix device private memcg accounting Andrew Morton ` (92 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, bharata, cl, guro, hannes, iamjoonsoo.kim, linux-mm, mhocko, mm-commits, rientjes, shakeelb, stable, tj, torvalds, vbabka From: Bharata B Rao <bharata@linux.ibm.com> Subject: mm: memcg/slab: uncharge during kmem_cache_free_bulk() Object cgroup charging is done for all the objects during allocation, but during freeing, uncharging ends up happening for only one object in the case of bulk allocation/freeing. Fix this by having a separate call to uncharge all the objects from kmem_cache_free_bulk() and by modifying memcg_slab_free_hook() to take care of bulk uncharging. Link: https://lkml.kernel.org/r/20201009060423.390479-1-bharata@linux.ibm.com Fixes: 964d4bd370d5 ("mm: memcg/slab: save obj_cgroup for non-root slab objects" Signed-off-by: Bharata B Rao <bharata@linux.ibm.com> Acked-by: Roman Gushchin <guro@fb.com> Cc: Christoph Lameter <cl@linux.com> Cc: David Rientjes <rientjes@google.com> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Shakeel Butt <shakeelb@google.com> Cc: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Tejun Heo <tj@kernel.org> Cc: <stable@vger.kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/slab.c | 2 +- mm/slab.h | 50 +++++++++++++++++++++++++++++++------------------- mm/slub.c | 3 ++- 3 files changed, 34 insertions(+), 21 deletions(-) --- a/mm/slab.c~mm-memcg-slab-uncharge-during-kmem_cache_free_bulk +++ a/mm/slab.c @@ -3438,7 +3438,7 @@ void ___cache_free(struct kmem_cache *ca memset(objp, 0, cachep->object_size); kmemleak_free_recursive(objp, cachep->flags); objp = cache_free_debugcheck(cachep, objp, caller); - memcg_slab_free_hook(cachep, virt_to_head_page(objp), objp); + memcg_slab_free_hook(cachep, &objp, 1); /* * Skip calling cache_free_alien() when the platform is not numa. --- a/mm/slab.h~mm-memcg-slab-uncharge-during-kmem_cache_free_bulk +++ a/mm/slab.h @@ -345,30 +345,42 @@ static inline void memcg_slab_post_alloc obj_cgroup_put(objcg); } -static inline void memcg_slab_free_hook(struct kmem_cache *s, struct page *page, - void *p) +static inline void memcg_slab_free_hook(struct kmem_cache *s_orig, + void **p, int objects) { + struct kmem_cache *s; struct obj_cgroup *objcg; + struct page *page; unsigned int off; + int i; if (!memcg_kmem_enabled()) return; - if (!page_has_obj_cgroups(page)) - return; - - off = obj_to_index(s, page, p); - objcg = page_obj_cgroups(page)[off]; - page_obj_cgroups(page)[off] = NULL; - - if (!objcg) - return; - - obj_cgroup_uncharge(objcg, obj_full_size(s)); - mod_objcg_state(objcg, page_pgdat(page), cache_vmstat_idx(s), - -obj_full_size(s)); - - obj_cgroup_put(objcg); + for (i = 0; i < objects; i++) { + if (unlikely(!p[i])) + continue; + + page = virt_to_head_page(p[i]); + if (!page_has_obj_cgroups(page)) + continue; + + if (!s_orig) + s = page->slab_cache; + else + s = s_orig; + + off = obj_to_index(s, page, p[i]); + objcg = page_obj_cgroups(page)[off]; + if (!objcg) + continue; + + page_obj_cgroups(page)[off] = NULL; + obj_cgroup_uncharge(objcg, obj_full_size(s)); + mod_objcg_state(objcg, page_pgdat(page), cache_vmstat_idx(s), + -obj_full_size(s)); + obj_cgroup_put(objcg); + } } #else /* CONFIG_MEMCG_KMEM */ @@ -406,8 +418,8 @@ static inline void memcg_slab_post_alloc { } -static inline void memcg_slab_free_hook(struct kmem_cache *s, struct page *page, - void *p) +static inline void memcg_slab_free_hook(struct kmem_cache *s, + void **p, int objects) { } #endif /* CONFIG_MEMCG_KMEM */ --- a/mm/slub.c~mm-memcg-slab-uncharge-during-kmem_cache_free_bulk +++ a/mm/slub.c @@ -3095,7 +3095,7 @@ static __always_inline void do_slab_free struct kmem_cache_cpu *c; unsigned long tid; - memcg_slab_free_hook(s, page, head); + memcg_slab_free_hook(s, &head, 1); redo: /* * Determine the currently cpus per cpu slab. @@ -3257,6 +3257,7 @@ void kmem_cache_free_bulk(struct kmem_ca if (WARN_ON(!size)) return; + memcg_slab_free_hook(s, p, size); do { struct detached_freelist df; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 089/181] mm/memcg: fix device private memcg accounting 2020-10-13 23:46 incoming Andrew Morton ` (87 preceding siblings ...) 2020-10-13 23:53 ` [patch 088/181] mm: memcg/slab: uncharge during kmem_cache_free_bulk() Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 090/181] selftests/vm: fix false build success on the second and later attempts Andrew Morton ` (91 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, bsingharora, hannes, ira.weiny, jglisse, linux-mm, mhocko, mm-commits, rcampbell, torvalds, vdavydov.dev From: Ralph Campbell <rcampbell@nvidia.com> Subject: mm/memcg: fix device private memcg accounting The code in mc_handle_swap_pte() checks for non_swap_entry() and returns NULL before checking is_device_private_entry() so device private pages are never handled. Fix this by checking for non_swap_entry() after handling device private swap PTEs. I assume the memory cgroup accounting would be off somehow when moving a process to another memory cgroup. Currently, the device private page is charged like a normal anonymous page when allocated and is uncharged when the page is freed so I think that path is OK. Link: https://lkml.kernel.org/r/20201009215952.2726-1-rcampbell@nvidia.com xFixes: c733a82874a7 ("mm/memcontrol: support MEMORY_DEVICE_PRIVATE") Signed-off-by: Ralph Campbell <rcampbell@nvidia.com> Acked-by: Johannes Weiner <hannes@cmpxchg.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: Vladimir Davydov <vdavydov.dev@gmail.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: Balbir Singh <bsingharora@gmail.com> Cc: Ira Weiny <ira.weiny@intel.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memcontrol.c | 5 ++++- 1 file changed, 4 insertions(+), 1 deletion(-) --- a/mm/memcontrol.c~mm-memcg-fix-device-private-memcg-accounting +++ a/mm/memcontrol.c @@ -5516,7 +5516,7 @@ static struct page *mc_handle_swap_pte(s struct page *page = NULL; swp_entry_t ent = pte_to_swp_entry(ptent); - if (!(mc.flags & MOVE_ANON) || non_swap_entry(ent)) + if (!(mc.flags & MOVE_ANON)) return NULL; /* @@ -5535,6 +5535,9 @@ static struct page *mc_handle_swap_pte(s return page; } + if (non_swap_entry(ent)) + return NULL; + /* * Because lookup_swap_cache() updates some statistics counter, * we call find_get_page() with swapper_space directly. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 090/181] selftests/vm: fix false build success on the second and later attempts 2020-10-13 23:46 incoming Andrew Morton ` (88 preceding siblings ...) 2020-10-13 23:53 ` [patch 089/181] mm/memcg: fix device private memcg accounting Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 091/181] selftests/vm: fix incorrect gcc invocation in some cases Andrew Morton ` (90 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, jgg, jhubbard, linux-mm, mm-commits, shuah, torvalds From: John Hubbard <jhubbard@nvidia.com> Subject: selftests/vm: fix false build success on the second and later attempts Patch series "selftests/vm: fix some minor aggravating factors in the Makefile". This fixes a couple of minor aggravating factors that I ran across while trying to do some changes in selftests/vm. These are simple things, but like most things with GNU Make, it's rarely obvious what's wrong until you understand *the entire Makefile and all of its includes*. So while there is, of course, joy in learning those details, I thought I'd fix these little things, so as to allow others to skip out on the Joy if they so choose. :) First of all, if you have an item (let's choose userfaultfd for an example) that fails to build, you might do this: $ make -j32 # ...you observe a failed item in the threaded output # OK, let's get a closer look $ make # ...but now the build quietly "succeeds". That's what Patch 0001 fixes. Second, if you instead attempt this approach for your closer look (a casual mistake, as it's not supported): $ make userfaultfd # ...userfaultfd fails to link, due to incomplete LDLIBS That's what Patch 0002 fixes. This patch (of 2): If one or more of these selftest fail to build, then after the first failure, subsequent invocations of "make" will make it appear that there are no build failures, after all. That's because the failed build products remain, with up-to-date timestamps, thus tricking Make (and you!) into believing that there's nothing else to build. Fix this by telling Make to delete targets that didn't completely succeed. Link: https://lkml.kernel.org/r/20200915012901.1655280-1-jhubbard@nvidia.com Link: https://lkml.kernel.org/r/20200915012901.1655280-2-jhubbard@nvidia.com Signed-off-by: John Hubbard <jhubbard@nvidia.com> Cc: Shuah Khan <shuah@kernel.org> Cc: Jason Gunthorpe <jgg@ziepe.ca> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/Makefile | 5 +++++ 1 file changed, 5 insertions(+) --- a/tools/testing/selftests/vm/Makefile~selftests-vm-fix-false-build-success-on-the-second-and-later-attempts +++ a/tools/testing/selftests/vm/Makefile @@ -3,6 +3,11 @@ uname_M := $(shell uname -m 2>/dev/null || echo not) MACHINE ?= $(shell echo $(uname_M) | sed -e 's/aarch64.*/arm64/') +# Without this, failed build products remain, with up-to-date timestamps, +# thus tricking Make (and you!) into believing that All Is Well, in subsequent +# make invocations: +.DELETE_ON_ERROR: + CFLAGS = -Wall -I ../../../../usr/include $(EXTRA_CFLAGS) LDLIBS = -lrt TEST_GEN_FILES = compaction_test _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 091/181] selftests/vm: fix incorrect gcc invocation in some cases 2020-10-13 23:46 incoming Andrew Morton ` (89 preceding siblings ...) 2020-10-13 23:53 ` [patch 090/181] selftests/vm: fix false build success on the second and later attempts Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 092/181] mm: account PMD tables like PTE tables Andrew Morton ` (89 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, jgg, jhubbard, linux-mm, mm-commits, shuah, torvalds From: John Hubbard <jhubbard@nvidia.com> Subject: selftests/vm: fix incorrect gcc invocation in some cases Avoid accidental wrong builds, due to built-in rules working just a little bit too well--but not quite as well as required for our situation here. In other words, "make userfaultfd" (for example) is supposed to fail to build at all, because this Makefile only supports either "make" (all), or "make /full/path". However, the built-in rules, if not suppressed, will pick up CFLAGS and the initial LDLIBS (but not the target-specific LDLIBS, because those are only set for the full path target!). This causes it to get pretty far into building things despite using incorrect values such as an *occasionally* incomplete LDLIBS value. Link: https://lkml.kernel.org/r/20200915012901.1655280-3-jhubbard@nvidia.com Signed-off-by: John Hubbard <jhubbard@nvidia.com> Cc: Shuah Khan <shuah@kernel.org> Cc: Jason Gunthorpe <jgg@ziepe.ca> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/Makefile | 12 ++++++++++++ 1 file changed, 12 insertions(+) --- a/tools/testing/selftests/vm/Makefile~selftests-vm-fix-incorrect-gcc-invocation-in-some-cases +++ a/tools/testing/selftests/vm/Makefile @@ -8,6 +8,18 @@ MACHINE ?= $(shell echo $(uname_M) | sed # make invocations: .DELETE_ON_ERROR: +# Avoid accidental wrong builds, due to built-in rules working just a little +# bit too well--but not quite as well as required for our situation here. +# +# In other words, "make userfaultfd" is supposed to fail to build at all, +# because this Makefile only supports either "make" (all), or "make /full/path". +# However, the built-in rules, if not suppressed, will pick up CFLAGS and the +# initial LDLIBS (but not the target-specific LDLIBS, because those are only +# set for the full path target!). This causes it to get pretty far into building +# things despite using incorrect values such as an *occasionally* incomplete +# LDLIBS. +MAKEFLAGS += --no-builtin-rules + CFLAGS = -Wall -I ../../../../usr/include $(EXTRA_CFLAGS) LDLIBS = -lrt TEST_GEN_FILES = compaction_test _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 092/181] mm: account PMD tables like PTE tables 2020-10-13 23:46 incoming Andrew Morton ` (90 preceding siblings ...) 2020-10-13 23:53 ` [patch 091/181] selftests/vm: fix incorrect gcc invocation in some cases Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 093/181] mm/memory.c: fix typo in __do_fault() comment Andrew Morton ` (88 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: abdhalee, akpm, anders.roxell, arnd, christophe.leroy, jcmvbkbc, joro, linux-mm, luto, mm-commits, naresh.kamboju, peterz, rppt, sathnaga, shorne, torvalds, willy From: Matthew Wilcox <willy@infradead.org> Subject: mm: account PMD tables like PTE tables We account the PTE level of the page tables to the process in order to make smarter OOM decisions and help diagnose why memory is fragmented. For these same reasons, we should account pages allocated for PMDs. With larger process address spaces and ASLR, the number of PMDs in use is higher than it used to be so the inaccuracy is starting to matter. [rppt@linux.ibm.com: arm: __pmd_free_tlb(): call page table destructor] Link: https://lkml.kernel.org/r/20200825111303.GB69694@linux.ibm.com Link: http://lkml.kernel.org/r/20200627184642.GF25039@casper.infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Reviewed-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Abdul Haleem <abdhalee@linux.vnet.ibm.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Arnd Bergmann <arnd@arndb.de> Cc: Christophe Leroy <christophe.leroy@csgroup.eu> Cc: Joerg Roedel <joro@8bytes.org> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Satheesh Rajendran <sathnaga@linux.vnet.ibm.com> Cc: Stafford Horne <shorne@gmail.com> Cc: Naresh Kamboju <naresh.kamboju@linaro.org> Cc: Anders Roxell <anders.roxell@linaro.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm/include/asm/tlb.h | 1 + include/linux/mm.h | 24 ++++++++++++++++++++---- 2 files changed, 21 insertions(+), 4 deletions(-) --- a/arch/arm/include/asm/tlb.h~mm-account-pmd-tables-like-pte-tables +++ a/arch/arm/include/asm/tlb.h @@ -59,6 +59,7 @@ __pmd_free_tlb(struct mmu_gather *tlb, p #ifdef CONFIG_ARM_LPAE struct page *page = virt_to_page(pmdp); + pgtable_pmd_page_dtor(page); tlb_remove_table(tlb, page); #endif } --- a/include/linux/mm.h~mm-account-pmd-tables-like-pte-tables +++ a/include/linux/mm.h @@ -2254,7 +2254,7 @@ static inline spinlock_t *pmd_lockptr(st return ptlock_ptr(pmd_to_page(pmd)); } -static inline bool pgtable_pmd_page_ctor(struct page *page) +static inline bool pmd_ptlock_init(struct page *page) { #ifdef CONFIG_TRANSPARENT_HUGEPAGE page->pmd_huge_pte = NULL; @@ -2262,7 +2262,7 @@ static inline bool pgtable_pmd_page_ctor return ptlock_init(page); } -static inline void pgtable_pmd_page_dtor(struct page *page) +static inline void pmd_ptlock_free(struct page *page) { #ifdef CONFIG_TRANSPARENT_HUGEPAGE VM_BUG_ON_PAGE(page->pmd_huge_pte, page); @@ -2279,8 +2279,8 @@ static inline spinlock_t *pmd_lockptr(st return &mm->page_table_lock; } -static inline bool pgtable_pmd_page_ctor(struct page *page) { return true; } -static inline void pgtable_pmd_page_dtor(struct page *page) {} +static inline bool pmd_ptlock_init(struct page *page) { return true; } +static inline void pmd_ptlock_free(struct page *page) {} #define pmd_huge_pte(mm, pmd) ((mm)->pmd_huge_pte) @@ -2293,6 +2293,22 @@ static inline spinlock_t *pmd_lock(struc return ptl; } +static inline bool pgtable_pmd_page_ctor(struct page *page) +{ + if (!pmd_ptlock_init(page)) + return false; + __SetPageTable(page); + inc_zone_page_state(page, NR_PAGETABLE); + return true; +} + +static inline void pgtable_pmd_page_dtor(struct page *page) +{ + pmd_ptlock_free(page); + __ClearPageTable(page); + dec_zone_page_state(page, NR_PAGETABLE); +} + /* * No scalability reason to split PUD locks yet, but follow the same pattern * as the PMD locks to make it easier if we decide to. The VM should not be _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 093/181] mm/memory.c: fix typo in __do_fault() comment 2020-10-13 23:46 incoming Andrew Morton ` (91 preceding siblings ...) 2020-10-13 23:53 ` [patch 092/181] mm: account PMD tables like PTE tables Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 094/181] mm/memory.c: replace vmf->vma with variable vma Andrew Morton ` (87 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, david, linux-mm, mm-commits, torvalds, yanfei.xu From: Yanfei Xu <yanfei.xu@windriver.com> Subject: mm/memory.c: fix typo in __do_fault() comment It's "pte_alloc_one", not "pte_alloc_pne". Let's fix that. Link: http://lkml.kernel.org/r/20200818104339.5310-1-yanfei.xu@windriver.com Signed-off-by: Yanfei Xu <yanfei.xu@windriver.com> Reviewed-by: David Hildenbrand <david@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/memory.c~mm-memory-fix-typo-in-__do_fault-comment +++ a/mm/memory.c @@ -3589,7 +3589,7 @@ static vm_fault_t __do_fault(struct vm_f * unlock_page(A) * lock_page(B) * lock_page(B) - * pte_alloc_pne + * pte_alloc_one * shrink_page_list * wait_on_page_writeback(A) * SetPageWriteback(B) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 094/181] mm/memory.c: replace vmf->vma with variable vma 2020-10-13 23:46 incoming Andrew Morton ` (92 preceding siblings ...) 2020-10-13 23:53 ` [patch 093/181] mm/memory.c: fix typo in __do_fault() comment Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 095/181] mm/mmap: rename __vma_unlink_common() to __vma_unlink() Andrew Morton ` (86 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, torvalds, willy, yanfei.xu From: Yanfei Xu <yanfei.xu@windriver.com> Subject: mm/memory.c: replace vmf->vma with variable vma The code has declared a vma_struct named vma which is assigned a value of vmf->vma. Thus, use variable vma directly here. Link: http://lkml.kernel.org/r/20200818084607.37616-1-yanfei.xu@windriver.com Signed-off-by: Yanfei Xu <yanfei.xu@windriver.com> Reviewed-by: Matthew Wilcox (Oracle) <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/memory.c~mm-memoryc-replace-vmf-vma-with-variable-vma +++ a/mm/memory.c @@ -3597,7 +3597,7 @@ static vm_fault_t __do_fault(struct vm_f * # flush A, B to clear the writeback */ if (pmd_none(*vmf->pmd) && !vmf->prealloc_pte) { - vmf->prealloc_pte = pte_alloc_one(vmf->vma->vm_mm); + vmf->prealloc_pte = pte_alloc_one(vma->vm_mm); if (!vmf->prealloc_pte) return VM_FAULT_OOM; smp_wmb(); /* See comment in __pte_alloc() */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 095/181] mm/mmap: rename __vma_unlink_common() to __vma_unlink() 2020-10-13 23:46 incoming Andrew Morton ` (93 preceding siblings ...) 2020-10-13 23:53 ` [patch 094/181] mm/memory.c: replace vmf->vma with variable vma Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 096/181] mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase() Andrew Morton ` (85 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, richard.weiyang, torvalds From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/mmap: rename __vma_unlink_common() to __vma_unlink() __vma_unlink_common() and __vma_unlink() are counterparts. Since there is no function named __vma_unlink(), let's rename __vma_unlink_common() to __vma_unlink() to make the code more self-explanatory and easy for audience to understand. Otherwise we may expect there are several variants of vma_unlink() and __vma_unlink_common() is used by them. Link: https://lkml.kernel.org/r/20200809232057.23477-1-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mmap.c | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) --- a/mm/mmap.c~mm-mmap-rename-__vma_unlink_common-to-__vma_unlink +++ a/mm/mmap.c @@ -677,7 +677,7 @@ static void __insert_vm_struct(struct mm mm->map_count++; } -static __always_inline void __vma_unlink_common(struct mm_struct *mm, +static __always_inline void __vma_unlink(struct mm_struct *mm, struct vm_area_struct *vma, struct vm_area_struct *ignore) { @@ -859,7 +859,7 @@ again: * us to remove next before dropping the locks. */ if (remove_next != 3) - __vma_unlink_common(mm, next, next); + __vma_unlink(mm, next, next); else /* * vma is not before next if they've been @@ -870,7 +870,7 @@ again: * "next" (which is stored in post-swap() * "vma"). */ - __vma_unlink_common(mm, next, vma); + __vma_unlink(mm, next, vma); if (file) __remove_shared_vm_struct(next, file, mapping); } else if (insert) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 096/181] mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase() 2020-10-13 23:46 incoming Andrew Morton ` (94 preceding siblings ...) 2020-10-13 23:53 ` [patch 095/181] mm/mmap: rename __vma_unlink_common() to __vma_unlink() Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 097/181] mmap locking API: add mmap_lock_is_contended() Andrew Morton ` (84 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, richard.weiyang, torvalds From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase() These two functions share the same logic except ignore a different vma. Let's reuse the code. Link: https://lkml.kernel.org/r/20200809232057.23477-2-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mmap.c | 16 +++++++--------- 1 file changed, 7 insertions(+), 9 deletions(-) --- a/mm/mmap.c~mm-mmap-leverage-vma_rb_erase_ignore-to-implement-vma_rb_erase +++ a/mm/mmap.c @@ -474,8 +474,12 @@ static __always_inline void vma_rb_erase { /* * All rb_subtree_gap values must be consistent prior to erase, - * with the possible exception of the "next" vma being erased if - * next->vm_start was reduced. + * with the possible exception of + * + * a. the "next" vma being erased if next->vm_start was reduced in + * __vma_adjust() -> __vma_unlink() + * b. the vma being erased in detach_vmas_to_be_unmapped() -> + * vma_rb_erase() */ validate_mm_rb(root, ignore); @@ -485,13 +489,7 @@ static __always_inline void vma_rb_erase static __always_inline void vma_rb_erase(struct vm_area_struct *vma, struct rb_root *root) { - /* - * All rb_subtree_gap values must be consistent prior to erase, - * with the possible exception of the vma being erased. - */ - validate_mm_rb(root, vma); - - __vma_rb_erase(vma, root); + vma_rb_erase_ignore(vma, root, vma); } /* _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 097/181] mmap locking API: add mmap_lock_is_contended() 2020-10-13 23:46 incoming Andrew Morton ` (95 preceding siblings ...) 2020-10-13 23:53 ` [patch 096/181] mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase() Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 098/181] mm: smaps*: extend smap_gather_stats to support specified beginning Andrew Morton ` (83 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: adobriyan, akpm, chinwen.chang, daniel.kiss, daniel.m.jordan, dbueso, jgg, jimmyassarsson, ldufour, linux-mm, matthias.bgg, mm-commits, songliubraving, steven.price, torvalds, vbabka, walken, willy, ying.huang From: Chinwen Chang <chinwen.chang@mediatek.com> Subject: mmap locking API: add mmap_lock_is_contended() Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4. Recently, we have observed some janky issues caused by unpleasantly long contention on mmap_lock which is held by smaps_rollup when probing large processes. To address the problem, we let smaps_rollup detect if anyone wants to acquire mmap_lock for write attempts. If yes, just release the lock temporarily to ease the contention. smaps_rollup is a procfs interface which allows users to summarize the process's memory usage without the overhead of seq_* calls. Android uses it to sample the memory usage of various processes to balance its memory pool sizes. If no one wants to take the lock for write requests, smaps_rollup with this patch will behave like the original one. Although there are on-going mmap_lock optimizations like range-based locks, the lock applied to smaps_rollup would be the coarse one, which is hard to avoid the occurrence of aforementioned issues. So the detection and temporary release for write attempts on mmap_lock in smaps_rollup is still necessary. This patch (of 3): Add new API to query if someone wants to acquire mmap_lock for write attempts. Using this instead of rwsem_is_contended makes it more tolerant of future changes to the lock type. Link: http://lkml.kernel.org/r/1597715898-3854-1-git-send-email-chinwen.chang@mediatek.com Link: http://lkml.kernel.org/r/1597715898-3854-2-git-send-email-chinwen.chang@mediatek.com Signed-off-by: Chinwen Chang <chinwen.chang@mediatek.com> Reviewed-by: Steven Price <steven.price@arm.com> Acked-by: Michel Lespinasse <walken@google.com> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Daniel Jordan <daniel.m.jordan@oracle.com> Cc: Daniel Kiss <daniel.kiss@arm.com> Cc: Davidlohr Bueso <dbueso@suse.de> Cc: Huang Ying <ying.huang@intel.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Jimmy Assarsson <jimmyassarsson@gmail.com> Cc: Laurent Dufour <ldufour@linux.ibm.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Matthias Brugger <matthias.bgg@gmail.com> Cc: Song Liu <songliubraving@fb.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/mmap_lock.h | 5 +++++ 1 file changed, 5 insertions(+) --- a/include/linux/mmap_lock.h~mmap-locking-api-add-mmap_lock_is_contended +++ a/include/linux/mmap_lock.h @@ -87,4 +87,9 @@ static inline void mmap_assert_write_loc VM_BUG_ON_MM(!rwsem_is_locked(&mm->mmap_lock), mm); } +static inline int mmap_lock_is_contended(struct mm_struct *mm) +{ + return rwsem_is_contended(&mm->mmap_lock); +} + #endif /* _LINUX_MMAP_LOCK_H */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 098/181] mm: smaps*: extend smap_gather_stats to support specified beginning 2020-10-13 23:46 incoming Andrew Morton ` (96 preceding siblings ...) 2020-10-13 23:53 ` [patch 097/181] mmap locking API: add mmap_lock_is_contended() Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 099/181] mm: proc: smaps_rollup: do not stall write attempts on mmap_lock Andrew Morton ` (82 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: adobriyan, akpm, chinwen.chang, daniel.kiss, daniel.m.jordan, dbueso, jgg, jimmyassarsson, ldufour, linux-mm, matthias.bgg, mm-commits, songliubraving, steven.price, torvalds, vbabka, walken, willy, ying.huang From: Chinwen Chang <chinwen.chang@mediatek.com> Subject: mm: smaps*: extend smap_gather_stats to support specified beginning Extend smap_gather_stats to support indicated beginning address at which it should start gathering. To achieve the goal, we add a new parameter @start assigned by the caller and try to refactor it for simplicity. If @start is 0, it will use the range of @vma for gathering. Link: http://lkml.kernel.org/r/1597715898-3854-3-git-send-email-chinwen.chang@mediatek.com Signed-off-by: Chinwen Chang <chinwen.chang@mediatek.com> Reviewed-by: Steven Price <steven.price@arm.com> Cc: Michel Lespinasse <walken@google.com> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: Daniel Jordan <daniel.m.jordan@oracle.com> Cc: Daniel Kiss <daniel.kiss@arm.com> Cc: Davidlohr Bueso <dbueso@suse.de> Cc: Huang Ying <ying.huang@intel.com> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Jimmy Assarsson <jimmyassarsson@gmail.com> Cc: Laurent Dufour <ldufour@linux.ibm.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Matthias Brugger <matthias.bgg@gmail.com> Cc: Song Liu <songliubraving@fb.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/proc/task_mmu.c | 30 ++++++++++++++++++++++-------- 1 file changed, 22 insertions(+), 8 deletions(-) --- a/fs/proc/task_mmu.c~mm-smaps-extend-smap_gather_stats-to-support-specified-beginning +++ a/fs/proc/task_mmu.c @@ -721,9 +721,21 @@ static const struct mm_walk_ops smaps_sh .pte_hole = smaps_pte_hole, }; +/* + * Gather mem stats from @vma with the indicated beginning + * address @start, and keep them in @mss. + * + * Use vm_start of @vma as the beginning address if @start is 0. + */ static void smap_gather_stats(struct vm_area_struct *vma, - struct mem_size_stats *mss) + struct mem_size_stats *mss, unsigned long start) { + const struct mm_walk_ops *ops = &smaps_walk_ops; + + /* Invalid start */ + if (start >= vma->vm_end) + return; + #ifdef CONFIG_SHMEM /* In case of smaps_rollup, reset the value from previous vma */ mss->check_shmem_swap = false; @@ -740,18 +752,20 @@ static void smap_gather_stats(struct vm_ */ unsigned long shmem_swapped = shmem_swap_usage(vma); - if (!shmem_swapped || (vma->vm_flags & VM_SHARED) || - !(vma->vm_flags & VM_WRITE)) { + if (!start && (!shmem_swapped || (vma->vm_flags & VM_SHARED) || + !(vma->vm_flags & VM_WRITE))) { mss->swap += shmem_swapped; } else { mss->check_shmem_swap = true; - walk_page_vma(vma, &smaps_shmem_walk_ops, mss); - return; + ops = &smaps_shmem_walk_ops; } } #endif /* mmap_lock is held in m_start */ - walk_page_vma(vma, &smaps_walk_ops, mss); + if (!start) + walk_page_vma(vma, ops, mss); + else + walk_page_range(vma->vm_mm, start, vma->vm_end, ops, mss); } #define SEQ_PUT_DEC(str, val) \ @@ -803,7 +817,7 @@ static int show_smap(struct seq_file *m, memset(&mss, 0, sizeof(mss)); - smap_gather_stats(vma, &mss); + smap_gather_stats(vma, &mss, 0); show_map_vma(m, vma); @@ -852,7 +866,7 @@ static int show_smaps_rollup(struct seq_ hold_task_mempolicy(priv); for (vma = priv->mm->mmap; vma; vma = vma->vm_next) { - smap_gather_stats(vma, &mss); + smap_gather_stats(vma, &mss, 0); last_vma_end = vma->vm_end; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 099/181] mm: proc: smaps_rollup: do not stall write attempts on mmap_lock 2020-10-13 23:46 incoming Andrew Morton ` (97 preceding siblings ...) 2020-10-13 23:53 ` [patch 098/181] mm: smaps*: extend smap_gather_stats to support specified beginning Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 100/181] mm: move PageDoubleMap bit Andrew Morton ` (81 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: adobriyan, akpm, chinwen.chang, daniel.kiss, daniel.m.jordan, dbueso, jgg, jimmyassarsson, ldufour, linux-mm, matthias.bgg, mm-commits, songliubraving, steven.price, torvalds, vbabka, walken, willy, ying.huang From: Chinwen Chang <chinwen.chang@mediatek.com> Subject: mm: proc: smaps_rollup: do not stall write attempts on mmap_lock smaps_rollup will try to grab mmap_lock and go through the whole vma list until it finishes the iterating. When encountering large processes, the mmap_lock will be held for a longer time, which may block other write requests like mmap and munmap from progressing smoothly. There are upcoming mmap_lock optimizations like range-based locks, but the lock applied to smaps_rollup would be the coarse type, which doesn't avoid the occurrence of unpleasant contention. To solve aforementioned issue, we add a check which detects whether anyone wants to grab mmap_lock for write attempts. Link: http://lkml.kernel.org/r/1597715898-3854-4-git-send-email-chinwen.chang@mediatek.com Signed-off-by: Chinwen Chang <chinwen.chang@mediatek.com> Cc: Steven Price <steven.price@arm.com> Cc: Michel Lespinasse <walken@google.com> Cc: Matthias Brugger <matthias.bgg@gmail.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Daniel Jordan <daniel.m.jordan@oracle.com> Cc: Davidlohr Bueso <dbueso@suse.de> Cc: Chinwen Chang <chinwen.chang@mediatek.com> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: "Matthew Wilcox (Oracle)" <willy@infradead.org> Cc: Jason Gunthorpe <jgg@ziepe.ca> Cc: Song Liu <songliubraving@fb.com> Cc: Jimmy Assarsson <jimmyassarsson@gmail.com> Cc: Huang Ying <ying.huang@intel.com> Cc: Daniel Kiss <daniel.kiss@arm.com> Cc: Laurent Dufour <ldufour@linux.ibm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/proc/task_mmu.c | 66 ++++++++++++++++++++++++++++++++++++++++++- 1 file changed, 65 insertions(+), 1 deletion(-) --- a/fs/proc/task_mmu.c~mm-proc-smaps_rollup-do-not-stall-write-attempts-on-mmap_lock +++ a/fs/proc/task_mmu.c @@ -865,9 +865,73 @@ static int show_smaps_rollup(struct seq_ hold_task_mempolicy(priv); - for (vma = priv->mm->mmap; vma; vma = vma->vm_next) { + for (vma = priv->mm->mmap; vma;) { smap_gather_stats(vma, &mss, 0); last_vma_end = vma->vm_end; + + /* + * Release mmap_lock temporarily if someone wants to + * access it for write request. + */ + if (mmap_lock_is_contended(mm)) { + mmap_read_unlock(mm); + ret = mmap_read_lock_killable(mm); + if (ret) { + release_task_mempolicy(priv); + goto out_put_mm; + } + + /* + * After dropping the lock, there are four cases to + * consider. See the following example for explanation. + * + * +------+------+-----------+ + * | VMA1 | VMA2 | VMA3 | + * +------+------+-----------+ + * | | | | + * 4k 8k 16k 400k + * + * Suppose we drop the lock after reading VMA2 due to + * contention, then we get: + * + * last_vma_end = 16k + * + * 1) VMA2 is freed, but VMA3 exists: + * + * find_vma(mm, 16k - 1) will return VMA3. + * In this case, just continue from VMA3. + * + * 2) VMA2 still exists: + * + * find_vma(mm, 16k - 1) will return VMA2. + * Iterate the loop like the original one. + * + * 3) No more VMAs can be found: + * + * find_vma(mm, 16k - 1) will return NULL. + * No more things to do, just break. + * + * 4) (last_vma_end - 1) is the middle of a vma (VMA'): + * + * find_vma(mm, 16k - 1) will return VMA' whose range + * contains last_vma_end. + * Iterate VMA' from last_vma_end. + */ + vma = find_vma(mm, last_vma_end - 1); + /* Case 3 above */ + if (!vma) + break; + + /* Case 1 above */ + if (vma->vm_start >= last_vma_end) + continue; + + /* Case 4 above */ + if (vma->vm_end > last_vma_end) + smap_gather_stats(vma, &mss, last_vma_end); + } + /* Case 2 above */ + vma = vma->vm_next; } show_vma_header_prefix(m, priv->mm->mmap->vm_start, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 100/181] mm: move PageDoubleMap bit 2020-10-13 23:46 incoming Andrew Morton ` (98 preceding siblings ...) 2020-10-13 23:53 ` [patch 099/181] mm: proc: smaps_rollup: do not stall write attempts on mmap_lock Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 101/181] mm: simplify PageDoubleMap with PF_SECOND policy Andrew Morton ` (80 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, torvalds, willy, ziy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: move PageDoubleMap bit Patch series "Fix PageDoubleMap". This is a purely theoretical problem for now as none of the filesystems which use PG_private_2 (ie PG_fscache) are being converted at this time, but it's confusing to leave it like this. This patch (of 2): PG_private_2 is defined as being PF_ANY (applicable to tail pages as well as regular & head pages). That means that the first tail page of a double-map page will appear to have Private2 set. Use the Workingset bit instead which is defined as PF_HEAD so any attempt to access the Workingset bit on a tail page will redirect to the head page's Workingset bit. Link: https://lkml.kernel.org/r/20200629151933.15671-1-willy@infradead.org Link: https://lkml.kernel.org/r/20200629151933.15671-2-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Reviewed-by: Zi Yan <ziy@nvidia.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/page-flags.h | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/include/linux/page-flags.h~mm-move-pagedoublemap-bit +++ a/include/linux/page-flags.h @@ -167,7 +167,7 @@ enum pageflags { PG_slob_free = PG_private, /* Compound pages. Stored in first tail page's flags */ - PG_double_map = PG_private_2, + PG_double_map = PG_workingset, /* non-lru isolated movable page */ PG_isolated = PG_reclaim, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 101/181] mm: simplify PageDoubleMap with PF_SECOND policy 2020-10-13 23:46 incoming Andrew Morton ` (99 preceding siblings ...) 2020-10-13 23:53 ` [patch 100/181] mm: move PageDoubleMap bit Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:53 ` [patch 102/181] mm/mmap: leave adjust_next as virtual address instead of page frame number Andrew Morton ` (79 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, torvalds, willy, ziy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm: simplify PageDoubleMap with PF_SECOND policy Introduce the new page policy of PF_SECOND which lets us use the normal pageflags generation machinery to create the various DoubleMap manipulation functions. Link: https://lkml.kernel.org/r/20200629151933.15671-3-willy@infradead.org Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Reviewed-by: Zi Yan <ziy@nvidia.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/page-flags.h | 40 ++++++++--------------------------- 1 file changed, 10 insertions(+), 30 deletions(-) --- a/include/linux/page-flags.h~mm-simplify-pagedoublemap-with-pf_second-policy +++ a/include/linux/page-flags.h @@ -235,6 +235,9 @@ static inline void page_init_poison(stru * * PF_NO_COMPOUND: * the page flag is not relevant for compound pages. + * + * PF_SECOND: + * the page flag is stored in the first tail page. */ #define PF_POISONED_CHECK(page) ({ \ VM_BUG_ON_PGFLAGS(PagePoisoned(page), page); \ @@ -250,6 +253,9 @@ static inline void page_init_poison(stru #define PF_NO_COMPOUND(page, enforce) ({ \ VM_BUG_ON_PGFLAGS(enforce && PageCompound(page), page); \ PF_POISONED_CHECK(page); }) +#define PF_SECOND(page, enforce) ({ \ + VM_BUG_ON_PGFLAGS(!PageHead(page), page); \ + PF_POISONED_CHECK(&page[1]); }) /* * Macros to create function definitions for page flags @@ -688,42 +694,15 @@ static inline int PageTransTail(struct p * * See also __split_huge_pmd_locked() and page_remove_anon_compound_rmap(). */ -static inline int PageDoubleMap(struct page *page) -{ - return PageHead(page) && test_bit(PG_double_map, &page[1].flags); -} - -static inline void SetPageDoubleMap(struct page *page) -{ - VM_BUG_ON_PAGE(!PageHead(page), page); - set_bit(PG_double_map, &page[1].flags); -} - -static inline void ClearPageDoubleMap(struct page *page) -{ - VM_BUG_ON_PAGE(!PageHead(page), page); - clear_bit(PG_double_map, &page[1].flags); -} -static inline int TestSetPageDoubleMap(struct page *page) -{ - VM_BUG_ON_PAGE(!PageHead(page), page); - return test_and_set_bit(PG_double_map, &page[1].flags); -} - -static inline int TestClearPageDoubleMap(struct page *page) -{ - VM_BUG_ON_PAGE(!PageHead(page), page); - return test_and_clear_bit(PG_double_map, &page[1].flags); -} - +PAGEFLAG(DoubleMap, double_map, PF_SECOND) + TESTSCFLAG(DoubleMap, double_map, PF_SECOND) #else TESTPAGEFLAG_FALSE(TransHuge) TESTPAGEFLAG_FALSE(TransCompound) TESTPAGEFLAG_FALSE(TransCompoundMap) TESTPAGEFLAG_FALSE(TransTail) PAGEFLAG_FALSE(DoubleMap) - TESTSETFLAG_FALSE(DoubleMap) - TESTCLEARFLAG_FALSE(DoubleMap) + TESTSCFLAG_FALSE(DoubleMap) #endif /* @@ -888,6 +867,7 @@ static inline int page_has_private(struc #undef PF_ONLY_HEAD #undef PF_NO_TAIL #undef PF_NO_COMPOUND +#undef PF_SECOND #endif /* !__GENERATING_BOUNDS_H */ #endif /* PAGE_FLAGS_H */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 102/181] mm/mmap: leave adjust_next as virtual address instead of page frame number 2020-10-13 23:46 incoming Andrew Morton ` (100 preceding siblings ...) 2020-10-13 23:53 ` [patch 101/181] mm: simplify PageDoubleMap with PF_SECOND policy Andrew Morton @ 2020-10-13 23:53 ` Andrew Morton 2020-10-13 23:54 ` [patch 103/181] mm/memory.c: fix spello of "function" Andrew Morton ` (78 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:53 UTC (permalink / raw) To: akpm, linux-mm, mike.kravetz, mm-commits, richard.weiyang, torvalds, vbabka From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/mmap: leave adjust_next as virtual address instead of page frame number Instead of converting adjust_next between bytes and pages number, let's just store the virtual address into adjust_next. Also, this patch fixes one typo in the comment of vma_adjust_trans_huge(). [vbabka@suse.cz: changelog tweak] Link: http://lkml.kernel.org/r/20200828081031.11306-1-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Acked-by: Vlastimil Babka <vbabka@suse.cz> Cc: Mike Kravetz <mike.kravetz@oracle.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/huge_memory.c | 4 ++-- mm/mmap.c | 8 ++++---- 2 files changed, 6 insertions(+), 6 deletions(-) --- a/mm/huge_memory.c~mm-mmap-leave-adjust_next-as-virtual-address-instead-of-page-frame-number +++ a/mm/huge_memory.c @@ -2306,13 +2306,13 @@ void vma_adjust_trans_huge(struct vm_are /* * If we're also updating the vma->vm_next->vm_start, if the new - * vm_next->vm_start isn't page aligned and it could previously + * vm_next->vm_start isn't hpage aligned and it could previously * contain an hugepage: check if we need to split an huge pmd. */ if (adjust_next > 0) { struct vm_area_struct *next = vma->vm_next; unsigned long nstart = next->vm_start; - nstart += adjust_next << PAGE_SHIFT; + nstart += adjust_next; if (nstart & ~HPAGE_PMD_MASK && (nstart & HPAGE_PMD_MASK) >= next->vm_start && (nstart & HPAGE_PMD_MASK) + HPAGE_PMD_SIZE <= next->vm_end) --- a/mm/mmap.c~mm-mmap-leave-adjust_next-as-virtual-address-instead-of-page-frame-number +++ a/mm/mmap.c @@ -758,7 +758,7 @@ int __vma_adjust(struct vm_area_struct * * vma expands, overlapping part of the next: * mprotect case 5 shifting the boundary up. */ - adjust_next = (end - next->vm_start) >> PAGE_SHIFT; + adjust_next = (end - next->vm_start); exporter = next; importer = vma; VM_WARN_ON(expand != importer); @@ -768,7 +768,7 @@ int __vma_adjust(struct vm_area_struct * * split_vma inserting another: so it must be * mprotect case 4 shifting the boundary down. */ - adjust_next = -((vma->vm_end - end) >> PAGE_SHIFT); + adjust_next = -(vma->vm_end - end); exporter = vma; importer = next; VM_WARN_ON(expand != importer); @@ -840,8 +840,8 @@ again: } vma->vm_pgoff = pgoff; if (adjust_next) { - next->vm_start += adjust_next << PAGE_SHIFT; - next->vm_pgoff += adjust_next; + next->vm_start += adjust_next; + next->vm_pgoff += adjust_next >> PAGE_SHIFT; } if (root) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 103/181] mm/memory.c: fix spello of "function" 2020-10-13 23:46 incoming Andrew Morton ` (101 preceding siblings ...) 2020-10-13 23:53 ` [patch 102/181] mm/mmap: leave adjust_next as virtual address instead of page frame number Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 104/181] mm/mmap: not necessary to check mapping separately Andrew Morton ` (77 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, rdunlap, torvalds From: Randy Dunlap <rdunlap@infradead.org> Subject: mm/memory.c: fix spello of "function" Fix typo/spello of "function". Link: https://lkml.kernel.org/r/e7bf180e-c558-b1d5-9a15-6d9708823c9c@infradead.org Signed-off-by: Randy Dunlap <rdunlap@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/memory.c~mm-memoryc-fix-spello-of-function +++ a/mm/memory.c @@ -3764,7 +3764,7 @@ static vm_fault_t do_set_pmd(struct vm_f /** * alloc_set_pte - setup new PTE entry for given page and add reverse page - * mapping. If needed, the fucntion allocates page table or use pre-allocated. + * mapping. If needed, the function allocates page table or use pre-allocated. * * @vmf: fault environment * @page: page to map _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 104/181] mm/mmap: not necessary to check mapping separately 2020-10-13 23:46 incoming Andrew Morton ` (102 preceding siblings ...) 2020-10-13 23:54 ` [patch 103/181] mm/memory.c: fix spello of "function" Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 105/181] mm/mmap: check on file instead of the rb_root_cached of its address_space Andrew Morton ` (76 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, richard.weiyang, torvalds From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/mmap: not necessary to check mapping separately *root* with type of struct rb_root_cached is an element of *mapping* with type of struct address_space. This implies when we have a valid *root* it must be a part of valid *mapping*. So we can merge these two checks together to make the code more easy to read and to save some cpu cycles. Link: https://lkml.kernel.org/r/20200913133631.37781-1-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mmap.c | 3 +-- 1 file changed, 1 insertion(+), 2 deletions(-) --- a/mm/mmap.c~mm-mmap-not-necessary-to-check-mapping-separately +++ a/mm/mmap.c @@ -895,10 +895,9 @@ again: anon_vma_interval_tree_post_update_vma(next); anon_vma_unlock_write(anon_vma); } - if (mapping) - i_mmap_unlock_write(mapping); if (root) { + i_mmap_unlock_write(mapping); uprobe_mmap(vma); if (adjust_next) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 105/181] mm/mmap: check on file instead of the rb_root_cached of its address_space 2020-10-13 23:46 incoming Andrew Morton ` (103 preceding siblings ...) 2020-10-13 23:54 ` [patch 104/181] mm/mmap: not necessary to check mapping separately Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 106/181] mm: use helper function mapping_allow_writable() Andrew Morton ` (75 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, richard.weiyang, torvalds From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/mmap: check on file instead of the rb_root_cached of its address_space In __vma_adjust(), we do the check on *root* to decide whether to adjust the address_space. It seems to be more meaningful to do the check on *file* itself. This means we are adjusting some data because it is a file backed vma. Since we seem to assume the address_space is valid if it is a file backed vma, let's just replace *root* with *file* here. Link: https://lkml.kernel.org/r/20200913133631.37781-2-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mmap.c | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) --- a/mm/mmap.c~mm-mmap-check-on-file-instead-of-the-rb_root_cached-of-its-address_space +++ a/mm/mmap.c @@ -823,7 +823,7 @@ again: anon_vma_interval_tree_pre_update_vma(next); } - if (root) { + if (file) { flush_dcache_mmap_lock(mapping); vma_interval_tree_remove(vma, root); if (adjust_next) @@ -844,7 +844,7 @@ again: next->vm_pgoff += adjust_next >> PAGE_SHIFT; } - if (root) { + if (file) { if (adjust_next) vma_interval_tree_insert(next, root); vma_interval_tree_insert(vma, root); @@ -896,7 +896,7 @@ again: anon_vma_unlock_write(anon_vma); } - if (root) { + if (file) { i_mmap_unlock_write(mapping); uprobe_mmap(vma); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 106/181] mm: use helper function mapping_allow_writable() 2020-10-13 23:46 incoming Andrew Morton ` (104 preceding siblings ...) 2020-10-13 23:54 ` [patch 105/181] mm/mmap: check on file instead of the rb_root_cached of its address_space Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 107/181] mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct() Andrew Morton ` (74 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, areber, christian.brauner, christian, cyphar, ebiederm, linmiaohe, linux-mm, mingo, mm-commits, peterz, shakeelb, surenb, tglx, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm: use helper function mapping_allow_writable() Commit 4bb5f5d9395b ("mm: allow drivers to prevent new writable mappings") changed i_mmap_writable from unsigned int to atomic_t and add the helper function mapping_allow_writable() to atomic_inc i_mmap_writable. But it forgot to use this helper function in dup_mmap() and __vma_link_file(). Link: https://lkml.kernel.org/r/20200917112736.7789-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Cc: Christian Brauner <christian.brauner@ubuntu.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Peter Zijlstra <peterz@infradead.org> Cc: "Eric W. Biederman" <ebiederm@xmission.com> Cc: Christian Kellner <christian@kellner.me> Cc: Suren Baghdasaryan <surenb@google.com> Cc: Adrian Reber <areber@redhat.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Aleksa Sarai <cyphar@cyphar.com> Cc: Thomas Gleixner <tglx@linutronix.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- kernel/fork.c | 2 +- mm/mmap.c | 2 +- 2 files changed, 2 insertions(+), 2 deletions(-) --- a/kernel/fork.c~mm-use-helper-function-mapping_allow_writable +++ a/kernel/fork.c @@ -559,7 +559,7 @@ static __latent_entropy int dup_mmap(str atomic_dec(&inode->i_writecount); i_mmap_lock_write(mapping); if (tmp->vm_flags & VM_SHARED) - atomic_inc(&mapping->i_mmap_writable); + mapping_allow_writable(mapping); flush_dcache_mmap_lock(mapping); /* insert tmp into the share list, just after mpnt */ vma_interval_tree_insert_after(tmp, mpnt, --- a/mm/mmap.c~mm-use-helper-function-mapping_allow_writable +++ a/mm/mmap.c @@ -621,7 +621,7 @@ static void __vma_link_file(struct vm_ar if (vma->vm_flags & VM_DENYWRITE) atomic_dec(&file_inode(file)->i_writecount); if (vma->vm_flags & VM_SHARED) - atomic_inc(&mapping->i_mmap_writable); + mapping_allow_writable(mapping); flush_dcache_mmap_lock(mapping); vma_interval_tree_insert(vma, &mapping->i_mmap); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 107/181] mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct() 2020-10-13 23:46 incoming Andrew Morton ` (105 preceding siblings ...) 2020-10-13 23:54 ` [patch 106/181] mm: use helper function mapping_allow_writable() Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 108/181] mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct() Andrew Morton ` (73 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct() In commit 1da177e4c3f4 ("Linux-2.6.12-rc2"), the helper allow_write_access came with the atomic_inc operation of the i_writecount field in the func __remove_shared_vm_struct(). But it forgot to use this helper function. Link: https://lkml.kernel.org/r/20200921115814.39680-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mmap.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/mmap.c~mm-mmap-use-helper-function-allow_write_access-in-__remove_shared_vm_struct +++ a/mm/mmap.c @@ -143,7 +143,7 @@ static void __remove_shared_vm_struct(st struct file *file, struct address_space *mapping) { if (vma->vm_flags & VM_DENYWRITE) - atomic_inc(&file_inode(file)->i_writecount); + allow_write_access(file); if (vma->vm_flags & VM_SHARED) mapping_unmap_writable(mapping); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 108/181] mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct() 2020-10-13 23:46 incoming Andrew Morton ` (106 preceding siblings ...) 2020-10-13 23:54 ` [patch 107/181] mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct() Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 109/181] mm: remove src/dst mm parameter in copy_page_range() Andrew Morton ` (72 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, liao.pingfang, linux-mm, mm-commits, torvalds, wang.yi59 From: Liao Pingfang <liao.pingfang@zte.com.cn> Subject: mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct() Replace do_brk with do_brk_flags in comment of insert_vm_struct(), since do_brk was removed in following commit. Link: https://lkml.kernel.org/r/1600650778-43230-1-git-send-email-wang.yi59@zte.com.cn Fixes: bb177a732c4369 ("mm: do not bug_on on incorrect length in __mm_populate()") Signed-off-by: Liao Pingfang <liao.pingfang@zte.com.cn> Signed-off-by: Yi Wang <wang.yi59@zte.com.cn> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mmap.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/mmap.c~mm-mmapc-replace-do_brk-with-do_brk_flags-in-comment-of-insert_vm_struct +++ a/mm/mmap.c @@ -3233,7 +3233,7 @@ int insert_vm_struct(struct mm_struct *m * By setting it to reflect the virtual start address of the * vma, merges and splits can happen in a seamless way, just * using the existing file pgoff checks and manipulations. - * Similarly in do_mmap and in do_brk. + * Similarly in do_mmap and in do_brk_flags. */ if (vma_is_anonymous(vma)) { BUG_ON(vma->anon_vma); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 109/181] mm: remove src/dst mm parameter in copy_page_range() 2020-10-13 23:46 incoming Andrew Morton ` (107 preceding siblings ...) 2020-10-13 23:54 ` [patch 108/181] mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct() Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 110/181] include/linux/huge_mm.h: remove mincore_huge_pmd declaration Andrew Morton ` (71 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, jgg, kirill.shutemov, kirill, linux-mm, mm-commits, peterx, torvalds From: Peter Xu <peterx@redhat.com> Subject: mm: remove src/dst mm parameter in copy_page_range() Both of the mm pointers are not needed after commit 7a4830c380f3 ("mm/fork: Pass new vma pointer into copy_page_range()"). Jason Gunthorpe also reported that the ordering of copy_page_range() is odd. Since working at it, reorder the parameters to be logical, by (1) always put the dst_* fields to be before src_* fields, and (2) keep the same type of parameters together. [peterx@redhat.com: further reorder some parameters and line format, per Jason] Link: https://lkml.kernel.org/r/20201002192647.7161-1-peterx@redhat.com [peterx@redhat.com: fix warnings] Link: https://lkml.kernel.org/r/20201006200138.GA6026@xz-x1 Link: https://lkml.kernel.org/r/20200930204950.6668-1-peterx@redhat.com Signed-off-by: Peter Xu <peterx@redhat.com> Reported-by: Kirill A. Shutemov <kirill@shutemov.name> Reviewed-by: Jason Gunthorpe <jgg@nvidia.com> Acked-by: Kirill A. Shutemov <kirill.shutemov@linux.intel.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/mm.h | 4 - kernel/fork.c | 2 mm/memory.c | 141 ++++++++++++++++++++++--------------------- 3 files changed, 76 insertions(+), 71 deletions(-) --- a/include/linux/mm.h~mm-remove-src-dst-mm-parameter-in-copy_page_range +++ a/include/linux/mm.h @@ -1653,8 +1653,8 @@ struct mmu_notifier_range; void free_pgd_range(struct mmu_gather *tlb, unsigned long addr, unsigned long end, unsigned long floor, unsigned long ceiling); -int copy_page_range(struct mm_struct *dst, struct mm_struct *src, - struct vm_area_struct *vma, struct vm_area_struct *new); +int +copy_page_range(struct vm_area_struct *dst_vma, struct vm_area_struct *src_vma); int follow_pte_pmd(struct mm_struct *mm, unsigned long address, struct mmu_notifier_range *range, pte_t **ptepp, pmd_t **pmdpp, spinlock_t **ptlp); --- a/kernel/fork.c~mm-remove-src-dst-mm-parameter-in-copy_page_range +++ a/kernel/fork.c @@ -590,7 +590,7 @@ static __latent_entropy int dup_mmap(str mm->map_count++; if (!(tmp->vm_flags & VM_WIPEONFORK)) - retval = copy_page_range(mm, oldmm, mpnt, tmp); + retval = copy_page_range(tmp, mpnt); if (tmp->vm_ops && tmp->vm_ops->open) tmp->vm_ops->open(tmp); --- a/mm/memory.c~mm-remove-src-dst-mm-parameter-in-copy_page_range +++ a/mm/memory.c @@ -794,15 +794,14 @@ copy_nonpresent_pte(struct mm_struct *ds * lock. */ static inline int -copy_present_page(struct mm_struct *dst_mm, struct mm_struct *src_mm, - pte_t *dst_pte, pte_t *src_pte, - struct vm_area_struct *vma, struct vm_area_struct *new, - unsigned long addr, int *rss, struct page **prealloc, - pte_t pte, struct page *page) +copy_present_page(struct vm_area_struct *dst_vma, struct vm_area_struct *src_vma, + pte_t *dst_pte, pte_t *src_pte, unsigned long addr, int *rss, + struct page **prealloc, pte_t pte, struct page *page) { + struct mm_struct *src_mm = src_vma->vm_mm; struct page *new_page; - if (!is_cow_mapping(vma->vm_flags)) + if (!is_cow_mapping(src_vma->vm_flags)) return 1; /* @@ -832,16 +831,16 @@ copy_present_page(struct mm_struct *dst_ * over and copy the page & arm it. */ *prealloc = NULL; - copy_user_highpage(new_page, page, addr, vma); + copy_user_highpage(new_page, page, addr, src_vma); __SetPageUptodate(new_page); - page_add_new_anon_rmap(new_page, new, addr, false); - lru_cache_add_inactive_or_unevictable(new_page, new); + page_add_new_anon_rmap(new_page, dst_vma, addr, false); + lru_cache_add_inactive_or_unevictable(new_page, dst_vma); rss[mm_counter(new_page)]++; /* All done, just insert the new page copy in the child */ - pte = mk_pte(new_page, new->vm_page_prot); - pte = maybe_mkwrite(pte_mkdirty(pte), new); - set_pte_at(dst_mm, addr, dst_pte, pte); + pte = mk_pte(new_page, dst_vma->vm_page_prot); + pte = maybe_mkwrite(pte_mkdirty(pte), dst_vma); + set_pte_at(dst_vma->vm_mm, addr, dst_pte, pte); return 0; } @@ -850,24 +849,21 @@ copy_present_page(struct mm_struct *dst_ * is required to copy this pte. */ static inline int -copy_present_pte(struct mm_struct *dst_mm, struct mm_struct *src_mm, - pte_t *dst_pte, pte_t *src_pte, struct vm_area_struct *vma, - struct vm_area_struct *new, - unsigned long addr, int *rss, struct page **prealloc) +copy_present_pte(struct vm_area_struct *dst_vma, struct vm_area_struct *src_vma, + pte_t *dst_pte, pte_t *src_pte, unsigned long addr, int *rss, + struct page **prealloc) { - unsigned long vm_flags = vma->vm_flags; + struct mm_struct *src_mm = src_vma->vm_mm; + unsigned long vm_flags = src_vma->vm_flags; pte_t pte = *src_pte; struct page *page; - page = vm_normal_page(vma, addr, pte); + page = vm_normal_page(src_vma, addr, pte); if (page) { int retval; - retval = copy_present_page(dst_mm, src_mm, - dst_pte, src_pte, - vma, new, - addr, rss, prealloc, - pte, page); + retval = copy_present_page(dst_vma, src_vma, dst_pte, src_pte, + addr, rss, prealloc, pte, page); if (retval <= 0) return retval; @@ -901,7 +897,7 @@ copy_present_pte(struct mm_struct *dst_m if (!(vm_flags & VM_UFFD_WP)) pte = pte_clear_uffd_wp(pte); - set_pte_at(dst_mm, addr, dst_pte, pte); + set_pte_at(dst_vma->vm_mm, addr, dst_pte, pte); return 0; } @@ -924,11 +920,13 @@ page_copy_prealloc(struct mm_struct *src return new_page; } -static int copy_pte_range(struct mm_struct *dst_mm, struct mm_struct *src_mm, - pmd_t *dst_pmd, pmd_t *src_pmd, struct vm_area_struct *vma, - struct vm_area_struct *new, - unsigned long addr, unsigned long end) +static int +copy_pte_range(struct vm_area_struct *dst_vma, struct vm_area_struct *src_vma, + pmd_t *dst_pmd, pmd_t *src_pmd, unsigned long addr, + unsigned long end) { + struct mm_struct *dst_mm = dst_vma->vm_mm; + struct mm_struct *src_mm = src_vma->vm_mm; pte_t *orig_src_pte, *orig_dst_pte; pte_t *src_pte, *dst_pte; spinlock_t *src_ptl, *dst_ptl; @@ -971,15 +969,15 @@ again: if (unlikely(!pte_present(*src_pte))) { entry.val = copy_nonpresent_pte(dst_mm, src_mm, dst_pte, src_pte, - vma, addr, rss); + src_vma, addr, rss); if (entry.val) break; progress += 8; continue; } /* copy_present_pte() will clear `*prealloc' if consumed */ - ret = copy_present_pte(dst_mm, src_mm, dst_pte, src_pte, - vma, new, addr, rss, &prealloc); + ret = copy_present_pte(dst_vma, src_vma, dst_pte, src_pte, + addr, rss, &prealloc); /* * If we need a pre-allocated page for this pte, drop the * locks, allocate, and try again. @@ -1014,7 +1012,7 @@ again: entry.val = 0; } else if (ret) { WARN_ON_ONCE(ret != -EAGAIN); - prealloc = page_copy_prealloc(src_mm, vma, addr); + prealloc = page_copy_prealloc(src_mm, src_vma, addr); if (!prealloc) return -ENOMEM; /* We've captured and resolved the error. Reset, try again. */ @@ -1028,11 +1026,13 @@ out: return ret; } -static inline int copy_pmd_range(struct mm_struct *dst_mm, struct mm_struct *src_mm, - pud_t *dst_pud, pud_t *src_pud, struct vm_area_struct *vma, - struct vm_area_struct *new, - unsigned long addr, unsigned long end) +static inline int +copy_pmd_range(struct vm_area_struct *dst_vma, struct vm_area_struct *src_vma, + pud_t *dst_pud, pud_t *src_pud, unsigned long addr, + unsigned long end) { + struct mm_struct *dst_mm = dst_vma->vm_mm; + struct mm_struct *src_mm = src_vma->vm_mm; pmd_t *src_pmd, *dst_pmd; unsigned long next; @@ -1045,9 +1045,9 @@ static inline int copy_pmd_range(struct if (is_swap_pmd(*src_pmd) || pmd_trans_huge(*src_pmd) || pmd_devmap(*src_pmd)) { int err; - VM_BUG_ON_VMA(next-addr != HPAGE_PMD_SIZE, vma); + VM_BUG_ON_VMA(next-addr != HPAGE_PMD_SIZE, src_vma); err = copy_huge_pmd(dst_mm, src_mm, - dst_pmd, src_pmd, addr, vma); + dst_pmd, src_pmd, addr, src_vma); if (err == -ENOMEM) return -ENOMEM; if (!err) @@ -1056,18 +1056,20 @@ static inline int copy_pmd_range(struct } if (pmd_none_or_clear_bad(src_pmd)) continue; - if (copy_pte_range(dst_mm, src_mm, dst_pmd, src_pmd, - vma, new, addr, next)) + if (copy_pte_range(dst_vma, src_vma, dst_pmd, src_pmd, + addr, next)) return -ENOMEM; } while (dst_pmd++, src_pmd++, addr = next, addr != end); return 0; } -static inline int copy_pud_range(struct mm_struct *dst_mm, struct mm_struct *src_mm, - p4d_t *dst_p4d, p4d_t *src_p4d, struct vm_area_struct *vma, - struct vm_area_struct *new, - unsigned long addr, unsigned long end) +static inline int +copy_pud_range(struct vm_area_struct *dst_vma, struct vm_area_struct *src_vma, + p4d_t *dst_p4d, p4d_t *src_p4d, unsigned long addr, + unsigned long end) { + struct mm_struct *dst_mm = dst_vma->vm_mm; + struct mm_struct *src_mm = src_vma->vm_mm; pud_t *src_pud, *dst_pud; unsigned long next; @@ -1080,9 +1082,9 @@ static inline int copy_pud_range(struct if (pud_trans_huge(*src_pud) || pud_devmap(*src_pud)) { int err; - VM_BUG_ON_VMA(next-addr != HPAGE_PUD_SIZE, vma); + VM_BUG_ON_VMA(next-addr != HPAGE_PUD_SIZE, src_vma); err = copy_huge_pud(dst_mm, src_mm, - dst_pud, src_pud, addr, vma); + dst_pud, src_pud, addr, src_vma); if (err == -ENOMEM) return -ENOMEM; if (!err) @@ -1091,18 +1093,19 @@ static inline int copy_pud_range(struct } if (pud_none_or_clear_bad(src_pud)) continue; - if (copy_pmd_range(dst_mm, src_mm, dst_pud, src_pud, - vma, new, addr, next)) + if (copy_pmd_range(dst_vma, src_vma, dst_pud, src_pud, + addr, next)) return -ENOMEM; } while (dst_pud++, src_pud++, addr = next, addr != end); return 0; } -static inline int copy_p4d_range(struct mm_struct *dst_mm, struct mm_struct *src_mm, - pgd_t *dst_pgd, pgd_t *src_pgd, struct vm_area_struct *vma, - struct vm_area_struct *new, - unsigned long addr, unsigned long end) +static inline int +copy_p4d_range(struct vm_area_struct *dst_vma, struct vm_area_struct *src_vma, + pgd_t *dst_pgd, pgd_t *src_pgd, unsigned long addr, + unsigned long end) { + struct mm_struct *dst_mm = dst_vma->vm_mm; p4d_t *src_p4d, *dst_p4d; unsigned long next; @@ -1114,20 +1117,22 @@ static inline int copy_p4d_range(struct next = p4d_addr_end(addr, end); if (p4d_none_or_clear_bad(src_p4d)) continue; - if (copy_pud_range(dst_mm, src_mm, dst_p4d, src_p4d, - vma, new, addr, next)) + if (copy_pud_range(dst_vma, src_vma, dst_p4d, src_p4d, + addr, next)) return -ENOMEM; } while (dst_p4d++, src_p4d++, addr = next, addr != end); return 0; } -int copy_page_range(struct mm_struct *dst_mm, struct mm_struct *src_mm, - struct vm_area_struct *vma, struct vm_area_struct *new) +int +copy_page_range(struct vm_area_struct *dst_vma, struct vm_area_struct *src_vma) { pgd_t *src_pgd, *dst_pgd; unsigned long next; - unsigned long addr = vma->vm_start; - unsigned long end = vma->vm_end; + unsigned long addr = src_vma->vm_start; + unsigned long end = src_vma->vm_end; + struct mm_struct *dst_mm = dst_vma->vm_mm; + struct mm_struct *src_mm = src_vma->vm_mm; struct mmu_notifier_range range; bool is_cow; int ret; @@ -1138,19 +1143,19 @@ int copy_page_range(struct mm_struct *ds * readonly mappings. The tradeoff is that copy_page_range is more * efficient than faulting. */ - if (!(vma->vm_flags & (VM_HUGETLB | VM_PFNMAP | VM_MIXEDMAP)) && - !vma->anon_vma) + if (!(src_vma->vm_flags & (VM_HUGETLB | VM_PFNMAP | VM_MIXEDMAP)) && + !src_vma->anon_vma) return 0; - if (is_vm_hugetlb_page(vma)) - return copy_hugetlb_page_range(dst_mm, src_mm, vma); + if (is_vm_hugetlb_page(src_vma)) + return copy_hugetlb_page_range(dst_mm, src_mm, src_vma); - if (unlikely(vma->vm_flags & VM_PFNMAP)) { + if (unlikely(src_vma->vm_flags & VM_PFNMAP)) { /* * We do not free on error cases below as remove_vma * gets called on error from higher level routine */ - ret = track_pfn_copy(vma); + ret = track_pfn_copy(src_vma); if (ret) return ret; } @@ -1161,11 +1166,11 @@ int copy_page_range(struct mm_struct *ds * parent mm. And a permission downgrade will only happen if * is_cow_mapping() returns true. */ - is_cow = is_cow_mapping(vma->vm_flags); + is_cow = is_cow_mapping(src_vma->vm_flags); if (is_cow) { mmu_notifier_range_init(&range, MMU_NOTIFY_PROTECTION_PAGE, - 0, vma, src_mm, addr, end); + 0, src_vma, src_mm, addr, end); mmu_notifier_invalidate_range_start(&range); } @@ -1176,8 +1181,8 @@ int copy_page_range(struct mm_struct *ds next = pgd_addr_end(addr, end); if (pgd_none_or_clear_bad(src_pgd)) continue; - if (unlikely(copy_p4d_range(dst_mm, src_mm, dst_pgd, src_pgd, - vma, new, addr, next))) { + if (unlikely(copy_p4d_range(dst_vma, src_vma, dst_pgd, src_pgd, + addr, next))) { ret = -ENOMEM; break; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 110/181] include/linux/huge_mm.h: remove mincore_huge_pmd declaration 2020-10-13 23:46 incoming Andrew Morton ` (108 preceding siblings ...) 2020-10-13 23:54 ` [patch 109/181] mm: remove src/dst mm parameter in copy_page_range() Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 111/181] tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro Andrew Morton ` (70 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, torvalds, yulei.kernel, yuleixzhang, ziy From: yuleixzhang <yulei.kernel@gmail.com> Subject: include/linux/huge_mm.h: remove mincore_huge_pmd declaration As mincore_huge_pmd() was dropped, remove the declaration from the header file. Link: https://lkml.kernel.org/r/20200922083423.15074-1-yuleixzhang@tencent.com Signed-off-by: Yulei Zhang <yuleixzhang@tencent.com> Reviewed-by: Zi Yan <ziy@nvidia.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/huge_mm.h | 3 --- 1 file changed, 3 deletions(-) --- a/include/linux/huge_mm.h~mm-cleanup-mincore_huge_pmd +++ a/include/linux/huge_mm.h @@ -38,9 +38,6 @@ extern int zap_huge_pmd(struct mmu_gathe extern int zap_huge_pud(struct mmu_gather *tlb, struct vm_area_struct *vma, pud_t *pud, unsigned long addr); -extern int mincore_huge_pmd(struct vm_area_struct *vma, pmd_t *pmd, - unsigned long addr, unsigned long end, - unsigned char *vec); extern bool move_huge_pmd(struct vm_area_struct *vma, unsigned long old_addr, unsigned long new_addr, pmd_t *old_pmd, pmd_t *new_pmd); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 111/181] tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro 2020-10-13 23:46 incoming Andrew Morton ` (109 preceding siblings ...) 2020-10-13 23:54 ` [patch 110/181] include/linux/huge_mm.h: remove mincore_huge_pmd declaration Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 112/181] lib/test_hmm.c: remove unused dmirror_zero_page Andrew Morton ` (69 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, jgg, jglisse, jhubbard, linux-mm, mm-commits, rcampbell, shuah, torvalds From: Ralph Campbell <rcampbell@nvidia.com> Subject: tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro Some tests might not be able to be run if resources like huge pages are not available. Mark these tests as skipped instead of simply passing. Link: http://lkml.kernel.org/r/20200827190400.12608-1-rcampbell@nvidia.com Signed-off-by: Ralph Campbell <rcampbell@nvidia.com> Reviewed-by: Jason Gunthorpe <jgg@nvidia.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Shuah Khan <shuah@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/hmm-tests.c | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/tools/testing/selftests/vm/hmm-tests.c~mm-test-use-the-new-skip-macro +++ a/tools/testing/selftests/vm/hmm-tests.c @@ -680,7 +680,7 @@ TEST_F(hmm, anon_write_hugetlbfs) n = gethugepagesizes(pagesizes, 4); if (n <= 0) - return; + SKIP(return, "Huge page size could not be determined"); for (idx = 0; --n > 0; ) { if (pagesizes[n] < pagesizes[idx]) idx = n; @@ -694,7 +694,7 @@ TEST_F(hmm, anon_write_hugetlbfs) buffer->ptr = get_hugepage_region(size, GHR_STRICT); if (buffer->ptr == NULL) { free(buffer); - return; + SKIP(return, "Huge page could not be allocated"); } buffer->fd = -1; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 112/181] lib/test_hmm.c: remove unused dmirror_zero_page 2020-10-13 23:46 incoming Andrew Morton ` (110 preceding siblings ...) 2020-10-13 23:54 ` [patch 111/181] tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 113/181] mm/dmapool.c: replace open-coded list_for_each_entry_safe() Andrew Morton ` (68 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, jglisse, linux-mm, mm-commits, rcampbell, torvalds From: Ralph Campbell <rcampbell@nvidia.com> Subject: lib/test_hmm.c: remove unused dmirror_zero_page The variable dmirror_zero_page is unused in the HMM self test driver which was probably intended to demonstrate how a driver could use migrate_vma_setup() to share a single read-only device private zero page similar to how the CPU does. However, this isn't needed for the self tests so remove it. Link: https://lkml.kernel.org/r/20200914213801.16520-1-rcampbell@nvidia.com Signed-off-by: Ralph Campbell <rcampbell@nvidia.com> Cc: Jerome Glisse <jglisse@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- lib/test_hmm.c | 14 -------------- 1 file changed, 14 deletions(-) --- a/lib/test_hmm.c~hmm-test-remove-unused-dmirror_zero_page +++ a/lib/test_hmm.c @@ -36,7 +36,6 @@ static const struct dev_pagemap_ops dmirror_devmem_ops; static const struct mmu_interval_notifier_ops dmirror_min_ops; static dev_t dmirror_dev; -static struct page *dmirror_zero_page; struct dmirror_device; @@ -1127,17 +1126,6 @@ static int __init hmm_dmirror_init(void) goto err_chrdev; } - /* - * Allocate a zero page to simulate a reserved page of device private - * memory which is always zero. The zero_pfn page isn't used just to - * make the code here simpler (i.e., we need a struct page for it). - */ - dmirror_zero_page = alloc_page(GFP_HIGHUSER | __GFP_ZERO); - if (!dmirror_zero_page) { - ret = -ENOMEM; - goto err_chrdev; - } - pr_info("HMM test module loaded. This is only for testing HMM.\n"); return 0; @@ -1153,8 +1141,6 @@ static void __exit hmm_dmirror_exit(void { int id; - if (dmirror_zero_page) - __free_page(dmirror_zero_page); for (id = 0; id < DMIRROR_NDEVICES; id++) dmirror_device_remove(dmirror_devices + id); unregister_chrdev_region(dmirror_dev, DMIRROR_NDEVICES); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 113/181] mm/dmapool.c: replace open-coded list_for_each_entry_safe() 2020-10-13 23:46 incoming Andrew Morton ` (111 preceding siblings ...) 2020-10-13 23:54 ` [patch 112/181] lib/test_hmm.c: remove unused dmirror_zero_page Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 114/181] mm/dmapool.c: replace hard coded function name with __func__ Andrew Morton ` (67 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, andriy.shevchenko, linux-mm, mm-commits, torvalds, willy From: Andy Shevchenko <andriy.shevchenko@linux.intel.com> Subject: mm/dmapool.c: replace open-coded list_for_each_entry_safe() There is a place in the code where open-coded version of list_for_each_entry_safe() is used. Replace that with the standard macro. Link: http://lkml.kernel.org/r/20200814135055.24898-1-andriy.shevchenko@linux.intel.com Signed-off-by: Andy Shevchenko <andriy.shevchenko@linux.intel.com> Cc: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/dmapool.c | 6 ++---- 1 file changed, 2 insertions(+), 4 deletions(-) --- a/mm/dmapool.c~mm-dmapoolc-replace-open-coded-list_for_each_entry_safe +++ a/mm/dmapool.c @@ -266,6 +266,7 @@ static void pool_free_page(struct dma_po */ void dma_pool_destroy(struct dma_pool *pool) { + struct dma_page *page, *tmp; bool empty = false; if (unlikely(!pool)) @@ -281,10 +282,7 @@ void dma_pool_destroy(struct dma_pool *p device_remove_file(pool->dev, &dev_attr_pools); mutex_unlock(&pools_reg_lock); - while (!list_empty(&pool->page_list)) { - struct dma_page *page; - page = list_entry(pool->page_list.next, - struct dma_page, page_list); + list_for_each_entry_safe(page, tmp, &pool->page_list, page_list) { if (is_page_busy(page)) { if (pool->dev) dev_err(pool->dev, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 114/181] mm/dmapool.c: replace hard coded function name with __func__ 2020-10-13 23:46 incoming Andrew Morton ` (112 preceding siblings ...) 2020-10-13 23:54 ` [patch 113/181] mm/dmapool.c: replace open-coded list_for_each_entry_safe() Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 115/181] mm/memory-failure: do pgoff calculation before for_each_process() Andrew Morton ` (66 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, andriy.shevchenko, linux-mm, mm-commits, torvalds, willy From: Andy Shevchenko <andriy.shevchenko@linux.intel.com> Subject: mm/dmapool.c: replace hard coded function name with __func__ No need to hard code function name when __func__ can be used. While here, replace specifiers for special types like dma_addr_t. Link: http://lkml.kernel.org/r/20200814135055.24898-2-andriy.shevchenko@linux.intel.com Signed-off-by: Andy Shevchenko <andriy.shevchenko@linux.intel.com> Cc: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/dmapool.c | 40 ++++++++++++++++++---------------------- 1 file changed, 18 insertions(+), 22 deletions(-) --- a/mm/dmapool.c~mm-dmapoolc-replace-hard-coded-function-name-with-__func__ +++ a/mm/dmapool.c @@ -285,11 +285,10 @@ void dma_pool_destroy(struct dma_pool *p list_for_each_entry_safe(page, tmp, &pool->page_list, page_list) { if (is_page_busy(page)) { if (pool->dev) - dev_err(pool->dev, - "dma_pool_destroy %s, %p busy\n", + dev_err(pool->dev, "%s %s, %p busy\n", __func__, pool->name, page->vaddr); else - pr_err("dma_pool_destroy %s, %p busy\n", + pr_err("%s %s, %p busy\n", __func__, pool->name, page->vaddr); /* leak the still-in-use consistent memory */ list_del(&page->page_list); @@ -353,12 +352,11 @@ void *dma_pool_alloc(struct dma_pool *po if (data[i] == POOL_POISON_FREED) continue; if (pool->dev) - dev_err(pool->dev, - "dma_pool_alloc %s, %p (corrupted)\n", - pool->name, retval); + dev_err(pool->dev, "%s %s, %p (corrupted)\n", + __func__, pool->name, retval); else - pr_err("dma_pool_alloc %s, %p (corrupted)\n", - pool->name, retval); + pr_err("%s %s, %p (corrupted)\n", + __func__, pool->name, retval); /* * Dump the first 4 bytes even if they are not @@ -414,12 +412,11 @@ void dma_pool_free(struct dma_pool *pool if (!page) { spin_unlock_irqrestore(&pool->lock, flags); if (pool->dev) - dev_err(pool->dev, - "dma_pool_free %s, %p/%lx (bad dma)\n", - pool->name, vaddr, (unsigned long)dma); + dev_err(pool->dev, "%s %s, %p/%pad (bad dma)\n", + __func__, pool->name, vaddr, &dma); else - pr_err("dma_pool_free %s, %p/%lx (bad dma)\n", - pool->name, vaddr, (unsigned long)dma); + pr_err("%s %s, %p/%pad (bad dma)\n", + __func__, pool->name, vaddr, &dma); return; } @@ -430,12 +427,11 @@ void dma_pool_free(struct dma_pool *pool if ((dma - page->dma) != offset) { spin_unlock_irqrestore(&pool->lock, flags); if (pool->dev) - dev_err(pool->dev, - "dma_pool_free %s, %p (bad vaddr)/%pad\n", - pool->name, vaddr, &dma); + dev_err(pool->dev, "%s %s, %p (bad vaddr)/%pad\n", + __func__, pool->name, vaddr, &dma); else - pr_err("dma_pool_free %s, %p (bad vaddr)/%pad\n", - pool->name, vaddr, &dma); + pr_err("%s %s, %p (bad vaddr)/%pad\n", + __func__, pool->name, vaddr, &dma); return; } { @@ -447,11 +443,11 @@ void dma_pool_free(struct dma_pool *pool } spin_unlock_irqrestore(&pool->lock, flags); if (pool->dev) - dev_err(pool->dev, "dma_pool_free %s, dma %pad already free\n", - pool->name, &dma); + dev_err(pool->dev, "%s %s, dma %pad already free\n", + __func__, pool->name, &dma); else - pr_err("dma_pool_free %s, dma %pad already free\n", - pool->name, &dma); + pr_err("%s %s, dma %pad already free\n", + __func__, pool->name, &dma); return; } } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 115/181] mm/memory-failure: do pgoff calculation before for_each_process() 2020-10-13 23:46 incoming Andrew Morton ` (113 preceding siblings ...) 2020-10-13 23:54 ` [patch 114/181] mm/dmapool.c: replace hard coded function name with __func__ Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 116/181] mm/memory-failure.c: remove unused macro `writeback' Andrew Morton ` (65 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, naoya.horiguchi, tian.xianting, torvalds From: Xianting Tian <tian.xianting@h3c.com> Subject: mm/memory-failure: do pgoff calculation before for_each_process() There is no need to calculate pgoff in each loop of for_each_process(), so move it to the place before for_each_process(), which can save some CPU cycles. Link: http://lkml.kernel.org/r/20200818082647.34322-1-tian.xianting@h3c.com Signed-off-by: Xianting Tian <tian.xianting@h3c.com> Acked-by: Naoya Horiguchi <naoya.horiguchi@nec.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory-failure.c | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) --- a/mm/memory-failure.c~mm-memory-failure-do-pgoff-calculation-before-for_each_process +++ a/mm/memory-failure.c @@ -484,11 +484,12 @@ static void collect_procs_file(struct pa struct vm_area_struct *vma; struct task_struct *tsk; struct address_space *mapping = page->mapping; + pgoff_t pgoff; i_mmap_lock_read(mapping); read_lock(&tasklist_lock); + pgoff = page_to_pgoff(page); for_each_process(tsk) { - pgoff_t pgoff = page_to_pgoff(page); struct task_struct *t = task_early_kill(tsk, force_early); if (!t) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 116/181] mm/memory-failure.c: remove unused macro `writeback' 2020-10-13 23:46 incoming Andrew Morton ` (114 preceding siblings ...) 2020-10-13 23:54 ` [patch 115/181] mm/memory-failure: do pgoff calculation before for_each_process() Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 117/181] mm/vmalloc.c: update the comment in __vmalloc_area_node() Andrew Morton ` (64 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, alex.shi, linux-mm, mm-commits, naoya.horiguchi, torvalds From: Alex Shi <alex.shi@linux.alibaba.com> Subject: mm/memory-failure.c: remove unused macro `writeback' Unlike others we don't use the marco writeback. so let's remove it to tame gcc warning: mm/memory-failure.c:827: warning: macro "writeback" is not used [-Wunused-macros] Link: https://lkml.kernel.org/r/1599715096-20369-1-git-send-email-alex.shi@linux.alibaba.com Signed-off-by: Alex Shi <alex.shi@linux.alibaba.com> Cc: Naoya Horiguchi <naoya.horiguchi@nec.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/memory-failure.c | 2 -- 1 file changed, 2 deletions(-) --- a/mm/memory-failure.c~mm-remove-unused-marco-writeback +++ a/mm/memory-failure.c @@ -825,7 +825,6 @@ static int me_huge_page(struct page *p, #define sc ((1UL << PG_swapcache) | (1UL << PG_swapbacked)) #define unevict (1UL << PG_unevictable) #define mlock (1UL << PG_mlocked) -#define writeback (1UL << PG_writeback) #define lru (1UL << PG_lru) #define head (1UL << PG_head) #define slab (1UL << PG_slab) @@ -874,7 +873,6 @@ static struct page_state { #undef sc #undef unevict #undef mlock -#undef writeback #undef lru #undef head #undef slab _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 117/181] mm/vmalloc.c: update the comment in __vmalloc_area_node() 2020-10-13 23:46 incoming Andrew Morton ` (115 preceding siblings ...) 2020-10-13 23:54 ` [patch 116/181] mm/memory-failure.c: remove unused macro `writeback' Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 118/181] mm/vmalloc.c: fix the comment of find_vm_area Andrew Morton ` (63 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, rpenyaev, sh_def, torvalds From: Hui Su <sh_def@163.com> Subject: mm/vmalloc.c: update the comment in __vmalloc_area_node() Since c67dc624757 ("mm/vmalloc: do not call kmemleak_free() on not yet accounted memory"), the __vunmap() have been changed to __vfree(), so update the confusing comment(). Link: https://lkml.kernel.org/r/20200927155409.GA3315@rlk Signed-off-by: Hui Su <sh_def@163.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Cc: Roman Penyaev <rpenyaev@suse.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmalloc.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/vmalloc.c~mm-vmallocc-update-the-comment-in-__vmalloc_area_node +++ a/mm/vmalloc.c @@ -2447,7 +2447,7 @@ static void *__vmalloc_area_node(struct page = alloc_pages_node(node, alloc_mask|highmem_mask, 0); if (unlikely(!page)) { - /* Successfully allocated i pages, free them in __vunmap() */ + /* Successfully allocated i pages, free them in __vfree() */ area->nr_pages = i; atomic_long_add(area->nr_pages, &nr_vmalloc_pages); goto fail; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 118/181] mm/vmalloc.c: fix the comment of find_vm_area 2020-10-13 23:46 incoming Andrew Morton ` (116 preceding siblings ...) 2020-10-13 23:54 ` [patch 117/181] mm/vmalloc.c: update the comment in __vmalloc_area_node() Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 119/181] docs/vm: fix 'mm_count' vs 'mm_users' counter confusion Andrew Morton ` (62 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, sh_def, torvalds From: Hui Su <sh_def@163.com> Subject: mm/vmalloc.c: fix the comment of find_vm_area Fix the comment of find_vm_area() and get_vm_area() Link: https://lkml.kernel.org/r/20200927153034.GA199877@rlk Signed-off-by: Hui Su <sh_def@163.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmalloc.c | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/mm/vmalloc.c~mm-vmallocc-fix-the-comment-of-find_vm_area +++ a/mm/vmalloc.c @@ -2133,7 +2133,7 @@ struct vm_struct *get_vm_area_caller(uns * It is up to the caller to do all required locking to keep the returned * pointer valid. * - * Return: pointer to the found area or %NULL on faulure + * Return: the area descriptor on success or %NULL on failure. */ struct vm_struct *find_vm_area(const void *addr) { @@ -2154,7 +2154,7 @@ struct vm_struct *find_vm_area(const voi * This function returns the found VM area, but using it is NOT safe * on SMP machines, except for its size or flags. * - * Return: pointer to the found area or %NULL on faulure + * Return: the area descriptor on success or %NULL on failure. */ struct vm_struct *remove_vm_area(const void *addr) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 119/181] docs/vm: fix 'mm_count' vs 'mm_users' counter confusion 2020-10-13 23:46 incoming Andrew Morton ` (117 preceding siblings ...) 2020-10-13 23:54 ` [patch 118/181] mm/vmalloc.c: fix the comment of find_vm_area Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:54 ` [patch 120/181] kasan/kunit: add KUnit Struct to Current Task Andrew Morton ` (61 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: agordeev, akpm, corbet, linux-mm, mm-commits, torvalds From: Alexander Gordeev <agordeev@linux.ibm.com> Subject: docs/vm: fix 'mm_count' vs 'mm_users' counter confusion In the context of the anonymous address space lifespan description the 'mm_users' reference counter is confused with 'mm_count'. I.e a "zombie" mm gets released when "mm_count" becomes zero, not "mm_users". Link: https://lkml.kernel.org/r/1597040695-32633-1-git-send-email-agordeev@linux.ibm.com Signed-off-by: Alexander Gordeev <agordeev@linux.ibm.com> Cc: Jonathan Corbet <corbet@lwn.net> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/vm/active_mm.rst | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/Documentation/vm/active_mm.rst~docs-vm-fix-mm_count-vs-mm_users-counter-confusion +++ a/Documentation/vm/active_mm.rst @@ -64,7 +64,7 @@ Active MM actually get cases where you have a address space that is _only_ used by lazy users. That is often a short-lived state, because once that thread gets scheduled away in favour of a real thread, the "zombie" mm gets - released because "mm_users" becomes zero. + released because "mm_count" becomes zero. Also, a new rule is that _nobody_ ever has "init_mm" as a real MM any more. "init_mm" should be considered just a "lazy context when no other _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 120/181] kasan/kunit: add KUnit Struct to Current Task 2020-10-13 23:46 incoming Andrew Morton ` (118 preceding siblings ...) 2020-10-13 23:54 ` [patch 119/181] docs/vm: fix 'mm_count' vs 'mm_users' counter confusion Andrew Morton @ 2020-10-13 23:54 ` Andrew Morton 2020-10-13 23:55 ` [patch 121/181] KUnit: KASAN Integration Andrew Morton ` (60 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:54 UTC (permalink / raw) To: a.p.zijlstra, akpm, andreyknvl, aryabinin, brendanhiggins, davidgow, dvyukov, juri.lelli, linux-mm, mingo, mm-commits, shuah, torvalds, trishalfonso, vincent.guittot From: Patricia Alfonso <trishalfonso@google.com> Subject: kasan/kunit: add KUnit Struct to Current Task Patch series "KASAN-KUnit Integration", v14. This patchset contains everything needed to integrate KASAN and KUnit. KUnit will be able to: (1) Fail tests when an unexpected KASAN error occurs (2) Pass tests when an expected KASAN error occurs Convert KASAN tests to KUnit with the exception of copy_user_test because KUnit is unable to test those. Add documentation on how to run the KASAN tests with KUnit and what to expect when running these tests. This patch (of 5): In order to integrate debugging tools like KASAN into the KUnit framework, add KUnit struct to the current task to keep track of the current KUnit test. Link: https://lkml.kernel.org/r/20200915035828.570483-1-davidgow@google.com Link: https://lkml.kernel.org/r/20200915035828.570483-2-davidgow@google.com Link: https://lkml.kernel.org/r/20200910070331.3358048-1-davidgow@google.com Link: https://lkml.kernel.org/r/20200910070331.3358048-2-davidgow@google.com Signed-off-by: Patricia Alfonso <trishalfonso@google.com> Signed-off-by: David Gow <davidgow@google.com> Reviewed-by: Brendan Higgins <brendanhiggins@google.com> Tested-by: Andrey Konovalov <andreyknvl@google.com> Cc: Brendan Higgins <brendanhiggins@google.com> Cc: Andrey Ryabinin <aryabinin@virtuozzo.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Peter Zijlstra <a.p.zijlstra@chello.nl> Cc: Juri Lelli <juri.lelli@redhat.com> Cc: Vincent Guittot <vincent.guittot@linaro.org> Cc: Shuah Khan <shuah@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/sched.h | 4 ++++ 1 file changed, 4 insertions(+) --- a/include/linux/sched.h~add-kunit-struct-to-current-task +++ a/include/linux/sched.h @@ -1208,6 +1208,10 @@ struct task_struct { #endif #endif +#if IS_ENABLED(CONFIG_KUNIT) + struct kunit *kunit_test; +#endif + #ifdef CONFIG_FUNCTION_GRAPH_TRACER /* Index of current stored address in ret_stack: */ int curr_ret_stack; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 121/181] KUnit: KASAN Integration 2020-10-13 23:46 incoming Andrew Morton ` (119 preceding siblings ...) 2020-10-13 23:54 ` [patch 120/181] kasan/kunit: add KUnit Struct to Current Task Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 122/181] KASAN: port KASAN Tests to KUnit Andrew Morton ` (59 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: a.p.zijlstra, akpm, andreyknvl, aryabinin, brendanhiggins, davidgow, dvyukov, juri.lelli, linux-mm, mingo, mm-commits, shuah, torvalds, trishalfonso, vincent.guittot From: Patricia Alfonso <trishalfonso@google.com> Subject: KUnit: KASAN Integration Integrate KASAN into KUnit testing framework. - Fail tests when KASAN reports an error that is not expected - Use KUNIT_EXPECT_KASAN_FAIL to expect a KASAN error in KASAN tests - Expected KASAN reports pass tests and are still printed when run without kunit_tool (kunit_tool still bypasses the report due to the test passing) - KUnit struct in current task used to keep track of the current test from KASAN code Make use of "[PATCH v3 kunit-next 1/2] kunit: generalize kunit_resource API beyond allocated resources" and "[PATCH v3 kunit-next 2/2] kunit: add support for named resources" from Alan Maguire [1] - A named resource is added to a test when a KASAN report is expected - This resource contains a struct for kasan_data containing booleans representing if a KASAN report is expected and if a KASAN report is found [1] (https://lore.kernel.org/linux-kselftest/1583251361-12748-1-git-send-email-alan.maguire@oracle.com/T/#t) Link: https://lkml.kernel.org/r/20200915035828.570483-3-davidgow@google.com Link: https://lkml.kernel.org/r/20200910070331.3358048-3-davidgow@google.com Signed-off-by: Patricia Alfonso <trishalfonso@google.com> Signed-off-by: David Gow <davidgow@google.com> Reviewed-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Dmitry Vyukov <dvyukov@google.com> Acked-by: Brendan Higgins <brendanhiggins@google.com> Tested-by: Andrey Konovalov <andreyknvl@google.com> Cc: Andrey Ryabinin <aryabinin@virtuozzo.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Juri Lelli <juri.lelli@redhat.com> Cc: Peter Zijlstra <a.p.zijlstra@chello.nl> Cc: Shuah Khan <shuah@kernel.org> Cc: Vincent Guittot <vincent.guittot@linaro.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/kunit/test.h | 5 ++++ include/linux/kasan.h | 6 +++++ lib/kunit/test.c | 13 ++++++----- lib/test_kasan.c | 47 ++++++++++++++++++++++++++++++++++++++-- mm/kasan/report.c | 32 +++++++++++++++++++++++++++ 5 files changed, 96 insertions(+), 7 deletions(-) --- a/include/kunit/test.h~kunit-kasan-integration +++ a/include/kunit/test.h @@ -224,6 +224,11 @@ struct kunit { struct list_head resources; /* Protected by lock. */ }; +static inline void kunit_set_failure(struct kunit *test) +{ + WRITE_ONCE(test->success, false); +} + void kunit_init_test(struct kunit *test, const char *name, char *log); int kunit_run_tests(struct kunit_suite *suite); --- a/include/linux/kasan.h~kunit-kasan-integration +++ a/include/linux/kasan.h @@ -14,6 +14,12 @@ struct task_struct; #include <linux/pgtable.h> #include <asm/kasan.h> +/* kasan_data struct is used in KUnit tests for KASAN expected failures */ +struct kunit_kasan_expectation { + bool report_expected; + bool report_found; +}; + extern unsigned char kasan_early_shadow_page[PAGE_SIZE]; extern pte_t kasan_early_shadow_pte[PTRS_PER_PTE]; extern pmd_t kasan_early_shadow_pmd[PTRS_PER_PMD]; --- a/lib/kunit/test.c~kunit-kasan-integration +++ a/lib/kunit/test.c @@ -10,16 +10,12 @@ #include <linux/kernel.h> #include <linux/kref.h> #include <linux/sched/debug.h> +#include <linux/sched.h> #include "debugfs.h" #include "string-stream.h" #include "try-catch-impl.h" -static void kunit_set_failure(struct kunit *test) -{ - WRITE_ONCE(test->success, false); -} - static void kunit_print_tap_version(void) { static bool kunit_has_printed_tap_version; @@ -288,6 +284,10 @@ static void kunit_try_run_case(void *dat struct kunit_suite *suite = ctx->suite; struct kunit_case *test_case = ctx->test_case; +#if (IS_ENABLED(CONFIG_KASAN) && IS_ENABLED(CONFIG_KUNIT)) + current->kunit_test = test; +#endif /* IS_ENABLED(CONFIG_KASAN) && IS_ENABLED(CONFIG_KUNIT) */ + /* * kunit_run_case_internal may encounter a fatal error; if it does, * abort will be called, this thread will exit, and finally the parent @@ -602,6 +602,9 @@ void kunit_cleanup(struct kunit *test) spin_unlock(&test->lock); kunit_remove_resource(test, res); } +#if (IS_ENABLED(CONFIG_KASAN) && IS_ENABLED(CONFIG_KUNIT)) + current->kunit_test = NULL; +#endif /* IS_ENABLED(CONFIG_KASAN) && IS_ENABLED(CONFIG_KUNIT)*/ } EXPORT_SYMBOL_GPL(kunit_cleanup); --- a/lib/test_kasan.c~kunit-kasan-integration +++ a/lib/test_kasan.c @@ -23,6 +23,8 @@ #include <asm/page.h> +#include <kunit/test.h> + #include "../mm/kasan/kasan.h" #define OOB_TAG_OFF (IS_ENABLED(CONFIG_KASAN_GENERIC) ? 0 : KASAN_SHADOW_SCALE_SIZE) @@ -32,14 +34,55 @@ * are not eliminated as dead code. */ -int kasan_int_result; void *kasan_ptr_result; +int kasan_int_result; + +static struct kunit_resource resource; +static struct kunit_kasan_expectation fail_data; +static bool multishot; + +static int kasan_test_init(struct kunit *test) +{ + /* + * Temporarily enable multi-shot mode and set panic_on_warn=0. + * Otherwise, we'd only get a report for the first case. + */ + multishot = kasan_save_enable_multi_shot(); + + return 0; +} + +static void kasan_test_exit(struct kunit *test) +{ + kasan_restore_multi_shot(multishot); +} + +/** + * KUNIT_EXPECT_KASAN_FAIL() - Causes a test failure when the expression does + * not cause a KASAN error. This uses a KUnit resource named "kasan_data." Do + * Do not use this name for a KUnit resource outside here. + * + */ +#define KUNIT_EXPECT_KASAN_FAIL(test, condition) do { \ + fail_data.report_expected = true; \ + fail_data.report_found = false; \ + kunit_add_named_resource(test, \ + NULL, \ + NULL, \ + &resource, \ + "kasan_data", &fail_data); \ + condition; \ + KUNIT_EXPECT_EQ(test, \ + fail_data.report_expected, \ + fail_data.report_found); \ +} while (0) + + /* * Note: test functions are marked noinline so that their names appear in * reports. */ - static noinline void __init kmalloc_oob_right(void) { char *ptr; --- a/mm/kasan/report.c~kunit-kasan-integration +++ a/mm/kasan/report.c @@ -33,6 +33,8 @@ #include <asm/sections.h> +#include <kunit/test.h> + #include "kasan.h" #include "../slab.h" @@ -464,12 +466,37 @@ static bool report_enabled(void) return !test_and_set_bit(KASAN_BIT_REPORTED, &kasan_flags); } +#if IS_ENABLED(CONFIG_KUNIT) +static void kasan_update_kunit_status(struct kunit *cur_test) +{ + struct kunit_resource *resource; + struct kunit_kasan_expectation *kasan_data; + + resource = kunit_find_named_resource(cur_test, "kasan_data"); + + if (!resource) { + kunit_set_failure(cur_test); + return; + } + + kasan_data = (struct kunit_kasan_expectation *)resource->data; + kasan_data->report_found = true; + kunit_put_resource(resource); +} +#endif /* IS_ENABLED(CONFIG_KUNIT) */ + void kasan_report_invalid_free(void *object, unsigned long ip) { unsigned long flags; u8 tag = get_tag(object); object = reset_tag(object); + +#if IS_ENABLED(CONFIG_KUNIT) + if (current->kunit_test) + kasan_update_kunit_status(current->kunit_test); +#endif /* IS_ENABLED(CONFIG_KUNIT) */ + start_report(&flags); pr_err("BUG: KASAN: double-free or invalid-free in %pS\n", (void *)ip); print_tags(tag, object); @@ -488,6 +515,11 @@ static void __kasan_report(unsigned long void *untagged_addr; unsigned long flags; +#if IS_ENABLED(CONFIG_KUNIT) + if (current->kunit_test) + kasan_update_kunit_status(current->kunit_test); +#endif /* IS_ENABLED(CONFIG_KUNIT) */ + disable_trace_on_warning(); tagged_addr = (void *)addr; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 122/181] KASAN: port KASAN Tests to KUnit 2020-10-13 23:46 incoming Andrew Morton ` (120 preceding siblings ...) 2020-10-13 23:55 ` [patch 121/181] KUnit: KASAN Integration Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 123/181] KASAN: Testing Documentation Andrew Morton ` (58 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: a.p.zijlstra, akpm, andreyknvl, aryabinin, brendanhiggins, davidgow, dvyukov, juri.lelli, linux-mm, mingo, mm-commits, shuah, torvalds, trishalfonso, vincent.guittot From: Patricia Alfonso <trishalfonso@google.com> Subject: KASAN: port KASAN Tests to KUnit Transfer all previous tests for KASAN to KUnit so they can be run more easily. Using kunit_tool, developers can run these tests with their other KUnit tests and see "pass" or "fail" with the appropriate KASAN report instead of needing to parse each KASAN report to test KASAN functionalities. All KASAN reports are still printed to dmesg. Stack tests do not work properly when KASAN_STACK is enabled so those tests use a check for "if IS_ENABLED(CONFIG_KASAN_STACK)" so they only run if stack instrumentation is enabled. If KASAN_STACK is not enabled, KUnit will print a statement to let the user know this test was not run with KASAN_STACK enabled. copy_user_test and kasan_rcu_uaf cannot be run in KUnit so there is a separate test file for those tests, which can be run as before as a module. [trishalfonso@google.com: v14] Link: https://lkml.kernel.org/r/20200915035828.570483-4-davidgow@google.com Link: https://lkml.kernel.org/r/20200910070331.3358048-4-davidgow@google.com Signed-off-by: Patricia Alfonso <trishalfonso@google.com> Signed-off-by: David Gow <davidgow@google.com> Reviewed-by: Brendan Higgins <brendanhiggins@google.com> Reviewed-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Dmitry Vyukov <dvyukov@google.com> Tested-by: Andrey Konovalov <andreyknvl@google.com> Cc: Andrey Ryabinin <aryabinin@virtuozzo.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Juri Lelli <juri.lelli@redhat.com> Cc: Peter Zijlstra <a.p.zijlstra@chello.nl> Cc: Shuah Khan <shuah@kernel.org> Cc: Vincent Guittot <vincent.guittot@linaro.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- lib/Kconfig.kasan | 22 - lib/Makefile | 4 lib/test_kasan.c | 685 ++++++++++++++------------------------ lib/test_kasan_module.c | 111 ++++++ 4 files changed, 385 insertions(+), 437 deletions(-) --- a/lib/Kconfig.kasan~kasan-port-kasan-tests-to-kunit +++ a/lib/Kconfig.kasan @@ -166,12 +166,24 @@ config KASAN_VMALLOC for KASAN to detect more sorts of errors (and to support vmapped stacks), but at the cost of higher memory usage. -config TEST_KASAN - tristate "Module for testing KASAN for bug detection" - depends on m +config KASAN_KUNIT_TEST + tristate "KUnit-compatible tests of KASAN bug detection capabilities" if !KUNIT_ALL_TESTS + depends on KASAN && KUNIT + default KUNIT_ALL_TESTS help - This is a test module doing various nasty things like - out of bounds accesses, use after free. It is useful for testing + This is a KUnit test suite doing various nasty things like + out of bounds and use after free accesses. It is useful for testing kernel debugging features like KASAN. + For more information on KUnit and unit tests in general, please refer + to the KUnit documentation in Documentation/dev-tools/kunit + +config TEST_KASAN_MODULE + tristate "KUnit-incompatible tests of KASAN bug detection capabilities" + depends on m && KASAN + help + This is a part of the KASAN test suite that is incompatible with + KUnit. Currently includes tests that do bad copy_from/to_user + accesses. + endif # KASAN --- a/lib/Makefile~kasan-port-kasan-tests-to-kunit +++ a/lib/Makefile @@ -65,9 +65,11 @@ CFLAGS_test_bitops.o += -Werror obj-$(CONFIG_TEST_SYSCTL) += test_sysctl.o obj-$(CONFIG_TEST_HASH) += test_hash.o test_siphash.o obj-$(CONFIG_TEST_IDA) += test_ida.o -obj-$(CONFIG_TEST_KASAN) += test_kasan.o +obj-$(CONFIG_KASAN_KUNIT_TEST) += test_kasan.o CFLAGS_test_kasan.o += -fno-builtin CFLAGS_test_kasan.o += $(call cc-disable-warning, vla) +obj-$(CONFIG_TEST_KASAN_MODULE) += test_kasan_module.o +CFLAGS_test_kasan_module.o += -fno-builtin obj-$(CONFIG_TEST_UBSAN) += test_ubsan.o CFLAGS_test_ubsan.o += $(call cc-disable-warning, vla) UBSAN_SANITIZE_test_ubsan.o := y --- a/lib/test_kasan.c~kasan-port-kasan-tests-to-kunit +++ a/lib/test_kasan.c @@ -5,8 +5,6 @@ * Author: Andrey Ryabinin <a.ryabinin@samsung.com> */ -#define pr_fmt(fmt) "kasan test: %s " fmt, __func__ - #include <linux/bitops.h> #include <linux/delay.h> #include <linux/kasan.h> @@ -77,416 +75,327 @@ static void kasan_test_exit(struct kunit fail_data.report_found); \ } while (0) - - -/* - * Note: test functions are marked noinline so that their names appear in - * reports. - */ -static noinline void __init kmalloc_oob_right(void) +static void kmalloc_oob_right(struct kunit *test) { char *ptr; size_t size = 123; - pr_info("out-of-bounds to right\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } - - ptr[size + OOB_TAG_OFF] = 'x'; + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + KUNIT_EXPECT_KASAN_FAIL(test, ptr[size + OOB_TAG_OFF] = 'x'); kfree(ptr); } -static noinline void __init kmalloc_oob_left(void) +static void kmalloc_oob_left(struct kunit *test) { char *ptr; size_t size = 15; - pr_info("out-of-bounds to left\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); - *ptr = *(ptr - 1); + KUNIT_EXPECT_KASAN_FAIL(test, *ptr = *(ptr - 1)); kfree(ptr); } -static noinline void __init kmalloc_node_oob_right(void) +static void kmalloc_node_oob_right(struct kunit *test) { char *ptr; size_t size = 4096; - pr_info("kmalloc_node(): out-of-bounds to right\n"); ptr = kmalloc_node(size, GFP_KERNEL, 0); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); - ptr[size] = 0; + KUNIT_EXPECT_KASAN_FAIL(test, ptr[size] = 0); kfree(ptr); } -#ifdef CONFIG_SLUB -static noinline void __init kmalloc_pagealloc_oob_right(void) +static void kmalloc_pagealloc_oob_right(struct kunit *test) { char *ptr; size_t size = KMALLOC_MAX_CACHE_SIZE + 10; + if (!IS_ENABLED(CONFIG_SLUB)) { + kunit_info(test, "CONFIG_SLUB is not enabled."); + return; + } + /* Allocate a chunk that does not fit into a SLUB cache to trigger * the page allocator fallback. */ - pr_info("kmalloc pagealloc allocation: out-of-bounds to right\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } - - ptr[size + OOB_TAG_OFF] = 0; + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + KUNIT_EXPECT_KASAN_FAIL(test, ptr[size + OOB_TAG_OFF] = 0); kfree(ptr); } -static noinline void __init kmalloc_pagealloc_uaf(void) +static void kmalloc_pagealloc_uaf(struct kunit *test) { char *ptr; size_t size = KMALLOC_MAX_CACHE_SIZE + 10; - pr_info("kmalloc pagealloc allocation: use-after-free\n"); - ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); + if (!IS_ENABLED(CONFIG_SLUB)) { + kunit_info(test, "CONFIG_SLUB is not enabled."); return; } + ptr = kmalloc(size, GFP_KERNEL); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + kfree(ptr); - ptr[0] = 0; + KUNIT_EXPECT_KASAN_FAIL(test, ptr[0] = 0); } -static noinline void __init kmalloc_pagealloc_invalid_free(void) +static void kmalloc_pagealloc_invalid_free(struct kunit *test) { char *ptr; size_t size = KMALLOC_MAX_CACHE_SIZE + 10; - pr_info("kmalloc pagealloc allocation: invalid-free\n"); - ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); + if (!IS_ENABLED(CONFIG_SLUB)) { + kunit_info(test, "CONFIG_SLUB is not enabled."); return; } - kfree(ptr + 1); + ptr = kmalloc(size, GFP_KERNEL); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + + KUNIT_EXPECT_KASAN_FAIL(test, kfree(ptr + 1)); } -#endif -static noinline void __init kmalloc_large_oob_right(void) +static void kmalloc_large_oob_right(struct kunit *test) { char *ptr; size_t size = KMALLOC_MAX_CACHE_SIZE - 256; /* Allocate a chunk that is large enough, but still fits into a slab * and does not trigger the page allocator fallback in SLUB. */ - pr_info("kmalloc large allocation: out-of-bounds to right\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); - ptr[size] = 0; + KUNIT_EXPECT_KASAN_FAIL(test, ptr[size] = 0); kfree(ptr); } -static noinline void __init kmalloc_oob_krealloc_more(void) +static void kmalloc_oob_krealloc_more(struct kunit *test) { char *ptr1, *ptr2; size_t size1 = 17; size_t size2 = 19; - pr_info("out-of-bounds after krealloc more\n"); ptr1 = kmalloc(size1, GFP_KERNEL); - ptr2 = krealloc(ptr1, size2, GFP_KERNEL); - if (!ptr1 || !ptr2) { - pr_err("Allocation failed\n"); - kfree(ptr1); - kfree(ptr2); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr1); - ptr2[size2 + OOB_TAG_OFF] = 'x'; + ptr2 = krealloc(ptr1, size2, GFP_KERNEL); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr2); + KUNIT_EXPECT_KASAN_FAIL(test, ptr2[size2 + OOB_TAG_OFF] = 'x'); kfree(ptr2); } -static noinline void __init kmalloc_oob_krealloc_less(void) +static void kmalloc_oob_krealloc_less(struct kunit *test) { char *ptr1, *ptr2; size_t size1 = 17; size_t size2 = 15; - pr_info("out-of-bounds after krealloc less\n"); ptr1 = kmalloc(size1, GFP_KERNEL); - ptr2 = krealloc(ptr1, size2, GFP_KERNEL); - if (!ptr1 || !ptr2) { - pr_err("Allocation failed\n"); - kfree(ptr1); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr1); - ptr2[size2 + OOB_TAG_OFF] = 'x'; + ptr2 = krealloc(ptr1, size2, GFP_KERNEL); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr2); + KUNIT_EXPECT_KASAN_FAIL(test, ptr2[size2 + OOB_TAG_OFF] = 'x'); kfree(ptr2); } -static noinline void __init kmalloc_oob_16(void) +static void kmalloc_oob_16(struct kunit *test) { struct { u64 words[2]; } *ptr1, *ptr2; - pr_info("kmalloc out-of-bounds for 16-bytes access\n"); ptr1 = kmalloc(sizeof(*ptr1) - 3, GFP_KERNEL); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr1); + ptr2 = kmalloc(sizeof(*ptr2), GFP_KERNEL); - if (!ptr1 || !ptr2) { - pr_err("Allocation failed\n"); - kfree(ptr1); - kfree(ptr2); - return; - } - *ptr1 = *ptr2; + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr2); + + KUNIT_EXPECT_KASAN_FAIL(test, *ptr1 = *ptr2); kfree(ptr1); kfree(ptr2); } -static noinline void __init kmalloc_oob_memset_2(void) +static void kmalloc_oob_memset_2(struct kunit *test) { char *ptr; size_t size = 8; - pr_info("out-of-bounds in memset2\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } - - memset(ptr + 7 + OOB_TAG_OFF, 0, 2); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + KUNIT_EXPECT_KASAN_FAIL(test, memset(ptr + 7 + OOB_TAG_OFF, 0, 2)); kfree(ptr); } -static noinline void __init kmalloc_oob_memset_4(void) +static void kmalloc_oob_memset_4(struct kunit *test) { char *ptr; size_t size = 8; - pr_info("out-of-bounds in memset4\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } - - memset(ptr + 5 + OOB_TAG_OFF, 0, 4); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + KUNIT_EXPECT_KASAN_FAIL(test, memset(ptr + 5 + OOB_TAG_OFF, 0, 4)); kfree(ptr); } -static noinline void __init kmalloc_oob_memset_8(void) +static void kmalloc_oob_memset_8(struct kunit *test) { char *ptr; size_t size = 8; - pr_info("out-of-bounds in memset8\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } - - memset(ptr + 1 + OOB_TAG_OFF, 0, 8); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + KUNIT_EXPECT_KASAN_FAIL(test, memset(ptr + 1 + OOB_TAG_OFF, 0, 8)); kfree(ptr); } -static noinline void __init kmalloc_oob_memset_16(void) +static void kmalloc_oob_memset_16(struct kunit *test) { char *ptr; size_t size = 16; - pr_info("out-of-bounds in memset16\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } - - memset(ptr + 1 + OOB_TAG_OFF, 0, 16); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + KUNIT_EXPECT_KASAN_FAIL(test, memset(ptr + 1 + OOB_TAG_OFF, 0, 16)); kfree(ptr); } -static noinline void __init kmalloc_oob_in_memset(void) +static void kmalloc_oob_in_memset(struct kunit *test) { char *ptr; size_t size = 666; - pr_info("out-of-bounds in memset\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } - - memset(ptr, 0, size + 5 + OOB_TAG_OFF); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + KUNIT_EXPECT_KASAN_FAIL(test, memset(ptr, 0, size + 5 + OOB_TAG_OFF)); kfree(ptr); } -static noinline void __init kmalloc_memmove_invalid_size(void) +static void kmalloc_memmove_invalid_size(struct kunit *test) { char *ptr; size_t size = 64; volatile size_t invalid_size = -2; - pr_info("invalid size in memmove\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); memset((char *)ptr, 0, 64); - memmove((char *)ptr, (char *)ptr + 4, invalid_size); + + KUNIT_EXPECT_KASAN_FAIL(test, + memmove((char *)ptr, (char *)ptr + 4, invalid_size)); kfree(ptr); } -static noinline void __init kmalloc_uaf(void) +static void kmalloc_uaf(struct kunit *test) { char *ptr; size_t size = 10; - pr_info("use-after-free\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); kfree(ptr); - *(ptr + 8) = 'x'; + KUNIT_EXPECT_KASAN_FAIL(test, *(ptr + 8) = 'x'); } -static noinline void __init kmalloc_uaf_memset(void) +static void kmalloc_uaf_memset(struct kunit *test) { char *ptr; size_t size = 33; - pr_info("use-after-free in memset\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); kfree(ptr); - memset(ptr, 0, size); + KUNIT_EXPECT_KASAN_FAIL(test, memset(ptr, 0, size)); } -static noinline void __init kmalloc_uaf2(void) +static void kmalloc_uaf2(struct kunit *test) { char *ptr1, *ptr2; size_t size = 43; - pr_info("use-after-free after another kmalloc\n"); ptr1 = kmalloc(size, GFP_KERNEL); - if (!ptr1) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr1); kfree(ptr1); + ptr2 = kmalloc(size, GFP_KERNEL); - if (!ptr2) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr2); + + KUNIT_EXPECT_KASAN_FAIL(test, ptr1[40] = 'x'); + KUNIT_EXPECT_PTR_NE(test, ptr1, ptr2); - ptr1[40] = 'x'; - if (ptr1 == ptr2) - pr_err("Could not detect use-after-free: ptr1 == ptr2\n"); kfree(ptr2); } -static noinline void __init kfree_via_page(void) +static void kfree_via_page(struct kunit *test) { char *ptr; size_t size = 8; struct page *page; unsigned long offset; - pr_info("invalid-free false positive (via page)\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); page = virt_to_page(ptr); offset = offset_in_page(ptr); kfree(page_address(page) + offset); } -static noinline void __init kfree_via_phys(void) +static void kfree_via_phys(struct kunit *test) { char *ptr; size_t size = 8; phys_addr_t phys; - pr_info("invalid-free false positive (via phys)\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); phys = virt_to_phys(ptr); kfree(phys_to_virt(phys)); } -static noinline void __init kmem_cache_oob(void) +static void kmem_cache_oob(struct kunit *test) { char *p; size_t size = 200; struct kmem_cache *cache = kmem_cache_create("test_cache", size, 0, 0, NULL); - if (!cache) { - pr_err("Cache allocation failed\n"); - return; - } - pr_info("out-of-bounds in kmem_cache_alloc\n"); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, cache); p = kmem_cache_alloc(cache, GFP_KERNEL); if (!p) { - pr_err("Allocation failed\n"); + kunit_err(test, "Allocation failed: %s\n", __func__); kmem_cache_destroy(cache); return; } - *p = p[size + OOB_TAG_OFF]; - + KUNIT_EXPECT_KASAN_FAIL(test, *p = p[size + OOB_TAG_OFF]); kmem_cache_free(cache, p); kmem_cache_destroy(cache); } -static noinline void __init memcg_accounted_kmem_cache(void) +static void memcg_accounted_kmem_cache(struct kunit *test) { int i; char *p; @@ -494,12 +403,8 @@ static noinline void __init memcg_accoun struct kmem_cache *cache; cache = kmem_cache_create("test_cache", size, 0, SLAB_ACCOUNT, NULL); - if (!cache) { - pr_err("Cache allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, cache); - pr_info("allocate memcg accounted object\n"); /* * Several allocations with a delay to allow for lazy per memcg kmem * cache creation. @@ -519,134 +424,93 @@ free_cache: static char global_array[10]; -static noinline void __init kasan_global_oob(void) +static void kasan_global_oob(struct kunit *test) { volatile int i = 3; char *p = &global_array[ARRAY_SIZE(global_array) + i]; - pr_info("out-of-bounds global variable\n"); - *(volatile char *)p; -} - -static noinline void __init kasan_stack_oob(void) -{ - char stack_array[10]; - volatile int i = OOB_TAG_OFF; - char *p = &stack_array[ARRAY_SIZE(stack_array) + i]; - - pr_info("out-of-bounds on stack\n"); - *(volatile char *)p; + KUNIT_EXPECT_KASAN_FAIL(test, *(volatile char *)p); } -static noinline void __init ksize_unpoisons_memory(void) +static void ksize_unpoisons_memory(struct kunit *test) { char *ptr; size_t size = 123, real_size; - pr_info("ksize() unpoisons the whole allocated chunk\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); real_size = ksize(ptr); /* This access doesn't trigger an error. */ ptr[size] = 'x'; /* This one does. */ - ptr[real_size] = 'y'; + KUNIT_EXPECT_KASAN_FAIL(test, ptr[real_size] = 'y'); kfree(ptr); } -static noinline void __init copy_user_test(void) +static void kasan_stack_oob(struct kunit *test) { - char *kmem; - char __user *usermem; - size_t size = 10; - int unused; - - kmem = kmalloc(size, GFP_KERNEL); - if (!kmem) - return; + char stack_array[10]; + volatile int i = OOB_TAG_OFF; + char *p = &stack_array[ARRAY_SIZE(stack_array) + i]; - usermem = (char __user *)vm_mmap(NULL, 0, PAGE_SIZE, - PROT_READ | PROT_WRITE | PROT_EXEC, - MAP_ANONYMOUS | MAP_PRIVATE, 0); - if (IS_ERR(usermem)) { - pr_err("Failed to allocate user memory\n"); - kfree(kmem); + if (!IS_ENABLED(CONFIG_KASAN_STACK)) { + kunit_info(test, "CONFIG_KASAN_STACK is not enabled"); return; } - pr_info("out-of-bounds in copy_from_user()\n"); - unused = copy_from_user(kmem, usermem, size + 1 + OOB_TAG_OFF); - - pr_info("out-of-bounds in copy_to_user()\n"); - unused = copy_to_user(usermem, kmem, size + 1 + OOB_TAG_OFF); - - pr_info("out-of-bounds in __copy_from_user()\n"); - unused = __copy_from_user(kmem, usermem, size + 1 + OOB_TAG_OFF); - - pr_info("out-of-bounds in __copy_to_user()\n"); - unused = __copy_to_user(usermem, kmem, size + 1 + OOB_TAG_OFF); - - pr_info("out-of-bounds in __copy_from_user_inatomic()\n"); - unused = __copy_from_user_inatomic(kmem, usermem, size + 1 + OOB_TAG_OFF); - - pr_info("out-of-bounds in __copy_to_user_inatomic()\n"); - unused = __copy_to_user_inatomic(usermem, kmem, size + 1 + OOB_TAG_OFF); - - pr_info("out-of-bounds in strncpy_from_user()\n"); - unused = strncpy_from_user(kmem, usermem, size + 1 + OOB_TAG_OFF); - - vm_munmap((unsigned long)usermem, PAGE_SIZE); - kfree(kmem); + KUNIT_EXPECT_KASAN_FAIL(test, *(volatile char *)p); } -static noinline void __init kasan_alloca_oob_left(void) +static void kasan_alloca_oob_left(struct kunit *test) { volatile int i = 10; char alloca_array[i]; char *p = alloca_array - 1; - pr_info("out-of-bounds to left on alloca\n"); - *(volatile char *)p; + if (!IS_ENABLED(CONFIG_KASAN_STACK)) { + kunit_info(test, "CONFIG_KASAN_STACK is not enabled"); + return; + } + + KUNIT_EXPECT_KASAN_FAIL(test, *(volatile char *)p); } -static noinline void __init kasan_alloca_oob_right(void) +static void kasan_alloca_oob_right(struct kunit *test) { volatile int i = 10; char alloca_array[i]; char *p = alloca_array + i; - pr_info("out-of-bounds to right on alloca\n"); - *(volatile char *)p; + if (!IS_ENABLED(CONFIG_KASAN_STACK)) { + kunit_info(test, "CONFIG_KASAN_STACK is not enabled"); + return; + } + + KUNIT_EXPECT_KASAN_FAIL(test, *(volatile char *)p); } -static noinline void __init kmem_cache_double_free(void) +static void kmem_cache_double_free(struct kunit *test) { char *p; size_t size = 200; struct kmem_cache *cache; cache = kmem_cache_create("test_cache", size, 0, 0, NULL); - if (!cache) { - pr_err("Cache allocation failed\n"); - return; - } - pr_info("double-free on heap object\n"); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, cache); + p = kmem_cache_alloc(cache, GFP_KERNEL); if (!p) { - pr_err("Allocation failed\n"); + kunit_err(test, "Allocation failed: %s\n", __func__); kmem_cache_destroy(cache); return; } kmem_cache_free(cache, p); - kmem_cache_free(cache, p); + KUNIT_EXPECT_KASAN_FAIL(test, kmem_cache_free(cache, p)); kmem_cache_destroy(cache); } -static noinline void __init kmem_cache_invalid_free(void) +static void kmem_cache_invalid_free(struct kunit *test) { char *p; size_t size = 200; @@ -654,20 +518,17 @@ static noinline void __init kmem_cache_i cache = kmem_cache_create("test_cache", size, 0, SLAB_TYPESAFE_BY_RCU, NULL); - if (!cache) { - pr_err("Cache allocation failed\n"); - return; - } - pr_info("invalid-free of heap object\n"); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, cache); + p = kmem_cache_alloc(cache, GFP_KERNEL); if (!p) { - pr_err("Allocation failed\n"); + kunit_err(test, "Allocation failed: %s\n", __func__); kmem_cache_destroy(cache); return; } /* Trigger invalid free, the object doesn't get freed */ - kmem_cache_free(cache, p + 1); + KUNIT_EXPECT_KASAN_FAIL(test, kmem_cache_free(cache, p + 1)); /* * Properly free the object to prevent the "Objects remaining in @@ -678,45 +539,63 @@ static noinline void __init kmem_cache_i kmem_cache_destroy(cache); } -static noinline void __init kasan_memchr(void) +static void kasan_memchr(struct kunit *test) { char *ptr; size_t size = 24; - pr_info("out-of-bounds in memchr\n"); - ptr = kmalloc(size, GFP_KERNEL | __GFP_ZERO); - if (!ptr) + /* See https://bugzilla.kernel.org/show_bug.cgi?id=206337 */ + if (IS_ENABLED(CONFIG_AMD_MEM_ENCRYPT)) { + kunit_info(test, + "str* functions are not instrumented with CONFIG_AMD_MEM_ENCRYPT"); return; + } + + ptr = kmalloc(size, GFP_KERNEL | __GFP_ZERO); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); + + KUNIT_EXPECT_KASAN_FAIL(test, + kasan_ptr_result = memchr(ptr, '1', size + 1)); - kasan_ptr_result = memchr(ptr, '1', size + 1); kfree(ptr); } -static noinline void __init kasan_memcmp(void) +static void kasan_memcmp(struct kunit *test) { char *ptr; size_t size = 24; int arr[9]; - pr_info("out-of-bounds in memcmp\n"); - ptr = kmalloc(size, GFP_KERNEL | __GFP_ZERO); - if (!ptr) + /* See https://bugzilla.kernel.org/show_bug.cgi?id=206337 */ + if (IS_ENABLED(CONFIG_AMD_MEM_ENCRYPT)) { + kunit_info(test, + "str* functions are not instrumented with CONFIG_AMD_MEM_ENCRYPT"); return; + } + ptr = kmalloc(size, GFP_KERNEL | __GFP_ZERO); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); memset(arr, 0, sizeof(arr)); - kasan_int_result = memcmp(ptr, arr, size + 1); + + KUNIT_EXPECT_KASAN_FAIL(test, + kasan_int_result = memcmp(ptr, arr, size+1)); kfree(ptr); } -static noinline void __init kasan_strings(void) +static void kasan_strings(struct kunit *test) { char *ptr; size_t size = 24; - pr_info("use-after-free in strchr\n"); - ptr = kmalloc(size, GFP_KERNEL | __GFP_ZERO); - if (!ptr) + /* See https://bugzilla.kernel.org/show_bug.cgi?id=206337 */ + if (IS_ENABLED(CONFIG_AMD_MEM_ENCRYPT)) { + kunit_info(test, + "str* functions are not instrumented with CONFIG_AMD_MEM_ENCRYPT"); return; + } + + ptr = kmalloc(size, GFP_KERNEL | __GFP_ZERO); + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); kfree(ptr); @@ -727,220 +606,164 @@ static noinline void __init kasan_string * will likely point to zeroed byte. */ ptr += 16; - kasan_ptr_result = strchr(ptr, '1'); + KUNIT_EXPECT_KASAN_FAIL(test, kasan_ptr_result = strchr(ptr, '1')); - pr_info("use-after-free in strrchr\n"); - kasan_ptr_result = strrchr(ptr, '1'); + KUNIT_EXPECT_KASAN_FAIL(test, kasan_ptr_result = strrchr(ptr, '1')); - pr_info("use-after-free in strcmp\n"); - kasan_int_result = strcmp(ptr, "2"); + KUNIT_EXPECT_KASAN_FAIL(test, kasan_int_result = strcmp(ptr, "2")); - pr_info("use-after-free in strncmp\n"); - kasan_int_result = strncmp(ptr, "2", 1); + KUNIT_EXPECT_KASAN_FAIL(test, kasan_int_result = strncmp(ptr, "2", 1)); - pr_info("use-after-free in strlen\n"); - kasan_int_result = strlen(ptr); + KUNIT_EXPECT_KASAN_FAIL(test, kasan_int_result = strlen(ptr)); - pr_info("use-after-free in strnlen\n"); - kasan_int_result = strnlen(ptr, 1); + KUNIT_EXPECT_KASAN_FAIL(test, kasan_int_result = strnlen(ptr, 1)); } -static noinline void __init kasan_bitops(void) +static void kasan_bitops(struct kunit *test) { /* * Allocate 1 more byte, which causes kzalloc to round up to 16-bytes; * this way we do not actually corrupt other memory. */ long *bits = kzalloc(sizeof(*bits) + 1, GFP_KERNEL); - if (!bits) - return; + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, bits); /* * Below calls try to access bit within allocated memory; however, the * below accesses are still out-of-bounds, since bitops are defined to * operate on the whole long the bit is in. */ - pr_info("out-of-bounds in set_bit\n"); - set_bit(BITS_PER_LONG, bits); + KUNIT_EXPECT_KASAN_FAIL(test, set_bit(BITS_PER_LONG, bits)); - pr_info("out-of-bounds in __set_bit\n"); - __set_bit(BITS_PER_LONG, bits); + KUNIT_EXPECT_KASAN_FAIL(test, __set_bit(BITS_PER_LONG, bits)); - pr_info("out-of-bounds in clear_bit\n"); - clear_bit(BITS_PER_LONG, bits); + KUNIT_EXPECT_KASAN_FAIL(test, clear_bit(BITS_PER_LONG, bits)); - pr_info("out-of-bounds in __clear_bit\n"); - __clear_bit(BITS_PER_LONG, bits); + KUNIT_EXPECT_KASAN_FAIL(test, __clear_bit(BITS_PER_LONG, bits)); - pr_info("out-of-bounds in clear_bit_unlock\n"); - clear_bit_unlock(BITS_PER_LONG, bits); + KUNIT_EXPECT_KASAN_FAIL(test, clear_bit_unlock(BITS_PER_LONG, bits)); - pr_info("out-of-bounds in __clear_bit_unlock\n"); - __clear_bit_unlock(BITS_PER_LONG, bits); + KUNIT_EXPECT_KASAN_FAIL(test, __clear_bit_unlock(BITS_PER_LONG, bits)); - pr_info("out-of-bounds in change_bit\n"); - change_bit(BITS_PER_LONG, bits); + KUNIT_EXPECT_KASAN_FAIL(test, change_bit(BITS_PER_LONG, bits)); - pr_info("out-of-bounds in __change_bit\n"); - __change_bit(BITS_PER_LONG, bits); + KUNIT_EXPECT_KASAN_FAIL(test, __change_bit(BITS_PER_LONG, bits)); /* * Below calls try to access bit beyond allocated memory. */ - pr_info("out-of-bounds in test_and_set_bit\n"); - test_and_set_bit(BITS_PER_LONG + BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + test_and_set_bit(BITS_PER_LONG + BITS_PER_BYTE, bits)); - pr_info("out-of-bounds in __test_and_set_bit\n"); - __test_and_set_bit(BITS_PER_LONG + BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + __test_and_set_bit(BITS_PER_LONG + BITS_PER_BYTE, bits)); - pr_info("out-of-bounds in test_and_set_bit_lock\n"); - test_and_set_bit_lock(BITS_PER_LONG + BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + test_and_set_bit_lock(BITS_PER_LONG + BITS_PER_BYTE, bits)); - pr_info("out-of-bounds in test_and_clear_bit\n"); - test_and_clear_bit(BITS_PER_LONG + BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + test_and_clear_bit(BITS_PER_LONG + BITS_PER_BYTE, bits)); - pr_info("out-of-bounds in __test_and_clear_bit\n"); - __test_and_clear_bit(BITS_PER_LONG + BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + __test_and_clear_bit(BITS_PER_LONG + BITS_PER_BYTE, bits)); - pr_info("out-of-bounds in test_and_change_bit\n"); - test_and_change_bit(BITS_PER_LONG + BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + test_and_change_bit(BITS_PER_LONG + BITS_PER_BYTE, bits)); - pr_info("out-of-bounds in __test_and_change_bit\n"); - __test_and_change_bit(BITS_PER_LONG + BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + __test_and_change_bit(BITS_PER_LONG + BITS_PER_BYTE, bits)); - pr_info("out-of-bounds in test_bit\n"); - kasan_int_result = test_bit(BITS_PER_LONG + BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + kasan_int_result = + test_bit(BITS_PER_LONG + BITS_PER_BYTE, bits)); #if defined(clear_bit_unlock_is_negative_byte) - pr_info("out-of-bounds in clear_bit_unlock_is_negative_byte\n"); - kasan_int_result = clear_bit_unlock_is_negative_byte(BITS_PER_LONG + - BITS_PER_BYTE, bits); + KUNIT_EXPECT_KASAN_FAIL(test, + kasan_int_result = clear_bit_unlock_is_negative_byte( + BITS_PER_LONG + BITS_PER_BYTE, bits)); #endif kfree(bits); } -static noinline void __init kmalloc_double_kzfree(void) +static void kmalloc_double_kzfree(struct kunit *test) { char *ptr; size_t size = 16; - pr_info("double-free (kfree_sensitive)\n"); ptr = kmalloc(size, GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, ptr); kfree_sensitive(ptr); - kfree_sensitive(ptr); + KUNIT_EXPECT_KASAN_FAIL(test, kfree_sensitive(ptr)); } -#ifdef CONFIG_KASAN_VMALLOC -static noinline void __init vmalloc_oob(void) +static void vmalloc_oob(struct kunit *test) { void *area; - pr_info("vmalloc out-of-bounds\n"); + if (!IS_ENABLED(CONFIG_KASAN_VMALLOC)) { + kunit_info(test, "CONFIG_KASAN_VMALLOC is not enabled."); + return; + } /* * We have to be careful not to hit the guard page. * The MMU will catch that and crash us. */ area = vmalloc(3000); - if (!area) { - pr_err("Allocation failed\n"); - return; - } + KUNIT_ASSERT_NOT_ERR_OR_NULL(test, area); - ((volatile char *)area)[3100]; + KUNIT_EXPECT_KASAN_FAIL(test, ((volatile char *)area)[3100]); vfree(area); } -#else -static void __init vmalloc_oob(void) {} -#endif - -static struct kasan_rcu_info { - int i; - struct rcu_head rcu; -} *global_rcu_ptr; - -static noinline void __init kasan_rcu_reclaim(struct rcu_head *rp) -{ - struct kasan_rcu_info *fp = container_of(rp, - struct kasan_rcu_info, rcu); - - kfree(fp); - fp->i = 1; -} - -static noinline void __init kasan_rcu_uaf(void) -{ - struct kasan_rcu_info *ptr; - pr_info("use-after-free in kasan_rcu_reclaim\n"); - ptr = kmalloc(sizeof(struct kasan_rcu_info), GFP_KERNEL); - if (!ptr) { - pr_err("Allocation failed\n"); - return; - } - - global_rcu_ptr = rcu_dereference_protected(ptr, NULL); - call_rcu(&global_rcu_ptr->rcu, kasan_rcu_reclaim); -} +static struct kunit_case kasan_kunit_test_cases[] = { + KUNIT_CASE(kmalloc_oob_right), + KUNIT_CASE(kmalloc_oob_left), + KUNIT_CASE(kmalloc_node_oob_right), + KUNIT_CASE(kmalloc_pagealloc_oob_right), + KUNIT_CASE(kmalloc_pagealloc_uaf), + KUNIT_CASE(kmalloc_pagealloc_invalid_free), + KUNIT_CASE(kmalloc_large_oob_right), + KUNIT_CASE(kmalloc_oob_krealloc_more), + KUNIT_CASE(kmalloc_oob_krealloc_less), + KUNIT_CASE(kmalloc_oob_16), + KUNIT_CASE(kmalloc_oob_in_memset), + KUNIT_CASE(kmalloc_oob_memset_2), + KUNIT_CASE(kmalloc_oob_memset_4), + KUNIT_CASE(kmalloc_oob_memset_8), + KUNIT_CASE(kmalloc_oob_memset_16), + KUNIT_CASE(kmalloc_memmove_invalid_size), + KUNIT_CASE(kmalloc_uaf), + KUNIT_CASE(kmalloc_uaf_memset), + KUNIT_CASE(kmalloc_uaf2), + KUNIT_CASE(kfree_via_page), + KUNIT_CASE(kfree_via_phys), + KUNIT_CASE(kmem_cache_oob), + KUNIT_CASE(memcg_accounted_kmem_cache), + KUNIT_CASE(kasan_global_oob), + KUNIT_CASE(kasan_stack_oob), + KUNIT_CASE(kasan_alloca_oob_left), + KUNIT_CASE(kasan_alloca_oob_right), + KUNIT_CASE(ksize_unpoisons_memory), + KUNIT_CASE(kmem_cache_double_free), + KUNIT_CASE(kmem_cache_invalid_free), + KUNIT_CASE(kasan_memchr), + KUNIT_CASE(kasan_memcmp), + KUNIT_CASE(kasan_strings), + KUNIT_CASE(kasan_bitops), + KUNIT_CASE(kmalloc_double_kzfree), + KUNIT_CASE(vmalloc_oob), + {} +}; + +static struct kunit_suite kasan_kunit_test_suite = { + .name = "kasan", + .init = kasan_test_init, + .test_cases = kasan_kunit_test_cases, + .exit = kasan_test_exit, +}; -static int __init kmalloc_tests_init(void) -{ - /* - * Temporarily enable multi-shot mode. Otherwise, we'd only get a - * report for the first case. - */ - bool multishot = kasan_save_enable_multi_shot(); - - kmalloc_oob_right(); - kmalloc_oob_left(); - kmalloc_node_oob_right(); -#ifdef CONFIG_SLUB - kmalloc_pagealloc_oob_right(); - kmalloc_pagealloc_uaf(); - kmalloc_pagealloc_invalid_free(); -#endif - kmalloc_large_oob_right(); - kmalloc_oob_krealloc_more(); - kmalloc_oob_krealloc_less(); - kmalloc_oob_16(); - kmalloc_oob_in_memset(); - kmalloc_oob_memset_2(); - kmalloc_oob_memset_4(); - kmalloc_oob_memset_8(); - kmalloc_oob_memset_16(); - kmalloc_memmove_invalid_size(); - kmalloc_uaf(); - kmalloc_uaf_memset(); - kmalloc_uaf2(); - kfree_via_page(); - kfree_via_phys(); - kmem_cache_oob(); - memcg_accounted_kmem_cache(); - kasan_stack_oob(); - kasan_global_oob(); - kasan_alloca_oob_left(); - kasan_alloca_oob_right(); - ksize_unpoisons_memory(); - copy_user_test(); - kmem_cache_double_free(); - kmem_cache_invalid_free(); - kasan_memchr(); - kasan_memcmp(); - kasan_strings(); - kasan_bitops(); - kmalloc_double_kzfree(); - vmalloc_oob(); - kasan_rcu_uaf(); - - kasan_restore_multi_shot(multishot); - - return -EAGAIN; -} +kunit_test_suite(kasan_kunit_test_suite); -module_init(kmalloc_tests_init); MODULE_LICENSE("GPL"); --- /dev/null +++ a/lib/test_kasan_module.c @@ -0,0 +1,111 @@ +// SPDX-License-Identifier: GPL-2.0-only +/* + * + * Copyright (c) 2014 Samsung Electronics Co., Ltd. + * Author: Andrey Ryabinin <a.ryabinin@samsung.com> + */ + +#define pr_fmt(fmt) "kasan test: %s " fmt, __func__ + +#include <linux/mman.h> +#include <linux/module.h> +#include <linux/printk.h> +#include <linux/slab.h> +#include <linux/uaccess.h> + +#include "../mm/kasan/kasan.h" + +#define OOB_TAG_OFF (IS_ENABLED(CONFIG_KASAN_GENERIC) ? 0 : KASAN_SHADOW_SCALE_SIZE) + +static noinline void __init copy_user_test(void) +{ + char *kmem; + char __user *usermem; + size_t size = 10; + int unused; + + kmem = kmalloc(size, GFP_KERNEL); + if (!kmem) + return; + + usermem = (char __user *)vm_mmap(NULL, 0, PAGE_SIZE, + PROT_READ | PROT_WRITE | PROT_EXEC, + MAP_ANONYMOUS | MAP_PRIVATE, 0); + if (IS_ERR(usermem)) { + pr_err("Failed to allocate user memory\n"); + kfree(kmem); + return; + } + + pr_info("out-of-bounds in copy_from_user()\n"); + unused = copy_from_user(kmem, usermem, size + 1 + OOB_TAG_OFF); + + pr_info("out-of-bounds in copy_to_user()\n"); + unused = copy_to_user(usermem, kmem, size + 1 + OOB_TAG_OFF); + + pr_info("out-of-bounds in __copy_from_user()\n"); + unused = __copy_from_user(kmem, usermem, size + 1 + OOB_TAG_OFF); + + pr_info("out-of-bounds in __copy_to_user()\n"); + unused = __copy_to_user(usermem, kmem, size + 1 + OOB_TAG_OFF); + + pr_info("out-of-bounds in __copy_from_user_inatomic()\n"); + unused = __copy_from_user_inatomic(kmem, usermem, size + 1 + OOB_TAG_OFF); + + pr_info("out-of-bounds in __copy_to_user_inatomic()\n"); + unused = __copy_to_user_inatomic(usermem, kmem, size + 1 + OOB_TAG_OFF); + + pr_info("out-of-bounds in strncpy_from_user()\n"); + unused = strncpy_from_user(kmem, usermem, size + 1 + OOB_TAG_OFF); + + vm_munmap((unsigned long)usermem, PAGE_SIZE); + kfree(kmem); +} + +static struct kasan_rcu_info { + int i; + struct rcu_head rcu; +} *global_rcu_ptr; + +static noinline void __init kasan_rcu_reclaim(struct rcu_head *rp) +{ + struct kasan_rcu_info *fp = container_of(rp, + struct kasan_rcu_info, rcu); + + kfree(fp); + fp->i = 1; +} + +static noinline void __init kasan_rcu_uaf(void) +{ + struct kasan_rcu_info *ptr; + + pr_info("use-after-free in kasan_rcu_reclaim\n"); + ptr = kmalloc(sizeof(struct kasan_rcu_info), GFP_KERNEL); + if (!ptr) { + pr_err("Allocation failed\n"); + return; + } + + global_rcu_ptr = rcu_dereference_protected(ptr, NULL); + call_rcu(&global_rcu_ptr->rcu, kasan_rcu_reclaim); +} + + +static int __init test_kasan_module_init(void) +{ + /* + * Temporarily enable multi-shot mode. Otherwise, we'd only get a + * report for the first case. + */ + bool multishot = kasan_save_enable_multi_shot(); + + copy_user_test(); + kasan_rcu_uaf(); + + kasan_restore_multi_shot(multishot); + return -EAGAIN; +} + +module_init(test_kasan_module_init); +MODULE_LICENSE("GPL"); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 123/181] KASAN: Testing Documentation 2020-10-13 23:46 incoming Andrew Morton ` (121 preceding siblings ...) 2020-10-13 23:55 ` [patch 122/181] KASAN: port KASAN Tests to KUnit Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 124/181] mm: kasan: do not panic if both panic_on_warn and kasan_multishot set Andrew Morton ` (57 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: a.p.zijlstra, akpm, andreyknvl, aryabinin, brendanhiggins, davidgow, dvyukov, juri.lelli, linux-mm, mingo, mm-commits, shuah, torvalds, trishalfonso, vincent.guittot From: Patricia Alfonso <trishalfonso@google.com> Subject: KASAN: Testing Documentation Include documentation on how to test KASAN using CONFIG_TEST_KASAN_KUNIT and CONFIG_TEST_KASAN_MODULE. Link: https://lkml.kernel.org/r/20200915035828.570483-5-davidgow@google.com Link: https://lkml.kernel.org/r/20200910070331.3358048-5-davidgow@google.com Signed-off-by: Patricia Alfonso <trishalfonso@google.com> Signed-off-by: David Gow <davidgow@google.com> Reviewed-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Dmitry Vyukov <dvyukov@google.com> Acked-by: Brendan Higgins <brendanhiggins@google.com> Tested-by: Andrey Konovalov <andreyknvl@google.com> Cc: Andrey Ryabinin <aryabinin@virtuozzo.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Juri Lelli <juri.lelli@redhat.com> Cc: Peter Zijlstra <a.p.zijlstra@chello.nl> Cc: Shuah Khan <shuah@kernel.org> Cc: Vincent Guittot <vincent.guittot@linaro.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/dev-tools/kasan.rst | 70 ++++++++++++++++++++++++++++ 1 file changed, 70 insertions(+) --- a/Documentation/dev-tools/kasan.rst~kasan-testing-documentation +++ a/Documentation/dev-tools/kasan.rst @@ -281,3 +281,73 @@ unmapped. This will require changes in a This allows ``VMAP_STACK`` support on x86, and can simplify support of architectures that do not have a fixed module region. + +CONFIG_KASAN_KUNIT_TEST & CONFIG_TEST_KASAN_MODULE +-------------------------------------------------- + +``CONFIG_KASAN_KUNIT_TEST`` utilizes the KUnit Test Framework for testing. +This means each test focuses on a small unit of functionality and +there are a few ways these tests can be run. + +Each test will print the KASAN report if an error is detected and then +print the number of the test and the status of the test: + +pass:: + + ok 28 - kmalloc_double_kzfree +or, if kmalloc failed:: + + # kmalloc_large_oob_right: ASSERTION FAILED at lib/test_kasan.c:163 + Expected ptr is not null, but is + not ok 4 - kmalloc_large_oob_right +or, if a KASAN report was expected, but not found:: + + # kmalloc_double_kzfree: EXPECTATION FAILED at lib/test_kasan.c:629 + Expected kasan_data->report_expected == kasan_data->report_found, but + kasan_data->report_expected == 1 + kasan_data->report_found == 0 + not ok 28 - kmalloc_double_kzfree + +All test statuses are tracked as they run and an overall status will +be printed at the end:: + + ok 1 - kasan + +or:: + + not ok 1 - kasan + +(1) Loadable Module +~~~~~~~~~~~~~~~~~~~~ + +With ``CONFIG_KUNIT`` enabled, ``CONFIG_KASAN_KUNIT_TEST`` can be built as +a loadable module and run on any architecture that supports KASAN +using something like insmod or modprobe. The module is called ``test_kasan``. + +(2) Built-In +~~~~~~~~~~~~~ + +With ``CONFIG_KUNIT`` built-in, ``CONFIG_KASAN_KUNIT_TEST`` can be built-in +on any architecure that supports KASAN. These and any other KUnit +tests enabled will run and print the results at boot as a late-init +call. + +(3) Using kunit_tool +~~~~~~~~~~~~~~~~~~~~~ + +With ``CONFIG_KUNIT`` and ``CONFIG_KASAN_KUNIT_TEST`` built-in, we can also +use kunit_tool to see the results of these along with other KUnit +tests in a more readable way. This will not print the KASAN reports +of tests that passed. Use `KUnit documentation <https://www.kernel.org/doc/html/latest/dev-tools/kunit/index.html>`_ for more up-to-date +information on kunit_tool. + +.. _KUnit: https://www.kernel.org/doc/html/latest/dev-tools/kunit/index.html + +``CONFIG_TEST_KASAN_MODULE`` is a set of KASAN tests that could not be +converted to KUnit. These tests can be run only as a module with +``CONFIG_TEST_KASAN_MODULE`` built as a loadable module and +``CONFIG_KASAN`` built-in. The type of error expected and the +function being run is printed before the expression expected to give +an error. Then the error is printed, if found, and that test +should be interpretted to pass only if the error was the one expected +by the test. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 124/181] mm: kasan: do not panic if both panic_on_warn and kasan_multishot set 2020-10-13 23:46 incoming Andrew Morton ` (122 preceding siblings ...) 2020-10-13 23:55 ` [patch 123/181] KASAN: Testing Documentation Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 125/181] mm/page_alloc: tweak comments in has_unmovable_pages() Andrew Morton ` (56 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: a.p.zijlstra, akpm, andreyknvl, aryabinin, brendanhiggins, davidgow, dvyukov, juri.lelli, linux-mm, mingo, mm-commits, shuah, torvalds, trishalfonso, vincent.guittot From: David Gow <davidgow@google.com> Subject: mm: kasan: do not panic if both panic_on_warn and kasan_multishot set KASAN errors will currently trigger a panic when panic_on_warn is set. This renders kasan_multishot useless, as further KASAN errors won't be reported if the kernel has already paniced. By making kasan_multishot disable this behaviour for KASAN errors, we can still have the benefits of panic_on_warn for non-KASAN warnings, yet be able to use kasan_multishot. This is particularly important when running KASAN tests, which need to trigger multiple KASAN errors: previously these would panic the system if panic_on_warn was set, now they can run (and will panic the system should non-KASAN warnings show up). Link: https://lkml.kernel.org/r/20200915035828.570483-6-davidgow@google.com Link: https://lkml.kernel.org/r/20200910070331.3358048-6-davidgow@google.com Signed-off-by: David Gow <davidgow@google.com> Reviewed-by: Andrey Konovalov <andreyknvl@google.com> Reviewed-by: Brendan Higgins <brendanhiggins@google.com> Tested-by: Andrey Konovalov <andreyknvl@google.com> Cc: Andrey Ryabinin <aryabinin@virtuozzo.com> Cc: Dmitry Vyukov <dvyukov@google.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Juri Lelli <juri.lelli@redhat.com> Cc: Patricia Alfonso <trishalfonso@google.com> Cc: Peter Zijlstra <a.p.zijlstra@chello.nl> Cc: Shuah Khan <shuah@kernel.org> Cc: Vincent Guittot <vincent.guittot@linaro.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/kasan/report.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/kasan/report.c~mm-kasan-do-not-panic-if-both-panic_on_warn-and-kasan_multishot-set +++ a/mm/kasan/report.c @@ -95,7 +95,7 @@ static void end_report(unsigned long *fl pr_err("==================================================================\n"); add_taint(TAINT_BAD_PAGE, LOCKDEP_NOW_UNRELIABLE); spin_unlock_irqrestore(&report_lock, *flags); - if (panic_on_warn) { + if (panic_on_warn && !test_bit(KASAN_BIT_MULTI_SHOT, &kasan_flags)) { /* * This thread may hit another WARN() in the panic path. * Resetting this prevents additional WARN() from panicking the _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 125/181] mm/page_alloc: tweak comments in has_unmovable_pages() 2020-10-13 23:46 incoming Andrew Morton ` (123 preceding siblings ...) 2020-10-13 23:55 ` [patch 124/181] mm: kasan: do not panic if both panic_on_warn and kasan_multishot set Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 126/181] mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate() Andrew Morton ` (55 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, bhe, cai, david, jasowang, linux-mm, mhocko, mike.kravetz, mm-commits, mst, pankaj.gupta.linux, rppt, torvalds From: David Hildenbrand <david@redhat.com> Subject: mm/page_alloc: tweak comments in has_unmovable_pages() Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5. When introducing virtio-mem, the semantics of ZONE_MOVABLE were rather unclear, which is why we special-cased ZONE_MOVABLE such that partially plugged blocks would never end up in ZONE_MOVABLE. Now that the semantics are much clearer (and are documented in patch #6), let's support partially plugged memory blocks in ZONE_MOVABLE, allowing partially plugged memory blocks to be online to ZONE_MOVABLE and also unplugging from such memory blocks. This avoids surprises when onlining of memory blocks suddenly fails, just because they are not completely populated by virtio-mem (yet). This is especially helpful for testing, but also paves the way for virtio-mem optimizations, allowing more memory to get reliably unplugged. Cleanup has_unmovable_pages() and set_migratetype_isolate(), providing better documentation of how ZONE_MOVABLE interacts with different kind of unmovable pages (memory offlining vs. alloc_contig_range()). This patch (of 6): Let's move the split comment regarding bootmem allocations and memory holes, especially in the context of ZONE_MOVABLE, to the PageReserved() check. Link: http://lkml.kernel.org/r/20200816125333.7434-1-david@redhat.com Link: http://lkml.kernel.org/r/20200816125333.7434-2-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Reviewed-by: Baoquan He <bhe@redhat.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Michael S. Tsirkin <mst@redhat.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Pankaj Gupta <pankaj.gupta.linux@gmail.com> Cc: Jason Wang <jasowang@redhat.com> Cc: Mike Rapoport <rppt@kernel.org> Cc: Qian Cai <cai@lca.pw> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 22 ++++++---------------- 1 file changed, 6 insertions(+), 16 deletions(-) --- a/mm/page_alloc.c~mm-page_alloc-tweak-comments-in-has_unmovable_pages +++ a/mm/page_alloc.c @@ -8235,14 +8235,6 @@ struct page *has_unmovable_pages(struct unsigned long iter = 0; unsigned long pfn = page_to_pfn(page); - /* - * TODO we could make this much more efficient by not checking every - * page in the range if we know all of them are in MOVABLE_ZONE and - * that the movable zone guarantees that pages are migratable but - * the later is not the case right now unfortunatelly. E.g. movablecore - * can still lead to having bootmem allocations in zone_movable. - */ - if (is_migrate_cma_page(page)) { /* * CMA allocations (alloc_contig_range) really need to mark @@ -8261,6 +8253,12 @@ struct page *has_unmovable_pages(struct page = pfn_to_page(pfn + iter); + /* + * Both, bootmem allocations and memory holes are marked + * PG_reserved and are unmovable. We can even have unmovable + * allocations inside ZONE_MOVABLE, for example when + * specifying "movablecore". + */ if (PageReserved(page)) return page; @@ -8334,14 +8332,6 @@ struct page *has_unmovable_pages(struct * it. But now, memory offline itself doesn't call * shrink_node_slabs() and it still to be fixed. */ - /* - * If the page is not RAM, page_count()should be 0. - * we don't need more check. This is an _used_ not-movable page. - * - * The problematic thing here is PG_reserved pages. PG_reserved - * is set to both of a memory hole page and a _used_ kernel - * page at boot. - */ return page; } return NULL; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 126/181] mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate() 2020-10-13 23:46 incoming Andrew Morton ` (124 preceding siblings ...) 2020-10-13 23:55 ` [patch 125/181] mm/page_alloc: tweak comments in has_unmovable_pages() Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 127/181] mm/page_isolation: drop WARN_ON_ONCE() " Andrew Morton ` (54 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, bhe, cai, david, jasowang, linux-mm, mhocko, mike.kravetz, mm-commits, mst, pankaj.gupta.linux, rppt, torvalds From: David Hildenbrand <david@redhat.com> Subject: mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate() Right now, if we have two isolations racing on a pageblock that's in the MOVABLE zone, we would trigger the WARN_ON_ONCE(). Let's just return directly, simplifying error handling. The change was introduced in commit 3d680bdf60a5 ("mm/page_isolation: fix potential warning from user"). As far as I can see, we currently don't have alloc_contig_range() users that use the ZONE_MOVABLE (anymore), so it's currently more a cleanup and a preparation for the future than a fix. Link: http://lkml.kernel.org/r/20200816125333.7434-3-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Reviewed-by: Baoquan He <bhe@redhat.com> Reviewed-by: Pankaj Gupta <pankaj.gupta.linux@gmail.com> Acked-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Michael S. Tsirkin <mst@redhat.com> Cc: Qian Cai <cai@lca.pw> Cc: Jason Wang <jasowang@redhat.com> Cc: Mike Rapoport <rppt@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_isolation.c | 9 +++++---- 1 file changed, 5 insertions(+), 4 deletions(-) --- a/mm/page_isolation.c~mm-page_isolation-exit-early-when-pageblock-is-isolated-in-set_migratetype_isolate +++ a/mm/page_isolation.c @@ -29,10 +29,12 @@ static int set_migratetype_isolate(struc /* * We assume the caller intended to SET migrate type to isolate. * If it is already set, then someone else must have raced and - * set it before us. Return -EBUSY + * set it before us. */ - if (is_migrate_isolate_page(page)) - goto out; + if (is_migrate_isolate_page(page)) { + spin_unlock_irqrestore(&zone->lock, flags); + return -EBUSY; + } /* * FIXME: Now, memory hotplug doesn't call shrink_slab() by itself. @@ -52,7 +54,6 @@ static int set_migratetype_isolate(struc ret = 0; } -out: spin_unlock_irqrestore(&zone->lock, flags); if (!ret) { drain_all_pages(zone); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 127/181] mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate() 2020-10-13 23:46 incoming Andrew Morton ` (125 preceding siblings ...) 2020-10-13 23:55 ` [patch 126/181] mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate() Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 128/181] mm/page_isolation: cleanup set_migratetype_isolate() Andrew Morton ` (53 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, bhe, cai, david, jasowang, linux-mm, mhocko, mike.kravetz, mm-commits, mst, pankaj.gupta.linux, rppt, torvalds From: David Hildenbrand <david@redhat.com> Subject: mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate() Inside has_unmovable_pages(), we have a comment describing how unmovable data could end up in ZONE_MOVABLE - via "movablecore". Also, besides checking if the first page in the pageblock is reserved, we don't perform any further checks in case of ZONE_MOVABLE. In case of memory offlining, we set REPORT_FAILURE, properly dump_page() the page and handle the error gracefully. alloc_contig_pages() users currently never allocate from ZONE_MOVABLE. E.g., hugetlb uses alloc_contig_pages() for the allocation of gigantic pages only, which will never end up on the MOVABLE zone (see htlb_alloc_mask()). Link: http://lkml.kernel.org/r/20200816125333.7434-4-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Reviewed-by: Baoquan He <bhe@redhat.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Michael S. Tsirkin <mst@redhat.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Pankaj Gupta <pankaj.gupta.linux@gmail.com> Cc: Jason Wang <jasowang@redhat.com> Cc: Mike Rapoport <rppt@kernel.org> Cc: Qian Cai <cai@lca.pw> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_isolation.c | 15 ++++++--------- 1 file changed, 6 insertions(+), 9 deletions(-) --- a/mm/page_isolation.c~mm-page_isolation-drop-warn_on_once-in-set_migratetype_isolate +++ a/mm/page_isolation.c @@ -57,15 +57,12 @@ static int set_migratetype_isolate(struc spin_unlock_irqrestore(&zone->lock, flags); if (!ret) { drain_all_pages(zone); - } else { - WARN_ON_ONCE(zone_idx(zone) == ZONE_MOVABLE); - - if ((isol_flags & REPORT_FAILURE) && unmovable) - /* - * printk() with zone->lock held will likely trigger a - * lockdep splat, so defer it here. - */ - dump_page(unmovable, "unmovable page"); + } else if ((isol_flags & REPORT_FAILURE) && unmovable) { + /* + * printk() with zone->lock held will likely trigger a + * lockdep splat, so defer it here. + */ + dump_page(unmovable, "unmovable page"); } return ret; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 128/181] mm/page_isolation: cleanup set_migratetype_isolate() 2020-10-13 23:46 incoming Andrew Morton ` (126 preceding siblings ...) 2020-10-13 23:55 ` [patch 127/181] mm/page_isolation: drop WARN_ON_ONCE() " Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 129/181] virtio-mem: don't special-case ZONE_MOVABLE Andrew Morton ` (52 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, bhe, cai, david, jasowang, linux-mm, mhocko, mike.kravetz, mm-commits, mst, pankaj.gupta.linux, rppt, torvalds From: David Hildenbrand <david@redhat.com> Subject: mm/page_isolation: cleanup set_migratetype_isolate() Let's clean it up a bit, simplifying the exit paths. Link: http://lkml.kernel.org/r/20200816125333.7434-5-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Reviewed-by: Baoquan He <bhe@redhat.com> Reviewed-by: Pankaj Gupta <pankaj.gupta.linux@gmail.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Michael S. Tsirkin <mst@redhat.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Jason Wang <jasowang@redhat.com> Cc: Mike Rapoport <rppt@kernel.org> Cc: Qian Cai <cai@lca.pw> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_isolation.c | 17 +++++++---------- 1 file changed, 7 insertions(+), 10 deletions(-) --- a/mm/page_isolation.c~mm-page_isolation-cleanup-set_migratetype_isolate +++ a/mm/page_isolation.c @@ -17,12 +17,9 @@ static int set_migratetype_isolate(struct page *page, int migratetype, int isol_flags) { - struct page *unmovable = NULL; - struct zone *zone; + struct zone *zone = page_zone(page); + struct page *unmovable; unsigned long flags; - int ret = -EBUSY; - - zone = page_zone(page); spin_lock_irqsave(&zone->lock, flags); @@ -51,13 +48,13 @@ static int set_migratetype_isolate(struc NULL); __mod_zone_freepage_state(zone, -nr_pages, mt); - ret = 0; + spin_unlock_irqrestore(&zone->lock, flags); + drain_all_pages(zone); + return 0; } spin_unlock_irqrestore(&zone->lock, flags); - if (!ret) { - drain_all_pages(zone); - } else if ((isol_flags & REPORT_FAILURE) && unmovable) { + if (isol_flags & REPORT_FAILURE) { /* * printk() with zone->lock held will likely trigger a * lockdep splat, so defer it here. @@ -65,7 +62,7 @@ static int set_migratetype_isolate(struc dump_page(unmovable, "unmovable page"); } - return ret; + return -EBUSY; } static void unset_migratetype_isolate(struct page *page, unsigned migratetype) _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 129/181] virtio-mem: don't special-case ZONE_MOVABLE 2020-10-13 23:46 incoming Andrew Morton ` (127 preceding siblings ...) 2020-10-13 23:55 ` [patch 128/181] mm/page_isolation: cleanup set_migratetype_isolate() Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 130/181] mm: document semantics of ZONE_MOVABLE Andrew Morton ` (51 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, bhe, cai, david, jasowang, linux-mm, mhocko, mike.kravetz, mm-commits, mst, pankaj.gupta.linux, rppt, torvalds From: David Hildenbrand <david@redhat.com> Subject: virtio-mem: don't special-case ZONE_MOVABLE When introducing virtio-mem, the semantics of ZONE_MOVABLE were rather unclear, which is why we special-cased ZONE_MOVABLE such that partially plugged blocks would never end up in ZONE_MOVABLE. Now that the semantics are much clearer (and will be documented in a follow-up patch including the new virtio-mem behavior), let's allow to online partially plugged memory blocks to ZONE_MOVABLE and also consider memory blocks that were onlined to ZONE_MOVABLE when unplugging memory. While unplugged memory pages are, in general, unmovable, they can be skipped when offlining memory. virtio-mem only unplugs fairly big chunks (in the megabyte range) and rather tries to shrink the memory region than randomly choosing memory. In theory, if all other pages in the movable zone would be movable, virtio-mem would only shrink that zone and not create any kind of fragmentation. In the future, we might want to remember the zone again and use the information when (un)plugging memory. For now, let's keep it simple. Note: Support for defragmentation is planned, to deal with fragmentation after unplug due to memory chunks within memory blocks that could not get unplugged before (e.g., somebody pinning pages within ZONE_MOVABLE for a longer time). Link: http://lkml.kernel.org/r/20200816125333.7434-6-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Michael S. Tsirkin <mst@redhat.com> Cc: Jason Wang <jasowang@redhat.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Pankaj Gupta <pankaj.gupta.linux@gmail.com> Cc: Baoquan He <bhe@redhat.com> Cc: Mike Rapoport <rppt@kernel.org> Cc: Qian Cai <cai@lca.pw> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- drivers/virtio/virtio_mem.c | 47 +++++----------------------------- 1 file changed, 8 insertions(+), 39 deletions(-) --- a/drivers/virtio/virtio_mem.c~virtio-mem-dont-special-case-zone_movable +++ a/drivers/virtio/virtio_mem.c @@ -36,18 +36,10 @@ enum virtio_mem_mb_state { VIRTIO_MEM_MB_STATE_OFFLINE, /* Partially plugged, fully added to Linux, offline. */ VIRTIO_MEM_MB_STATE_OFFLINE_PARTIAL, - /* Fully plugged, fully added to Linux, online (!ZONE_MOVABLE). */ + /* Fully plugged, fully added to Linux, online. */ VIRTIO_MEM_MB_STATE_ONLINE, - /* Partially plugged, fully added to Linux, online (!ZONE_MOVABLE). */ + /* Partially plugged, fully added to Linux, online. */ VIRTIO_MEM_MB_STATE_ONLINE_PARTIAL, - /* - * Fully plugged, fully added to Linux, online (ZONE_MOVABLE). - * We are not allowed to allocate (unplug) parts of this block that - * are not movable (similar to gigantic pages). We will never allow - * to online OFFLINE_PARTIAL to ZONE_MOVABLE (as they would contain - * unmovable parts). - */ - VIRTIO_MEM_MB_STATE_ONLINE_MOVABLE, VIRTIO_MEM_MB_STATE_COUNT }; @@ -526,21 +518,10 @@ static bool virtio_mem_owned_mb(struct v } static int virtio_mem_notify_going_online(struct virtio_mem *vm, - unsigned long mb_id, - enum zone_type zone) + unsigned long mb_id) { switch (virtio_mem_mb_get_state(vm, mb_id)) { case VIRTIO_MEM_MB_STATE_OFFLINE_PARTIAL: - /* - * We won't allow to online a partially plugged memory block - * to the MOVABLE zone - it would contain unmovable parts. - */ - if (zone == ZONE_MOVABLE) { - dev_warn_ratelimited(&vm->vdev->dev, - "memory block has holes, MOVABLE not supported\n"); - return NOTIFY_BAD; - } - return NOTIFY_OK; case VIRTIO_MEM_MB_STATE_OFFLINE: return NOTIFY_OK; default: @@ -560,7 +541,6 @@ static void virtio_mem_notify_offline(st VIRTIO_MEM_MB_STATE_OFFLINE_PARTIAL); break; case VIRTIO_MEM_MB_STATE_ONLINE: - case VIRTIO_MEM_MB_STATE_ONLINE_MOVABLE: virtio_mem_mb_set_state(vm, mb_id, VIRTIO_MEM_MB_STATE_OFFLINE); break; @@ -579,24 +559,17 @@ static void virtio_mem_notify_offline(st virtio_mem_retry(vm); } -static void virtio_mem_notify_online(struct virtio_mem *vm, unsigned long mb_id, - enum zone_type zone) +static void virtio_mem_notify_online(struct virtio_mem *vm, unsigned long mb_id) { unsigned long nb_offline; switch (virtio_mem_mb_get_state(vm, mb_id)) { case VIRTIO_MEM_MB_STATE_OFFLINE_PARTIAL: - BUG_ON(zone == ZONE_MOVABLE); virtio_mem_mb_set_state(vm, mb_id, VIRTIO_MEM_MB_STATE_ONLINE_PARTIAL); break; case VIRTIO_MEM_MB_STATE_OFFLINE: - if (zone == ZONE_MOVABLE) - virtio_mem_mb_set_state(vm, mb_id, - VIRTIO_MEM_MB_STATE_ONLINE_MOVABLE); - else - virtio_mem_mb_set_state(vm, mb_id, - VIRTIO_MEM_MB_STATE_ONLINE); + virtio_mem_mb_set_state(vm, mb_id, VIRTIO_MEM_MB_STATE_ONLINE); break; default: BUG(); @@ -675,7 +648,6 @@ static int virtio_mem_memory_notifier_cb const unsigned long start = PFN_PHYS(mhp->start_pfn); const unsigned long size = PFN_PHYS(mhp->nr_pages); const unsigned long mb_id = virtio_mem_phys_to_mb_id(start); - enum zone_type zone; int rc = NOTIFY_OK; if (!virtio_mem_overlaps_range(vm, start, size)) @@ -717,8 +689,7 @@ static int virtio_mem_memory_notifier_cb break; } vm->hotplug_active = true; - zone = page_zonenum(pfn_to_page(mhp->start_pfn)); - rc = virtio_mem_notify_going_online(vm, mb_id, zone); + rc = virtio_mem_notify_going_online(vm, mb_id); break; case MEM_OFFLINE: virtio_mem_notify_offline(vm, mb_id); @@ -726,8 +697,7 @@ static int virtio_mem_memory_notifier_cb mutex_unlock(&vm->hotplug_mutex); break; case MEM_ONLINE: - zone = page_zonenum(pfn_to_page(mhp->start_pfn)); - virtio_mem_notify_online(vm, mb_id, zone); + virtio_mem_notify_online(vm, mb_id); vm->hotplug_active = false; mutex_unlock(&vm->hotplug_mutex); break; @@ -1906,8 +1876,7 @@ static void virtio_mem_remove(struct vir if (vm->nb_mb_state[VIRTIO_MEM_MB_STATE_OFFLINE] || vm->nb_mb_state[VIRTIO_MEM_MB_STATE_OFFLINE_PARTIAL] || vm->nb_mb_state[VIRTIO_MEM_MB_STATE_ONLINE] || - vm->nb_mb_state[VIRTIO_MEM_MB_STATE_ONLINE_PARTIAL] || - vm->nb_mb_state[VIRTIO_MEM_MB_STATE_ONLINE_MOVABLE]) { + vm->nb_mb_state[VIRTIO_MEM_MB_STATE_ONLINE_PARTIAL]) { dev_warn(&vdev->dev, "device still has system memory added\n"); } else { virtio_mem_delete_resource(vm); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 130/181] mm: document semantics of ZONE_MOVABLE 2020-10-13 23:46 incoming Andrew Morton ` (128 preceding siblings ...) 2020-10-13 23:55 ` [patch 129/181] virtio-mem: don't special-case ZONE_MOVABLE Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 131/181] mm, isolation: avoid checking unmovable pages across pageblock boundary Andrew Morton ` (50 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, bhe, cai, david, jasowang, linux-mm, mhocko, mike.kravetz, mm-commits, mst, pankaj.gupta.linux, rppt, torvalds From: David Hildenbrand <david@redhat.com> Subject: mm: document semantics of ZONE_MOVABLE Let's document what ZONE_MOVABLE means, how it's used, and which special cases we have regarding unmovable pages (memory offlining vs. migration / allocations). Link: http://lkml.kernel.org/r/20200816125333.7434-7-david@redhat.com Signed-off-by: David Hildenbrand <david@redhat.com> Acked-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Michal Hocko <mhocko@suse.com> Cc: Michael S. Tsirkin <mst@redhat.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Pankaj Gupta <pankaj.gupta.linux@gmail.com> Cc: Baoquan He <bhe@redhat.com> Cc: Jason Wang <jasowang@redhat.com> Cc: Qian Cai <cai@lca.pw> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/mmzone.h | 35 +++++++++++++++++++++++++++++++++++ 1 file changed, 35 insertions(+) --- a/include/linux/mmzone.h~mm-document-semantics-of-zone_movable +++ a/include/linux/mmzone.h @@ -396,6 +396,41 @@ enum zone_type { */ ZONE_HIGHMEM, #endif + /* + * ZONE_MOVABLE is similar to ZONE_NORMAL, except that it contains + * movable pages with few exceptional cases described below. Main use + * cases for ZONE_MOVABLE are to make memory offlining/unplug more + * likely to succeed, and to locally limit unmovable allocations - e.g., + * to increase the number of THP/huge pages. Notable special cases are: + * + * 1. Pinned pages: (long-term) pinning of movable pages might + * essentially turn such pages unmovable. Memory offlining might + * retry a long time. + * 2. memblock allocations: kernelcore/movablecore setups might create + * situations where ZONE_MOVABLE contains unmovable allocations + * after boot. Memory offlining and allocations fail early. + * 3. Memory holes: kernelcore/movablecore setups might create very rare + * situations where ZONE_MOVABLE contains memory holes after boot, + * for example, if we have sections that are only partially + * populated. Memory offlining and allocations fail early. + * 4. PG_hwpoison pages: while poisoned pages can be skipped during + * memory offlining, such pages cannot be allocated. + * 5. Unmovable PG_offline pages: in paravirtualized environments, + * hotplugged memory blocks might only partially be managed by the + * buddy (e.g., via XEN-balloon, Hyper-V balloon, virtio-mem). The + * parts not manged by the buddy are unmovable PG_offline pages. In + * some cases (virtio-mem), such pages can be skipped during + * memory offlining, however, cannot be moved/allocated. These + * techniques might use alloc_contig_range() to hide previously + * exposed pages from the buddy again (e.g., to implement some sort + * of memory unplug in virtio-mem). + * + * In general, no unmovable allocations that degrade memory offlining + * should end up in ZONE_MOVABLE. Allocators (like alloc_contig_range()) + * have to expect that migrating pages in ZONE_MOVABLE can fail (even + * if has_unmovable_pages() states that there are no unmovable pages, + * there can be false negatives). + */ ZONE_MOVABLE, #ifdef CONFIG_ZONE_DEVICE ZONE_DEVICE, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 131/181] mm, isolation: avoid checking unmovable pages across pageblock boundary 2020-10-13 23:46 incoming Andrew Morton ` (129 preceding siblings ...) 2020-10-13 23:55 ` [patch 130/181] mm: document semantics of ZONE_MOVABLE Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 132/181] mm/page_alloc.c: clean code by removing unnecessary initialization Andrew Morton ` (49 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, david, linux-mm, lixinhai.lxh, mhocko, mm-commits, osalvador, torvalds From: Li Xinhai <lixinhai.lxh@gmail.com> Subject: mm, isolation: avoid checking unmovable pages across pageblock boundary In has_unmovable_pages(), the page parameter would not always be the first page within a pageblock (see how the page pointer is passed in from start_isolate_page_range() after call __first_valid_page()), so that would cause checking unmovable pages span two pageblocks. After this patch, the checking is enforced within one pageblock no matter the page is first one or not, and obey the semantics of this function. This issue is found by code inspection. Michal said "this might lead to false negatives when an unrelated block would cause an isolation failure". Link: https://lkml.kernel.org/r/20200824065811.383266-1-lixinhai.lxh@gmail.com Signed-off-by: Li Xinhai <lixinhai.lxh@gmail.com> Reviewed-by: Oscar Salvador <osalvador@suse.de> Acked-by: Michal Hocko <mhocko@suse.com> Cc: David Hildenbrand <david@redhat.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 3 ++- 1 file changed, 2 insertions(+), 1 deletion(-) --- a/mm/page_alloc.c~mm-isolation-avoid-checking-unmovable-pages-across-pageblock-boundary +++ a/mm/page_alloc.c @@ -8234,6 +8234,7 @@ struct page *has_unmovable_pages(struct { unsigned long iter = 0; unsigned long pfn = page_to_pfn(page); + unsigned long offset = pfn % pageblock_nr_pages; if (is_migrate_cma_page(page)) { /* @@ -8247,7 +8248,7 @@ struct page *has_unmovable_pages(struct return page; } - for (; iter < pageblock_nr_pages; iter++) { + for (; iter < pageblock_nr_pages - offset; iter++) { if (!pfn_valid_within(pfn + iter)) continue; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 132/181] mm/page_alloc.c: clean code by removing unnecessary initialization 2020-10-13 23:46 incoming Andrew Morton ` (130 preceding siblings ...) 2020-10-13 23:55 ` [patch 131/181] mm, isolation: avoid checking unmovable pages across pageblock boundary Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 133/181] mm/page_alloc.c: micro-optimization remove unnecessary branch Andrew Morton ` (48 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, linux-mm, mateusznosek0, mm-commits, torvalds From: Mateusz Nosek <mateusznosek0@gmail.com> Subject: mm/page_alloc.c: clean code by removing unnecessary initialization Previously variable 'tmp' was initialized, but was not read later before reassigning. So the initialization can be removed. [akpm@linux-foundation.org: remove `tmp' altogether] Link: https://lkml.kernel.org/r/20200904132422.17387-1-mateusznosek0@gmail.com Signed-off-by: Mateusz Nosek <mateusznosek0@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 4 +--- 1 file changed, 1 insertion(+), 3 deletions(-) --- a/mm/page_alloc.c~mm-page_allocc-clean-code-by-removing-unnecessary-initialization +++ a/mm/page_alloc.c @@ -5651,7 +5651,6 @@ static int find_next_best_node(int node, int n, val; int min_val = INT_MAX; int best_node = NUMA_NO_NODE; - const struct cpumask *tmp = cpumask_of_node(0); /* Use the local node if we haven't already */ if (!node_isset(node, *used_node_mask)) { @@ -5672,8 +5671,7 @@ static int find_next_best_node(int node, val += (n < node); /* Give preference to headless and unused nodes */ - tmp = cpumask_of_node(n); - if (!cpumask_empty(tmp)) + if (!cpumask_empty(cpumask_of_node(n))) val += PENALTY_FOR_NODE_WITH_CPUS; /* Slight preference for less loaded node */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 133/181] mm/page_alloc.c: micro-optimization remove unnecessary branch 2020-10-13 23:46 incoming Andrew Morton ` (131 preceding siblings ...) 2020-10-13 23:55 ` [patch 132/181] mm/page_alloc.c: clean code by removing unnecessary initialization Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 134/181] mm/page_alloc.c: fix early params garbage value accesses Andrew Morton ` (47 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, linux-mm, mateusznosek0, mm-commits, torvalds From: Mateusz Nosek <mateusznosek0@gmail.com> Subject: mm/page_alloc.c: micro-optimization remove unnecessary branch Previously flags check was separated into two separated checks with two separated branches. In case of presence of any of two mentioned flags, the same effect on flow occurs. Therefore checks can be merged and one branch can be avoided. Link: https://lkml.kernel.org/r/20200911092310.31136-1-mateusznosek0@gmail.com Signed-off-by: Mateusz Nosek <mateusznosek0@gmail.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 8 +++----- 1 file changed, 3 insertions(+), 5 deletions(-) --- a/mm/page_alloc.c~mm-page_allocc-micro-optimization-remove-unnecessary-branch +++ a/mm/page_alloc.c @@ -3986,8 +3986,10 @@ __alloc_pages_may_oom(gfp_t gfp_mask, un * success so it is time to admit defeat. We will skip the OOM killer * because it is very likely that the caller has a more reasonable * fallback than shooting a random task. + * + * The OOM killer may not free memory on a specific node. */ - if (gfp_mask & __GFP_RETRY_MAYFAIL) + if (gfp_mask & (__GFP_RETRY_MAYFAIL | __GFP_THISNODE)) goto out; /* The OOM killer does not needlessly kill tasks for lowmem */ if (ac->highest_zoneidx < ZONE_NORMAL) @@ -4004,10 +4006,6 @@ __alloc_pages_may_oom(gfp_t gfp_mask, un * failures more gracefully we should just bail out here. */ - /* The OOM killer may not free memory on a specific node */ - if (gfp_mask & __GFP_THISNODE) - goto out; - /* Exhausted what can be done so it's blame time */ if (out_of_memory(&oc) || WARN_ON_ONCE(gfp_mask & __GFP_NOFAIL)) { *did_some_progress = 1; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 134/181] mm/page_alloc.c: fix early params garbage value accesses 2020-10-13 23:46 incoming Andrew Morton ` (132 preceding siblings ...) 2020-10-13 23:55 ` [patch 133/181] mm/page_alloc.c: micro-optimization remove unnecessary branch Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 135/181] mm/page_alloc.c: clean code by merging two functions Andrew Morton ` (46 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, linux-mm, mateusznosek0, mm-commits, torvalds From: Mateusz Nosek <mateusznosek0@gmail.com> Subject: mm/page_alloc.c: fix early params garbage value accesses Previously in '__init early_init_on_alloc' and '__init early_init_on_free' the return values from 'kstrtobool' were not handled properly. That caused potential garbage value read from variable 'bool_result'. Introduced patch fixes error handling. Link: https://lkml.kernel.org/r/20200916214125.28271-1-mateusznosek0@gmail.com Signed-off-by: Mateusz Nosek <mateusznosek0@gmail.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 12 ++++++------ 1 file changed, 6 insertions(+), 6 deletions(-) --- a/mm/page_alloc.c~mm-page_allocc-fix-early-params-garbage-value-accesses +++ a/mm/page_alloc.c @@ -156,16 +156,16 @@ static int __init early_init_on_alloc(ch int ret; bool bool_result; - if (!buf) - return -EINVAL; ret = kstrtobool(buf, &bool_result); + if (ret) + return ret; if (bool_result && page_poisoning_enabled()) pr_info("mem auto-init: CONFIG_PAGE_POISONING is on, will take precedence over init_on_alloc\n"); if (bool_result) static_branch_enable(&init_on_alloc); else static_branch_disable(&init_on_alloc); - return ret; + return 0; } early_param("init_on_alloc", early_init_on_alloc); @@ -174,16 +174,16 @@ static int __init early_init_on_free(cha int ret; bool bool_result; - if (!buf) - return -EINVAL; ret = kstrtobool(buf, &bool_result); + if (ret) + return ret; if (bool_result && page_poisoning_enabled()) pr_info("mem auto-init: CONFIG_PAGE_POISONING is on, will take precedence over init_on_free\n"); if (bool_result) static_branch_enable(&init_on_free); else static_branch_disable(&init_on_free); - return ret; + return 0; } early_param("init_on_free", early_init_on_free); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 135/181] mm/page_alloc.c: clean code by merging two functions 2020-10-13 23:46 incoming Andrew Morton ` (133 preceding siblings ...) 2020-10-13 23:55 ` [patch 134/181] mm/page_alloc.c: fix early params garbage value accesses Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 136/181] mm/page_alloc.c: __perform_reclaim should return 'unsigned long' Andrew Morton ` (45 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, linux-mm, mateusznosek0, mgorman, mm-commits, rppt, torvalds From: Mateusz Nosek <mateusznosek0@gmail.com> Subject: mm/page_alloc.c: clean code by merging two functions finalise_ac() is just 'epilogue' for 'prepare_alloc_pages'. Therefore there is no need to keep them both so 'finalise_ac' content can be merged into prepare_alloc_pages() code. It would make __alloc_pages_nodemask() cleaner when it comes to readability. Link: https://lkml.kernel.org/r/20200916110118.6537-1-mateusznosek0@gmail.com Signed-off-by: Mateusz Nosek <mateusznosek0@gmail.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Cc: Mel Gorman <mgorman@techsingularity.net> Cc: Mike Rapoport <rppt@kernel.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 10 ++-------- 1 file changed, 2 insertions(+), 8 deletions(-) --- a/mm/page_alloc.c~mm-page_allocc-clean-code-by-merging-two-functions +++ a/mm/page_alloc.c @@ -4838,12 +4838,6 @@ static inline bool prepare_alloc_pages(g *alloc_flags = current_alloc_flags(gfp_mask, *alloc_flags); - return true; -} - -/* Determine whether to spread dirty pages and what the first usable zone */ -static inline void finalise_ac(gfp_t gfp_mask, struct alloc_context *ac) -{ /* Dirty zone balancing only done in the fast path */ ac->spread_dirty_pages = (gfp_mask & __GFP_WRITE); @@ -4854,6 +4848,8 @@ static inline void finalise_ac(gfp_t gfp */ ac->preferred_zoneref = first_zones_zonelist(ac->zonelist, ac->highest_zoneidx, ac->nodemask); + + return true; } /* @@ -4882,8 +4878,6 @@ __alloc_pages_nodemask(gfp_t gfp_mask, u if (!prepare_alloc_pages(gfp_mask, order, preferred_nid, nodemask, &ac, &alloc_mask, &alloc_flags)) return NULL; - finalise_ac(gfp_mask, &ac); - /* * Forbid the first pass from falling back to types that fragment * memory until all local zones are considered. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 136/181] mm/page_alloc.c: __perform_reclaim should return 'unsigned long' 2020-10-13 23:46 incoming Andrew Morton ` (134 preceding siblings ...) 2020-10-13 23:55 ` [patch 135/181] mm/page_alloc.c: clean code by merging two functions Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:55 ` [patch 137/181] mmzone: clean code by removing unused macro parameter Andrew Morton ` (44 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, torvalds, yanfei.xu From: Yanfei Xu <yanfei.xu@windriver.com> Subject: mm/page_alloc.c: __perform_reclaim should return 'unsigned long' __perform_reclaim()'s single caller expects it to return 'unsigned long', hence change its return value and a local variable to 'unsigned long'. Link: https://lkml.kernel.org/r/20200916022138.16740-1-yanfei.xu@windriver.com Signed-off-by: Yanfei Xu <yanfei.xu@windriver.com> Suggested-by: Andrew Morton <akpm@linux-foundation.org> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/page_alloc.c | 5 ++--- 1 file changed, 2 insertions(+), 3 deletions(-) --- a/mm/page_alloc.c~mm-page_allocc-__perform_reclaim-should-return-unsigned-long +++ a/mm/page_alloc.c @@ -4253,13 +4253,12 @@ EXPORT_SYMBOL_GPL(fs_reclaim_release); #endif /* Perform direct synchronous page reclaim */ -static int +static unsigned long __perform_reclaim(gfp_t gfp_mask, unsigned int order, const struct alloc_context *ac) { - int progress; unsigned int noreclaim_flag; - unsigned long pflags; + unsigned long pflags, progress; cond_resched(); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 137/181] mmzone: clean code by removing unused macro parameter 2020-10-13 23:46 incoming Andrew Morton ` (135 preceding siblings ...) 2020-10-13 23:55 ` [patch 136/181] mm/page_alloc.c: __perform_reclaim should return 'unsigned long' Andrew Morton @ 2020-10-13 23:55 ` Andrew Morton 2020-10-13 23:56 ` [patch 138/181] mm: move call to compound_head() in release_pages() Andrew Morton ` (43 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:55 UTC (permalink / raw) To: akpm, linux-mm, mateusznosek0, mm-commits, torvalds From: Mateusz Nosek <mateusznosek0@gmail.com> Subject: mmzone: clean code by removing unused macro parameter Previously 'for_next_zone_zonelist_nodemask' macro parameter 'zlist' was unused so this patch removes it. Link: https://lkml.kernel.org/r/20200917211906.30059-1-mateusznosek0@gmail.com Signed-off-by: Mateusz Nosek <mateusznosek0@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/mmzone.h | 2 +- mm/page_alloc.c | 4 ++-- 2 files changed, 3 insertions(+), 3 deletions(-) --- a/include/linux/mmzone.h~mmzone-clean-code-by-removing-unused-macro-parameter +++ a/include/linux/mmzone.h @@ -1116,7 +1116,7 @@ static inline struct zoneref *first_zone z = next_zones_zonelist(++z, highidx, nodemask), \ zone = zonelist_zone(z)) -#define for_next_zone_zonelist_nodemask(zone, z, zlist, highidx, nodemask) \ +#define for_next_zone_zonelist_nodemask(zone, z, highidx, nodemask) \ for (zone = z->zone; \ zone; \ z = next_zones_zonelist(++z, highidx, nodemask), \ --- a/mm/page_alloc.c~mmzone-clean-code-by-removing-unused-macro-parameter +++ a/mm/page_alloc.c @@ -3741,8 +3741,8 @@ retry: */ no_fallback = alloc_flags & ALLOC_NOFRAGMENT; z = ac->preferred_zoneref; - for_next_zone_zonelist_nodemask(zone, z, ac->zonelist, - ac->highest_zoneidx, ac->nodemask) { + for_next_zone_zonelist_nodemask(zone, z, ac->highest_zoneidx, + ac->nodemask) { struct page *page; unsigned long mark; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 138/181] mm: move call to compound_head() in release_pages() 2020-10-13 23:46 incoming Andrew Morton ` (136 preceding siblings ...) 2020-10-13 23:55 ` [patch 137/181] mmzone: clean code by removing unused macro parameter Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 139/181] mm/page_alloc.c: fix freeing non-compound pages Andrew Morton ` (42 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, dan.j.williams, hch, linux-mm, mm-commits, rcampbell, torvalds, willy, yuzhao From: Ralph Campbell <rcampbell@nvidia.com> Subject: mm: move call to compound_head() in release_pages() The function is_huge_zero_page() doesn't call compound_head() to make sure the page pointer is a head page. The call to is_huge_zero_page() in release_pages() is made before compound_head() is called so the test would fail if release_pages() was called with a tail page of the huge_zero_page and put_page_testzero() would be called releasing the page. This is unlikely to be happening in normal use or we would be seeing all sorts of process data corruption when accessing a THP zero page. Looking at other places where is_huge_zero_page() is called, all seem to only pass a head page so I think the right solution is to move the call to compound_head() in release_pages() to a point before calling is_huge_zero_page(). Link: https://lkml.kernel.org/r/20200917173938.16420-1-rcampbell@nvidia.com Signed-off-by: Ralph Campbell <rcampbell@nvidia.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Cc: Yu Zhao <yuzhao@google.com> Cc: Dan Williams <dan.j.williams@intel.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Christoph Hellwig <hch@lst.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/swap.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/swap.c~mm-move-call-to-compound_head-in-release_pages +++ a/mm/swap.c @@ -889,6 +889,7 @@ void release_pages(struct page **pages, locked_pgdat = NULL; } + page = compound_head(page); if (is_huge_zero_page(page)) continue; @@ -910,7 +911,6 @@ void release_pages(struct page **pages, } } - page = compound_head(page); if (!put_page_testzero(page)) continue; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 139/181] mm/page_alloc.c: fix freeing non-compound pages 2020-10-13 23:46 incoming Andrew Morton ` (137 preceding siblings ...) 2020-10-13 23:56 ` [patch 138/181] mm: move call to compound_head() in release_pages() Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 140/181] include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts Andrew Morton ` (41 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, hughd, linux-mm, mm-commits, npiggin, peterz, rppt, torvalds, willy From: "Matthew Wilcox (Oracle)" <willy@infradead.org> Subject: mm/page_alloc.c: fix freeing non-compound pages Here is a very rare race which leaks memory: Page P0 is allocated to the page cache. Page P1 is free. Thread A Thread B Thread C find_get_entry(): xas_load() returns P0 Removes P0 from page cache P0 finds its buddy P1 alloc_pages(GFP_KERNEL, 1) returns P0 P0 has refcount 1 page_cache_get_speculative(P0) P0 has refcount 2 __free_pages(P0) P0 has refcount 1 put_page(P0) P1 is not freed Fix this by freeing all the pages in __free_pages() that won't be freed by the call to put_page(). It's usually not a good idea to split a page, but this is a very unlikely scenario. Link: https://lkml.kernel.org/r/20200926213919.26642-1-willy@infradead.org Fixes: e286781d5f2e ("mm: speculative page references") Signed-off-by: Matthew Wilcox (Oracle) <willy@infradead.org> Acked-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Nick Piggin <npiggin@gmail.com> Cc: Hugh Dickins <hughd@google.com> Cc: Peter Zijlstra <peterz@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- lib/Kconfig.debug | 9 ++++++++ lib/Makefile | 1 lib/test_free_pages.c | 42 ++++++++++++++++++++++++++++++++++++++++ mm/page_alloc.c | 3 ++ 4 files changed, 55 insertions(+) --- a/lib/Kconfig.debug~page_alloc-fix-freeing-non-compound-pages +++ a/lib/Kconfig.debug @@ -2367,6 +2367,15 @@ config TEST_HMM If unsure, say N. +config TEST_FREE_PAGES + tristate "Test freeing pages" + help + Test that a memory leak does not occur due to a race between + freeing a block of pages and a speculative page reference. + Loading this module is safe if your kernel has the bug fixed. + If the bug is not fixed, it will leak gigabytes of memory and + probably OOM your system. + config TEST_FPU tristate "Test floating point operations in kernel space" depends on X86 && !KCOV_INSTRUMENT_ALL --- a/lib/Makefile~page_alloc-fix-freeing-non-compound-pages +++ a/lib/Makefile @@ -101,6 +101,7 @@ obj-$(CONFIG_TEST_BLACKHOLE_DEV) += test obj-$(CONFIG_TEST_MEMINIT) += test_meminit.o obj-$(CONFIG_TEST_LOCKUP) += test_lockup.o obj-$(CONFIG_TEST_HMM) += test_hmm.o +obj-$(CONFIG_TEST_FREE_PAGES) += test_free_pages.o # # CFLAGS for compiling floating point code inside the kernel. x86/Makefile turns --- /dev/null +++ a/lib/test_free_pages.c @@ -0,0 +1,42 @@ +// SPDX-License-Identifier: GPL-2.0+ +/* + * test_free_pages.c: Check that free_pages() doesn't leak memory + * Copyright (c) 2020 Oracle + * Author: Matthew Wilcox <willy@infradead.org> + */ + +#include <linux/gfp.h> +#include <linux/mm.h> +#include <linux/module.h> + +static void test_free_pages(gfp_t gfp) +{ + unsigned int i; + + for (i = 0; i < 1000 * 1000; i++) { + unsigned long addr = __get_free_pages(gfp, 3); + struct page *page = virt_to_page(addr); + + /* Simulate page cache getting a speculative reference */ + get_page(page); + free_pages(addr, 3); + put_page(page); + } +} + +static int m_in(void) +{ + test_free_pages(GFP_KERNEL); + test_free_pages(GFP_KERNEL | __GFP_COMP); + + return 0; +} + +static void m_ex(void) +{ +} + +module_init(m_in); +module_exit(m_ex); +MODULE_AUTHOR("Matthew Wilcox <willy@infradead.org>"); +MODULE_LICENSE("GPL"); --- a/mm/page_alloc.c~page_alloc-fix-freeing-non-compound-pages +++ a/mm/page_alloc.c @@ -4952,6 +4952,9 @@ void __free_pages(struct page *page, uns { if (put_page_testzero(page)) free_the_page(page, order); + else if (!PageHead(page)) + while (order-- > 0) + free_the_page(page + (1 << order), order); } EXPORT_SYMBOL(__free_pages); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 140/181] include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts 2020-10-13 23:46 incoming Andrew Morton ` (138 preceding siblings ...) 2020-10-13 23:56 ` [patch 139/181] mm/page_alloc.c: fix freeing non-compound pages Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 141/181] mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool Andrew Morton ` (40 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, david, linux-mm, mhocko, mm-commits, paulmck, tglx, torvalds, urezki From: Michal Hocko <mhocko@suse.com> Subject: include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts There is a general understanding that GFP_ATOMIC/GFP_NOWAIT are to be used from atomic contexts. E.g. from within a spin lock or from the IRQ context. This is correct but there are some atomic contexts where the above doesn't hold. One of them would be an NMI context. Page allocator has never supported that and the general fear of this context didn't let anybody to actually even try to use the allocator there. Good, but let's be more specific about that. Another such a context, and that is where people seem to be more daring, is raw_spin_lock. Mostly because it simply resembles regular spin lock which is supported by the allocator and there is not any implementation difference with !RT kernels in the first place. Be explicit that such a context is not supported by the allocator. The underlying reason is that zone->lock would have to become raw_spin_lock as well and that has turned out to be a problem for RT (http://lkml.kernel.org/r/87mu305c1w.fsf@nanos.tec.linutronix.de). Link: https://lkml.kernel.org/r/20200929123010.5137-1-mhocko@kernel.org Signed-off-by: Michal Hocko <mhocko@suse.com> Reviewed-by: David Hildenbrand <david@redhat.com> Reviewed-by: Thomas Gleixner <tglx@linutronix.de> Reviewed-by: Uladzislau Rezki <urezki@gmail.com> Cc: "Paul E. McKenney" <paulmck@linux.vnet.ibm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/gfp.h | 4 +++- 1 file changed, 3 insertions(+), 1 deletion(-) --- a/include/linux/gfp.h~mm-clarify-usage-of-gfp_atomic-in-preemptible-contexts +++ a/include/linux/gfp.h @@ -238,7 +238,9 @@ struct vm_area_struct; * %__GFP_FOO flags as necessary. * * %GFP_ATOMIC users can not sleep and need the allocation to succeed. A lower - * watermark is applied to allow access to "atomic reserves" + * watermark is applied to allow access to "atomic reserves". + * The current implementation doesn't support NMI and few other strict + * non-preemptive contexts (e.g. raw_spin_lock). The same applies to %GFP_NOWAIT. * * %GFP_KERNEL is typical for kernel-internal allocations. The caller requires * %ZONE_NORMAL or a lower zone for direct access but can direct reclaim. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 141/181] mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool 2020-10-13 23:46 incoming Andrew Morton ` (139 preceding siblings ...) 2020-10-13 23:56 ` [patch 140/181] include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 142/181] mm/hugetlb.c: remove the unnecessary non_swap_entry() Andrew Morton ` (39 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, anshuman.khandual, bhe, david, linux-mm, mike.kravetz, mm-commits, torvalds From: Baoquan He <bhe@redhat.com> Subject: mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool Patch series "mm/hugetlb: Small cleanup and improvement", v2. This patch (of 3): Just like its neighbour is_hugetlb_entry_migration() has done. Link: https://lkml.kernel.org/r/20200723032248.24772-1-bhe@redhat.com Link: https://lkml.kernel.org/r/20200723032248.24772-2-bhe@redhat.com Signed-off-by: Baoquan He <bhe@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: David Hildenbrand <david@redhat.com> Reviewed-by: Anshuman Khandual <anshuman.khandual@arm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 8 ++++---- 1 file changed, 4 insertions(+), 4 deletions(-) --- a/mm/hugetlb.c~mm-hugetlbc-make-is_hugetlb_entry_hwpoisoned-return-bool +++ a/mm/hugetlb.c @@ -3805,17 +3805,17 @@ bool is_hugetlb_entry_migration(pte_t pt return false; } -static int is_hugetlb_entry_hwpoisoned(pte_t pte) +static bool is_hugetlb_entry_hwpoisoned(pte_t pte) { swp_entry_t swp; if (huge_pte_none(pte) || pte_present(pte)) - return 0; + return false; swp = pte_to_swp_entry(pte); if (non_swap_entry(swp) && is_hwpoison_entry(swp)) - return 1; + return true; else - return 0; + return false; } int copy_hugetlb_page_range(struct mm_struct *dst, struct mm_struct *src, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 142/181] mm/hugetlb.c: remove the unnecessary non_swap_entry() 2020-10-13 23:46 incoming Andrew Morton ` (140 preceding siblings ...) 2020-10-13 23:56 ` [patch 141/181] mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 143/181] doc/vm: fix typo in the hugetlb admin documentation Andrew Morton ` (38 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, anshuman.khandual, bhe, david, linux-mm, mike.kravetz, mm-commits, torvalds From: Baoquan He <bhe@redhat.com> Subject: mm/hugetlb.c: remove the unnecessary non_swap_entry() If a swap entry tests positive for either is_[migration|hwpoison]_entry(), then its swap_type() is among SWP_MIGRATION_READ, SWP_MIGRATION_WRITE and SWP_HWPOISON. All these types >= MAX_SWAPFILES, exactly what is asserted with non_swap_entry(). So the checking non_swap_entry() in is_hugetlb_entry_migration() and is_hugetlb_entry_hwpoisoned() is redundant. Let's remove it to optimize code. Link: https://lkml.kernel.org/r/20200723032248.24772-3-bhe@redhat.com Signed-off-by: Baoquan He <bhe@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: David Hildenbrand <david@redhat.com> Reviewed-by: Anshuman Khandual <anshuman.khandual@arm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) --- a/mm/hugetlb.c~mm-hugetlbc-remove-the-unnecessary-non_swap_entry +++ a/mm/hugetlb.c @@ -3799,7 +3799,7 @@ bool is_hugetlb_entry_migration(pte_t pt if (huge_pte_none(pte) || pte_present(pte)) return false; swp = pte_to_swp_entry(pte); - if (non_swap_entry(swp) && is_migration_entry(swp)) + if (is_migration_entry(swp)) return true; else return false; @@ -3812,7 +3812,7 @@ static bool is_hugetlb_entry_hwpoisoned( if (huge_pte_none(pte) || pte_present(pte)) return false; swp = pte_to_swp_entry(pte); - if (non_swap_entry(swp) && is_hwpoison_entry(swp)) + if (is_hwpoison_entry(swp)) return true; else return false; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 143/181] doc/vm: fix typo in the hugetlb admin documentation 2020-10-13 23:46 incoming Andrew Morton ` (141 preceding siblings ...) 2020-10-13 23:56 ` [patch 142/181] mm/hugetlb.c: remove the unnecessary non_swap_entry() Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 144/181] mm/hugetlb: not necessary to coalesce regions recursively Andrew Morton ` (37 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, anshuman.khandual, bhe, david, linux-mm, mike.kravetz, mm-commits, torvalds From: Baoquan He <bhe@redhat.com> Subject: doc/vm: fix typo in the hugetlb admin documentation Change 'pecify' to 'Specify'. Link: https://lkml.kernel.org/r/20200723032248.24772-4-bhe@redhat.com Signed-off-by: Baoquan He <bhe@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Anshuman Khandual <anshuman.khandual@arm.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- Documentation/admin-guide/mm/hugetlbpage.rst | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/Documentation/admin-guide/mm/hugetlbpage.rst~doc-vm-fix-typo-in-the-hugetlb-admin-documentation +++ a/Documentation/admin-guide/mm/hugetlbpage.rst @@ -131,7 +131,7 @@ hugepages parameter is preceded by an invalid hugepagesz parameter, it will be ignored. default_hugepagesz - pecify the default huge page size. This parameter can + Specify the default huge page size. This parameter can only be specified once on the command line. default_hugepagesz can optionally be followed by the hugepages parameter to preallocate a specific number of huge pages of default size. The number of default _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 144/181] mm/hugetlb: not necessary to coalesce regions recursively 2020-10-13 23:46 incoming Andrew Morton ` (142 preceding siblings ...) 2020-10-13 23:56 ` [patch 143/181] doc/vm: fix typo in the hugetlb admin documentation Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 145/181] mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache() Andrew Morton ` (36 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, bhe, linux-mm, mike.kravetz, mm-commits, richard.weiyang, torvalds, vbabka From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/hugetlb: not necessary to coalesce regions recursively Patch series "mm/hugetlb: code refine and simplification", v4. Following are some cleanups for hugetlb. Simple testing with tools/testing/selftests/vm/map_hugetlb passes. This patch (of 7): Per my understanding, we keep the regions ordered and would always coalesce regions properly. So the task to keep this property is just to coalesce its neighbour. Let's simplify this. Link: https://lkml.kernel.org/r/20200901014636.29737-1-richard.weiyang@linux.alibaba.com Link: https://lkml.kernel.org/r/20200831022351.20916-1-richard.weiyang@linux.alibaba.com Link: https://lkml.kernel.org/r/20200831022351.20916-2-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Baoquan He <bhe@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 6 +----- 1 file changed, 1 insertion(+), 5 deletions(-) --- a/mm/hugetlb.c~mm-hugetlb-not-necessary-to-coalesce-regions-recursively +++ a/mm/hugetlb.c @@ -309,8 +309,7 @@ static void coalesce_file_region(struct list_del(&rg->link); kfree(rg); - coalesce_file_region(resv, prg); - return; + rg = prg; } nrg = list_next_entry(rg, link); @@ -320,9 +319,6 @@ static void coalesce_file_region(struct list_del(&rg->link); kfree(rg); - - coalesce_file_region(resv, nrg); - return; } } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 145/181] mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache() 2020-10-13 23:46 incoming Andrew Morton ` (143 preceding siblings ...) 2020-10-13 23:56 ` [patch 144/181] mm/hugetlb: not necessary to coalesce regions recursively Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 146/181] mm/hugetlb: use list_splice to merge two list at once Andrew Morton ` (35 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, bhe, linux-mm, mike.kravetz, mm-commits, richard.weiyang, torvalds, vbabka From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache() We are sure to get a valid file_region, otherwise the VM_BUG_ON(resv->region_cache_count <= 0) at the very beginning would be triggered. Let's remove the redundant one. Link: https://lkml.kernel.org/r/20200831022351.20916-3-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Baoquan He <bhe@redhat.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/hugetlb.c~mm-hugetlb-remove-vm_bug_onnrg-in-get_file_region_entry_from_cache +++ a/mm/hugetlb.c @@ -240,7 +240,6 @@ get_file_region_entry_from_cache(struct resv->region_cache_count--; nrg = list_first_entry(&resv->region_cache, struct file_region, link); - VM_BUG_ON(!nrg); list_del(&nrg->link); nrg->from = from; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 146/181] mm/hugetlb: use list_splice to merge two list at once 2020-10-13 23:46 incoming Andrew Morton ` (144 preceding siblings ...) 2020-10-13 23:56 ` [patch 145/181] mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache() Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 147/181] mm/hugetlb: count file_region to be added when regions_needed != NULL Andrew Morton ` (34 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, bhe, linux-mm, mike.kravetz, mm-commits, richard.weiyang, torvalds, vbabka From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/hugetlb: use list_splice to merge two list at once Instead of add allocated file_region one by one to region_cache, we could use list_splice to merge two list at once. Also we know the number of entries in the list, increase the number directly. Link: https://lkml.kernel.org/r/20200831022351.20916-4-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Baoquan He <bhe@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 7 ++----- 1 file changed, 2 insertions(+), 5 deletions(-) --- a/mm/hugetlb.c~mm-hugetlb-use-list_splice-to-merge-two-list-at-once +++ a/mm/hugetlb.c @@ -443,11 +443,8 @@ static int allocate_file_region_entries( spin_lock(&resv->lock); - list_for_each_entry_safe(rg, trg, &allocated_regions, link) { - list_del(&rg->link); - list_add(&rg->link, &resv->region_cache); - resv->region_cache_count++; - } + list_splice(&allocated_regions, &resv->region_cache); + resv->region_cache_count += to_allocate; } return 0; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 147/181] mm/hugetlb: count file_region to be added when regions_needed != NULL 2020-10-13 23:46 incoming Andrew Morton ` (145 preceding siblings ...) 2020-10-13 23:56 ` [patch 146/181] mm/hugetlb: use list_splice to merge two list at once Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 148/181] mm/hugetlb: a page from buddy is not on any list Andrew Morton ` (33 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, bhe, linux-mm, mike.kravetz, mm-commits, richard.weiyang, torvalds, vbabka From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/hugetlb: count file_region to be added when regions_needed != NULL There are only two cases of function add_reservation_in_range() * count file_region and return the number in regions_needed * do the real list operation without counting This means it is not necessary to have two parameters to classify these two cases. Just use regions_needed to separate them. Link: https://lkml.kernel.org/r/20200831022351.20916-5-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Baoquan He <bhe@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 33 +++++++++++++++++---------------- 1 file changed, 17 insertions(+), 16 deletions(-) --- a/mm/hugetlb.c~mm-hugetlb-count-file_region-to-be-added-when-regions_needed-=-null +++ a/mm/hugetlb.c @@ -321,16 +321,17 @@ static void coalesce_file_region(struct } } -/* Must be called with resv->lock held. Calling this with count_only == true - * will count the number of pages to be added but will not modify the linked - * list. If regions_needed != NULL and count_only == true, then regions_needed - * will indicate the number of file_regions needed in the cache to carry out to - * add the regions for this range. +/* + * Must be called with resv->lock held. + * + * Calling this with regions_needed != NULL will count the number of pages + * to be added but will not modify the linked list. And regions_needed will + * indicate the number of file_regions needed in the cache to carry out to add + * the regions for this range. */ static long add_reservation_in_range(struct resv_map *resv, long f, long t, struct hugetlb_cgroup *h_cg, - struct hstate *h, long *regions_needed, - bool count_only) + struct hstate *h, long *regions_needed) { long add = 0; struct list_head *head = &resv->regions; @@ -366,14 +367,14 @@ static long add_reservation_in_range(str */ if (rg->from > last_accounted_offset) { add += rg->from - last_accounted_offset; - if (!count_only) { + if (!regions_needed) { nrg = get_file_region_entry_from_cache( resv, last_accounted_offset, rg->from); record_hugetlb_cgroup_uncharge_info(h_cg, h, resv, nrg); list_add(&nrg->link, rg->link.prev); coalesce_file_region(resv, nrg); - } else if (regions_needed) + } else *regions_needed += 1; } @@ -385,13 +386,13 @@ static long add_reservation_in_range(str */ if (last_accounted_offset < t) { add += t - last_accounted_offset; - if (!count_only) { + if (!regions_needed) { nrg = get_file_region_entry_from_cache( resv, last_accounted_offset, t); record_hugetlb_cgroup_uncharge_info(h_cg, h, resv, nrg); list_add(&nrg->link, rg->link.prev); coalesce_file_region(resv, nrg); - } else if (regions_needed) + } else *regions_needed += 1; } @@ -484,8 +485,8 @@ static long region_add(struct resv_map * retry: /* Count how many regions are actually needed to execute this add. */ - add_reservation_in_range(resv, f, t, NULL, NULL, &actual_regions_needed, - true); + add_reservation_in_range(resv, f, t, NULL, NULL, + &actual_regions_needed); /* * Check for sufficient descriptors in the cache to accommodate @@ -513,7 +514,7 @@ retry: goto retry; } - add = add_reservation_in_range(resv, f, t, h_cg, h, NULL, false); + add = add_reservation_in_range(resv, f, t, h_cg, h, NULL); resv->adds_in_progress -= in_regions_needed; @@ -549,9 +550,9 @@ static long region_chg(struct resv_map * spin_lock(&resv->lock); - /* Count how many hugepages in this range are NOT respresented. */ + /* Count how many hugepages in this range are NOT represented. */ chg = add_reservation_in_range(resv, f, t, NULL, NULL, - out_regions_needed, true); + out_regions_needed); if (*out_regions_needed == 0) *out_regions_needed = 1; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 148/181] mm/hugetlb: a page from buddy is not on any list 2020-10-13 23:46 incoming Andrew Morton ` (146 preceding siblings ...) 2020-10-13 23:56 ` [patch 147/181] mm/hugetlb: count file_region to be added when regions_needed != NULL Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 149/181] mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page Andrew Morton ` (32 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, bhe, linux-mm, mike.kravetz, mm-commits, richard.weiyang, torvalds, vbabka From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/hugetlb: a page from buddy is not on any list The page allocated from buddy is not on any list, so just use list_add() is enough. Link: https://lkml.kernel.org/r/20200831022351.20916-6-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Baoquan He <bhe@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/hugetlb.c~mm-hugetlb-a-page-from-buddy-is-not-on-any-list +++ a/mm/hugetlb.c @@ -2416,7 +2416,7 @@ struct page *alloc_huge_page(struct vm_a h->resv_huge_pages--; } spin_lock(&hugetlb_lock); - list_move(&page->lru, &h->hugepage_activelist); + list_add(&page->lru, &h->hugepage_activelist); /* Fall through */ } hugetlb_cgroup_commit_charge(idx, pages_per_huge_page(h), h_cg, page); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 149/181] mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page 2020-10-13 23:46 incoming Andrew Morton ` (147 preceding siblings ...) 2020-10-13 23:56 ` [patch 148/181] mm/hugetlb: a page from buddy is not on any list Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 150/181] mm/hugetlb: take the free hpage during the iteration directly Andrew Morton ` (31 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, bhe, linux-mm, mike.kravetz, mm-commits, richard.weiyang, torvalds, vbabka From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page set_hugetlb_cgroup_[rsvd] just manipulate page local data, which is not necessary to be protected by hugetlb_lock. Let's take this out. Link: https://lkml.kernel.org/r/20200831022351.20916-7-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Baoquan He <bhe@redhat.com> Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/hugetlb.c~mm-hugetlb-narrow-the-hugetlb_lock-protection-area-during-preparing-huge-page +++ a/mm/hugetlb.c @@ -1504,9 +1504,9 @@ static void prep_new_huge_page(struct hs { INIT_LIST_HEAD(&page->lru); set_compound_page_dtor(page, HUGETLB_PAGE_DTOR); - spin_lock(&hugetlb_lock); set_hugetlb_cgroup(page, NULL); set_hugetlb_cgroup_rsvd(page, NULL); + spin_lock(&hugetlb_lock); h->nr_huge_pages++; h->nr_huge_pages_node[nid]++; spin_unlock(&hugetlb_lock); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 150/181] mm/hugetlb: take the free hpage during the iteration directly 2020-10-13 23:46 incoming Andrew Morton ` (148 preceding siblings ...) 2020-10-13 23:56 ` [patch 149/181] mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 151/181] hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share Andrew Morton ` (30 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, bhe, linux-mm, mike.kravetz, mm-commits, richard.weiyang, torvalds, vbabka From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/hugetlb: take the free hpage during the iteration directly Function dequeue_huge_page_node_exact() iterates the free list and return the first valid free hpage. Instead of break and check the loop variant, we could return in the loop directly. This could reduce some redundant check. [mike.kravetz@oracle.com: points out a logic error] [richard.weiyang@linux.alibaba.com: v4] Link: https://lkml.kernel.org/r/20200901014636.29737-8-richard.weiyang@linux.alibaba.com Link: https://lkml.kernel.org/r/20200831022351.20916-8-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Cc: Baoquan He <bhe@redhat.com> Cc: Mike Kravetz <mike.kravetz@oracle.com> Cc: Vlastimil Babka <vbabka@suse.cz> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 22 +++++++++------------- 1 file changed, 9 insertions(+), 13 deletions(-) --- a/mm/hugetlb.c~mm-hugetlb-take-the-free-hpage-during-the-iteration-directly +++ a/mm/hugetlb.c @@ -1040,21 +1040,17 @@ static struct page *dequeue_huge_page_no if (nocma && is_migrate_cma_page(page)) continue; - if (!PageHWPoison(page)) - break; + if (PageHWPoison(page)) + continue; + + list_move(&page->lru, &h->hugepage_activelist); + set_page_refcounted(page); + h->free_huge_pages--; + h->free_huge_pages_node[nid]--; + return page; } - /* - * if 'non-isolated free hugepage' not found on the list, - * the allocation fails. - */ - if (&h->hugepage_freelists[nid] == &page->lru) - return NULL; - list_move(&page->lru, &h->hugepage_activelist); - set_page_refcounted(page); - h->free_huge_pages--; - h->free_huge_pages_node[nid]--; - return page; + return NULL; } static struct page *dequeue_huge_page_nodemask(struct hstate *h, gfp_t gfp_mask, int nid, _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 151/181] hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share 2020-10-13 23:46 incoming Andrew Morton ` (149 preceding siblings ...) 2020-10-13 23:56 ` [patch 150/181] mm/hugetlb: take the free hpage during the iteration directly Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 152/181] mm/vmscan: fix infinite loop in drop_slab_node Andrew Morton ` (29 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, dave, kirill.shutemov, linux-mm, mhocko, mike.kravetz, mm-commits, torvalds, willy From: Mike Kravetz <mike.kravetz@oracle.com> Subject: hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share As a debugging aid, huge_pmd_share should make sure i_mmap_rwsem is held if necessary. To clarify the 'if necessary', expand the comment block at the beginning of huge_pmd_share. No functional change. The added i_mmap_assert_locked() call is only enabled if CONFIG_LOCKDEP. Ideally, this should have been included with commit 34ae204f1851 ("hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem"). Link: https://lkml.kernel.org/r/20200911201248.88537-1-mike.kravetz@oracle.com Signed-off-by: Mike Kravetz <mike.kravetz@oracle.com> Cc: Matthew Wilcox <willy@infradead.org> Cc: Michal Hocko <mhocko@kernel.org> Cc: "Kirill A . Shutemov" <kirill.shutemov@linux.intel.com> Cc: Davidlohr Bueso <dave@stgolabs.net> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/hugetlb.c | 15 +++++++++++---- 1 file changed, 11 insertions(+), 4 deletions(-) --- a/mm/hugetlb.c~hugetlb-add-lockdep-check-for-i_mmap_rwsem-held-in-huge_pmd_share +++ a/mm/hugetlb.c @@ -5337,10 +5337,16 @@ void adjust_range_if_pmd_sharing_possibl * !shared pmd case because we can allocate the pmd later as well, it makes the * code much cleaner. * - * This routine must be called with i_mmap_rwsem held in at least read mode. - * For hugetlbfs, this prevents removal of any page table entries associated - * with the address space. This is important as we are setting up sharing - * based on existing page table entries (mappings). + * This routine must be called with i_mmap_rwsem held in at least read mode if + * sharing is possible. For hugetlbfs, this prevents removal of any page + * table entries associated with the address space. This is important as we + * are setting up sharing based on existing page table entries (mappings). + * + * NOTE: This routine is only called from huge_pte_alloc. Some callers of + * huge_pte_alloc know that sharing is not possible and do not take + * i_mmap_rwsem as a performance optimization. This is handled by the + * if !vma_shareable check at the beginning of the routine. i_mmap_rwsem is + * only required for subsequent processing. */ pte_t *huge_pmd_share(struct mm_struct *mm, unsigned long addr, pud_t *pud) { @@ -5357,6 +5363,7 @@ pte_t *huge_pmd_share(struct mm_struct * if (!vma_shareable(vma, addr)) return (pte_t *)pmd_alloc(mm, pud, addr); + i_mmap_assert_locked(mapping); vma_interval_tree_foreach(svma, &mapping->i_mmap, idx, idx) { if (svma == vma) continue; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 152/181] mm/vmscan: fix infinite loop in drop_slab_node 2020-10-13 23:46 incoming Andrew Morton ` (150 preceding siblings ...) 2020-10-13 23:56 ` [patch 151/181] hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 153/181] mm/vmscan: fix comments for isolate_lru_page() Andrew Morton ` (28 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, chris, linux-mm, mhocko, mm-commits, songmuchun, torvalds, vbabka, willy, zangchunxin From: Chunxin Zang <zangchunxin@bytedance.com> Subject: mm/vmscan: fix infinite loop in drop_slab_node We have observed that drop_caches can take a considerable amount of time (<put data here>). Especially when there are many memcgs involved because they are adding an additional overhead. It is quite unfortunate that the operation cannot be interrupted by a signal currently. Add a check for fatal signals into the main loop so that userspace can control early bailout. There are two reasons: 1. We have too many memcgs, even though one object freed in one memcg, the sum of object is bigger than 10. 2. We spend a lot of time in traverse memcg once. So, the memcg who traversed at the first have been freed many objects. Traverse memcg next time, the freed count bigger than 10 again. We can get the following info through 'ps': root:~# ps -aux | grep drop root 357956 ... R Aug25 21119854:55 echo 3 > /proc/sys/vm/drop_caches root 1771385 ... R Aug16 21146421:17 echo 3 > /proc/sys/vm/drop_caches root 1986319 ... R 18:56 117:27 echo 3 > /proc/sys/vm/drop_caches root 2002148 ... R Aug24 5720:39 echo 3 > /proc/sys/vm/drop_caches root 2564666 ... R 18:59 113:58 echo 3 > /proc/sys/vm/drop_caches root 2639347 ... R Sep03 2383:39 echo 3 > /proc/sys/vm/drop_caches root 3904747 ... R 03:35 993:31 echo 3 > /proc/sys/vm/drop_caches root 4016780 ... R Aug21 7882:18 echo 3 > /proc/sys/vm/drop_caches Use bpftrace follow 'freed' value in drop_slab_node: root:~# bpftrace -e 'kprobe:drop_slab_node+70 {@ret=hist(reg("bp")); }' Attaching 1 probe... ^B^C @ret: [64, 128) 1 | | [128, 256) 28 | | [256, 512) 107 |@ | [512, 1K) 298 |@@@ | [1K, 2K) 613 |@@@@@@@ | [2K, 4K) 4435 |@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@| [4K, 8K) 442 |@@@@@ | [8K, 16K) 299 |@@@ | [16K, 32K) 100 |@ | [32K, 64K) 139 |@ | [64K, 128K) 56 | | [128K, 256K) 26 | | [256K, 512K) 2 | | In the while loop, we can check whether the TASK_KILLABLE signal is set, if so, we should break the loop. Link: https://lkml.kernel.org/r/20200909152047.27905-1-zangchunxin@bytedance.com Signed-off-by: Chunxin Zang <zangchunxin@bytedance.com> Signed-off-by: Muchun Song <songmuchun@bytedance.com> Acked-by: Chris Down <chris@chrisdown.name> Acked-by: Michal Hocko <mhocko@suse.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Matthew Wilcox <willy@infradead.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 3 +++ 1 file changed, 3 insertions(+) --- a/mm/vmscan.c~mm-vmscan-fix-infinite-loop-in-drop_slab_node +++ a/mm/vmscan.c @@ -699,6 +699,9 @@ void drop_slab_node(int nid) do { struct mem_cgroup *memcg = NULL; + if (fatal_signal_pending(current)) + return; + freed = 0; memcg = mem_cgroup_iter(NULL, NULL, NULL); do { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 153/181] mm/vmscan: fix comments for isolate_lru_page() 2020-10-13 23:46 incoming Andrew Morton ` (151 preceding siblings ...) 2020-10-13 23:56 ` [patch 152/181] mm/vmscan: fix infinite loop in drop_slab_node Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 154/181] mm/z3fold.c: use xx_zalloc instead xx_alloc and memset Andrew Morton ` (27 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, sh_def, torvalds From: Hui Su <sh_def@163.com> Subject: mm/vmscan: fix comments for isolate_lru_page() fix comments for isolate_lru_page(): s/fundamentnal/fundamental Link: https://lkml.kernel.org/r/20200927173923.GA8058@rlk Signed-off-by: Hui Su <sh_def@163.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/vmscan.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/vmscan.c~mm-vmscan-fix-comments-for-isolate_lru_page +++ a/mm/vmscan.c @@ -1754,7 +1754,7 @@ static unsigned long isolate_lru_pages(u * Restrictions: * * (1) Must be called with an elevated refcount on the page. This is a - * fundamentnal difference from isolate_lru_pages (which is called + * fundamental difference from isolate_lru_pages (which is called * without a stable reference). * (2) the lru_lock must not be held. * (3) interrupts must be enabled. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 154/181] mm/z3fold.c: use xx_zalloc instead xx_alloc and memset 2020-10-13 23:46 incoming Andrew Morton ` (152 preceding siblings ...) 2020-10-13 23:56 ` [patch 153/181] mm/vmscan: fix comments for isolate_lru_page() Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 155/181] mm/zbud: remove redundant initialization Andrew Morton ` (26 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, sh_def, torvalds From: Hui Su <sh_def@163.com> Subject: mm/z3fold.c: use xx_zalloc instead xx_alloc and memset alloc_slots() allocates memory for slots using kmem_cache_alloc(), then memsets it. We can just use kmem_cache_zalloc(). Link: https://lkml.kernel.org/r/20200926100834.GA184671@rlk Signed-off-by: Hui Su <sh_def@163.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/z3fold.c | 3 +-- 1 file changed, 1 insertion(+), 2 deletions(-) --- a/mm/z3fold.c~mmz3fold-use-xx_zalloc-instead-xx_alloc-and-memset +++ a/mm/z3fold.c @@ -212,13 +212,12 @@ static inline struct z3fold_buddy_slots { struct z3fold_buddy_slots *slots; - slots = kmem_cache_alloc(pool->c_handle, + slots = kmem_cache_zalloc(pool->c_handle, (gfp & ~(__GFP_HIGHMEM | __GFP_MOVABLE))); if (slots) { /* It will be freed separately in free_handle(). */ kmemleak_not_leak(slots); - memset(slots->slot, 0, sizeof(slots->slot)); slots->pool = (unsigned long)pool; rwlock_init(&slots->lock); } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 155/181] mm/zbud: remove redundant initialization 2020-10-13 23:46 incoming Andrew Morton ` (153 preceding siblings ...) 2020-10-13 23:56 ` [patch 154/181] mm/z3fold.c: use xx_zalloc instead xx_alloc and memset Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:56 ` [patch 156/181] mm/compaction.c: micro-optimization remove unnecessary branch Andrew Morton ` (25 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, chenxiang66, david, ddstreet, linux-mm, mm-commits, sjenning, torvalds From: Xiang Chen <chenxiang66@hisilicon.com> Subject: mm/zbud: remove redundant initialization zhdr is already initialized in the front of the function, so remove redundant initialization here. Link: https://lkml.kernel.org/r/1600419885-191907-1-git-send-email-chenxiang66@hisilicon.com Signed-off-by: Xiang Chen <chenxiang66@hisilicon.com> Reviewed-by: David Hildenbrand <david@redhat.com> Cc: Seth Jennings <sjenning@redhat.com> Cc: Dan Streetman <ddstreet@ieee.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/zbud.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/zbud.c~mm-zbud-remove-redundant-initialization +++ a/mm/zbud.c @@ -367,7 +367,6 @@ int zbud_alloc(struct zbud_pool *pool, s spin_lock(&pool->lock); /* First, try to find an unbuddied zbud page. */ - zhdr = NULL; for_each_unbuddied_list(i, chunks) { if (!list_empty(&pool->unbuddied[i])) { zhdr = list_first_entry(&pool->unbuddied[i], _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 156/181] mm/compaction.c: micro-optimization remove unnecessary branch 2020-10-13 23:46 incoming Andrew Morton ` (154 preceding siblings ...) 2020-10-13 23:56 ` [patch 155/181] mm/zbud: remove redundant initialization Andrew Morton @ 2020-10-13 23:56 ` Andrew Morton 2020-10-13 23:57 ` [patch 157/181] include/linux/compaction.h: clean code by removing unused enum value Andrew Morton ` (24 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:56 UTC (permalink / raw) To: akpm, iamjoonsoo.kim, linux-mm, mateusznosek0, mgorman, mm-commits, rientjes, torvalds, vbabka From: Mateusz Nosek <mateusznosek0@gmail.com> Subject: mm/compaction.c: micro-optimization remove unnecessary branch The same code can work both for 'zone->compact_considered > defer_limit' and 'zone->compact_considered >= defer_limit'. In the latter there is one branch less which is more effective considering performance. Link: https://lkml.kernel.org/r/20200913190448.28649-1-mateusznosek0@gmail.com Signed-off-by: Mateusz Nosek <mateusznosek0@gmail.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com> Cc: Vlastimil Babka <vbabka@suse.cz> Cc: Mel Gorman <mgorman@suse.de> Cc: David Rientjes <rientjes@google.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/compaction.c | 5 ++--- 1 file changed, 2 insertions(+), 3 deletions(-) --- a/mm/compaction.c~mm-compactionc-micro-optimization-remove-unnecessary-branch +++ a/mm/compaction.c @@ -180,11 +180,10 @@ bool compaction_deferred(struct zone *zo return false; /* Avoid possible overflow */ - if (++zone->compact_considered > defer_limit) + if (++zone->compact_considered >= defer_limit) { zone->compact_considered = defer_limit; - - if (zone->compact_considered >= defer_limit) return false; + } trace_mm_compaction_deferred(zone, order); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 157/181] include/linux/compaction.h: clean code by removing unused enum value 2020-10-13 23:46 incoming Andrew Morton ` (155 preceding siblings ...) 2020-10-13 23:56 ` [patch 156/181] mm/compaction.c: micro-optimization remove unnecessary branch Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 158/181] selftests/vm: 8x compaction_test speedup Andrew Morton ` (23 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, linux-mm, mateusznosek0, mm-commits, torvalds From: Mateusz Nosek <mateusznosek0@gmail.com> Subject: include/linux/compaction.h: clean code by removing unused enum value The enum value 'COMPACT_INACTIVE' is never used so can be removed. Link: https://lkml.kernel.org/r/20200917110750.12015-1-mateusznosek0@gmail.com Signed-off-by: Mateusz Nosek <mateusznosek0@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/compaction.h | 3 --- 1 file changed, 3 deletions(-) --- a/include/linux/compaction.h~include-linux-compactionh-clean-code-by-removing-unused-enum-value +++ a/include/linux/compaction.h @@ -29,9 +29,6 @@ enum compact_result { /* compaction didn't start as it was deferred due to past failures */ COMPACT_DEFERRED, - /* compaction not active last round */ - COMPACT_INACTIVE = COMPACT_DEFERRED, - /* For more detailed tracepoint output - internal to compaction */ COMPACT_NO_SUITABLE_PAGE, /* compaction should continue to another pageblock */ _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 158/181] selftests/vm: 8x compaction_test speedup 2020-10-13 23:46 incoming Andrew Morton ` (156 preceding siblings ...) 2020-10-13 23:57 ` [patch 157/181] include/linux/compaction.h: clean code by removing unused enum value Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 159/181] mm/mempolicy: remove or narrow the lock on current Andrew Morton ` (22 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, jhubbard, linux-mm, mgorman, mm-commits, shuah, sjayaram, torvalds From: John Hubbard <jhubbard@nvidia.com> Subject: selftests/vm: 8x compaction_test speedup This patch reduces the running time for compaction_test from about 27 sec, to 3.3 sec, which is about an 8x speedup. These numbers are for an Intel x86_64 system with 32 GB of DRAM. The compaction_test.c program was spending most of its time doing mmap(), 1 MB at a time, on about 25 GB of memory. Instead, do the mmaps 100 MB at a time. (Going past 100 MB doesn't make things go much faster, because other parts of the program are using the remaining time.) Link: https://lkml.kernel.org/r/20201002080621.551044-2-jhubbard@nvidia.com Signed-off-by: John Hubbard <jhubbard@nvidia.com> Acked-by: Sri Jayaramappa <sjayaram@akamai.com> Cc: Shuah Khan <shuah@kernel.org> Cc: Mel Gorman <mgorman@techsingularity.net> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- tools/testing/selftests/vm/compaction_test.c | 11 ++++++----- 1 file changed, 6 insertions(+), 5 deletions(-) --- a/tools/testing/selftests/vm/compaction_test.c~selftests-vm-8x-compaction_test-speedup +++ a/tools/testing/selftests/vm/compaction_test.c @@ -18,7 +18,8 @@ #include "../kselftest.h" -#define MAP_SIZE 1048576 +#define MAP_SIZE_MB 100 +#define MAP_SIZE (MAP_SIZE_MB * 1024 * 1024) struct map_list { void *map; @@ -165,7 +166,7 @@ int main(int argc, char **argv) void *map = NULL; unsigned long mem_free = 0; unsigned long hugepage_size = 0; - unsigned long mem_fragmentable = 0; + long mem_fragmentable_MB = 0; if (prereq() != 0) { printf("Either the sysctl compact_unevictable_allowed is not\n" @@ -190,9 +191,9 @@ int main(int argc, char **argv) return -1; } - mem_fragmentable = mem_free * 0.8 / 1024; + mem_fragmentable_MB = mem_free * 0.8 / 1024; - while (mem_fragmentable > 0) { + while (mem_fragmentable_MB > 0) { map = mmap(NULL, MAP_SIZE, PROT_READ | PROT_WRITE, MAP_ANONYMOUS | MAP_PRIVATE | MAP_LOCKED, -1, 0); if (map == MAP_FAILED) @@ -213,7 +214,7 @@ int main(int argc, char **argv) for (i = 0; i < MAP_SIZE; i += page_size) *(unsigned long *)(map + i) = (unsigned long)map + i; - mem_fragmentable--; + mem_fragmentable_MB -= MAP_SIZE_MB; } for (entry = list; entry != NULL; entry = entry->next) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 159/181] mm/mempolicy: remove or narrow the lock on current 2020-10-13 23:46 incoming Andrew Morton ` (157 preceding siblings ...) 2020-10-13 23:57 ` [patch 158/181] selftests/vm: 8x compaction_test speedup Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 160/181] mm: remove unused alloc_page_vma_node() Andrew Morton ` (21 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, richard.weiyang, torvalds From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm/mempolicy: remove or narrow the lock on current It is not necessary to hold the lock of current when setting nodemask of a new policy. Link: https://lkml.kernel.org/r/20200921040416.86185-1-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mempolicy.c | 5 +---- 1 file changed, 1 insertion(+), 4 deletions(-) --- a/mm/mempolicy.c~mm-mempolicy-remove-or-narrow-the-lock-on-current +++ a/mm/mempolicy.c @@ -875,13 +875,12 @@ static long do_set_mempolicy(unsigned sh goto out; } - task_lock(current); ret = mpol_set_nodemask(new, nodes, scratch); if (ret) { - task_unlock(current); mpol_put(new); goto out; } + task_lock(current); old = current->mempolicy; current->mempolicy = new; if (new && new->mode == MPOL_INTERLEAVE) @@ -1324,9 +1323,7 @@ static long do_mbind(unsigned long start NODEMASK_SCRATCH(scratch); if (scratch) { mmap_write_lock(mm); - task_lock(current); err = mpol_set_nodemask(new, nmask, scratch); - task_unlock(current); if (err) mmap_write_unlock(mm); } else _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 160/181] mm: remove unused alloc_page_vma_node() 2020-10-13 23:46 incoming Andrew Morton ` (158 preceding siblings ...) 2020-10-13 23:57 ` [patch 159/181] mm/mempolicy: remove or narrow the lock on current Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 161/181] mm/mempool: add 'else' to split mutually exclusive case Andrew Morton ` (20 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, linux-mm, mm-commits, richard.weiyang, torvalds From: Wei Yang <richard.weiyang@linux.alibaba.com> Subject: mm: remove unused alloc_page_vma_node() No one use this macro anymore. Also fix code style of policy_node(). Link: https://lkml.kernel.org/r/20200921021401.84508-1-richard.weiyang@linux.alibaba.com Signed-off-by: Wei Yang <richard.weiyang@linux.alibaba.com> Reviewed-by: Andrew Morton <akpm@linux-foundation.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/gfp.h | 2 -- mm/mempolicy.c | 3 +-- 2 files changed, 1 insertion(+), 4 deletions(-) --- a/include/linux/gfp.h~mm-remove-unused-alloc_page_vma_node +++ a/include/linux/gfp.h @@ -562,8 +562,6 @@ extern struct page *alloc_pages_vma(gfp_ #define alloc_page(gfp_mask) alloc_pages(gfp_mask, 0) #define alloc_page_vma(gfp_mask, vma, addr) \ alloc_pages_vma(gfp_mask, 0, vma, addr, numa_node_id(), false) -#define alloc_page_vma_node(gfp_mask, vma, addr, node) \ - alloc_pages_vma(gfp_mask, 0, vma, addr, node, false) extern unsigned long __get_free_pages(gfp_t gfp_mask, unsigned int order); extern unsigned long get_zeroed_page(gfp_t gfp_mask); --- a/mm/mempolicy.c~mm-remove-unused-alloc_page_vma_node +++ a/mm/mempolicy.c @@ -1882,8 +1882,7 @@ nodemask_t *policy_nodemask(gfp_t gfp, s } /* Return the node id preferred by the given mempolicy, or the given id */ -static int policy_node(gfp_t gfp, struct mempolicy *policy, - int nd) +static int policy_node(gfp_t gfp, struct mempolicy *policy, int nd) { if (policy->mode == MPOL_PREFERRED && !(policy->flags & MPOL_F_LOCAL)) nd = policy->v.preferred_node; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 161/181] mm/mempool: add 'else' to split mutually exclusive case 2020-10-13 23:46 incoming Andrew Morton ` (159 preceding siblings ...) 2020-10-13 23:57 ` [patch 160/181] mm: remove unused alloc_page_vma_node() Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 162/181] KVM: PPC: Book3S HV: simplify kvm_cma_reserve() Andrew Morton ` (19 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, linmiaohe, linux-mm, mm-commits, torvalds From: Miaohe Lin <linmiaohe@huawei.com> Subject: mm/mempool: add 'else' to split mutually exclusive case Add else to split mutually exclusive case and avoid some unnecessary check. It doesn't seem to change code generation (compiler is smart), but I think it helps readability. [akpm@linux-foundation.org: fix comment location] Link: https://lkml.kernel.org/r/20200924111641.28922-1-linmiaohe@huawei.com Signed-off-by: Miaohe Lin <linmiaohe@huawei.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/mempool.c | 18 ++++++++---------- 1 file changed, 8 insertions(+), 10 deletions(-) --- a/mm/mempool.c~mm-mempool-add-else-to-split-mutually-exclusive-case +++ a/mm/mempool.c @@ -58,11 +58,10 @@ static void __check_element(mempool_t *p static void check_element(mempool_t *pool, void *element) { /* Mempools backed by slab allocator */ - if (pool->free == mempool_free_slab || pool->free == mempool_kfree) + if (pool->free == mempool_free_slab || pool->free == mempool_kfree) { __check_element(pool, element, ksize(element)); - - /* Mempools backed by page allocator */ - if (pool->free == mempool_free_pages) { + } else if (pool->free == mempool_free_pages) { + /* Mempools backed by page allocator */ int order = (int)(long)pool->pool_data; void *addr = kmap_atomic((struct page *)element); @@ -82,11 +81,10 @@ static void __poison_element(void *eleme static void poison_element(mempool_t *pool, void *element) { /* Mempools backed by slab allocator */ - if (pool->alloc == mempool_alloc_slab || pool->alloc == mempool_kmalloc) + if (pool->alloc == mempool_alloc_slab || pool->alloc == mempool_kmalloc) { __poison_element(element, ksize(element)); - - /* Mempools backed by page allocator */ - if (pool->alloc == mempool_alloc_pages) { + } else if (pool->alloc == mempool_alloc_pages) { + /* Mempools backed by page allocator */ int order = (int)(long)pool->pool_data; void *addr = kmap_atomic((struct page *)element); @@ -107,7 +105,7 @@ static __always_inline void kasan_poison { if (pool->alloc == mempool_alloc_slab || pool->alloc == mempool_kmalloc) kasan_poison_kfree(element, _RET_IP_); - if (pool->alloc == mempool_alloc_pages) + else if (pool->alloc == mempool_alloc_pages) kasan_free_pages(element, (unsigned long)pool->pool_data); } @@ -115,7 +113,7 @@ static void kasan_unpoison_element(mempo { if (pool->alloc == mempool_alloc_slab || pool->alloc == mempool_kmalloc) kasan_unpoison_slab(element); - if (pool->alloc == mempool_alloc_pages) + else if (pool->alloc == mempool_alloc_pages) kasan_alloc_pages(element, (unsigned long)pool->pool_data); } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 162/181] KVM: PPC: Book3S HV: simplify kvm_cma_reserve() 2020-10-13 23:46 incoming Andrew Morton ` (160 preceding siblings ...) 2020-10-13 23:57 ` [patch 161/181] mm/mempool: add 'else' to split mutually exclusive case Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 163/181] dma-contiguous: simplify cma_early_percent_memory() Andrew Morton ` (18 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: KVM: PPC: Book3S HV: simplify kvm_cma_reserve() Patch series "memblock: seasonal cleaning^w cleanup", v3. These patches simplify several uses of memblock iterators and hide some of the memblock implementation details from the rest of the system. This patch (of 17): The memory size calculation in kvm_cma_reserve() traverses memblock.memory rather than simply call memblock_phys_mem_size(). The comment in that function suggests that at some point there should have been call to memblock_analyze() before memblock_phys_mem_size() could be used. As of now, there is no memblock_analyze() at all and memblock_phys_mem_size() can be used as soon as cold-plug memory is registered with memblock. Replace loop over memblock.memory with a call to memblock_phys_mem_size(). Link: https://lkml.kernel.org/r/20200818151634.14343-1-rppt@kernel.org Link: https://lkml.kernel.org/r/20200818151634.14343-2-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Ingo Molnar <mingo@redhat.com> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Cc: Ingo Molnar <mingo@kernel.org> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/powerpc/kvm/book3s_hv_builtin.c | 12 ++---------- 1 file changed, 2 insertions(+), 10 deletions(-) --- a/arch/powerpc/kvm/book3s_hv_builtin.c~kvm-ppc-book3s-hv-simplify-kvm_cma_reserve +++ a/arch/powerpc/kvm/book3s_hv_builtin.c @@ -95,23 +95,15 @@ EXPORT_SYMBOL_GPL(kvm_free_hpt_cma); void __init kvm_cma_reserve(void) { unsigned long align_size; - struct memblock_region *reg; - phys_addr_t selected_size = 0; + phys_addr_t selected_size; /* * We need CMA reservation only when we are in HV mode */ if (!cpu_has_feature(CPU_FTR_HVMODE)) return; - /* - * We cannot use memblock_phys_mem_size() here, because - * memblock_analyze() has not been called yet. - */ - for_each_memblock(memory, reg) - selected_size += memblock_region_memory_end_pfn(reg) - - memblock_region_memory_base_pfn(reg); - selected_size = (selected_size * kvm_cma_resv_ratio / 100) << PAGE_SHIFT; + selected_size = PAGE_ALIGN(memblock_phys_mem_size() * kvm_cma_resv_ratio / 100); if (selected_size) { pr_info("%s: reserving %ld MiB for global area\n", __func__, (unsigned long)selected_size / SZ_1M); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 163/181] dma-contiguous: simplify cma_early_percent_memory() 2020-10-13 23:46 incoming Andrew Morton ` (161 preceding siblings ...) 2020-10-13 23:57 ` [patch 162/181] KVM: PPC: Book3S HV: simplify kvm_cma_reserve() Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 164/181] arm, xtensa: simplify initialization of high memory pages Andrew Morton ` (17 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: dma-contiguous: simplify cma_early_percent_memory() The memory size calculation in cma_early_percent_memory() traverses memblock.memory rather than simply call memblock_phys_mem_size(). The comment in that function suggests that at some point there should have been call to memblock_analyze() before memblock_phys_mem_size() could be used. As of now, there is no memblock_analyze() at all and memblock_phys_mem_size() can be used as soon as cold-plug memory is registered with memblock. Replace loop over memblock.memory with a call to memblock_phys_mem_size(). Link: https://lkml.kernel.org/r/20200818151634.14343-3-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Reviewed-by: Christoph Hellwig <hch@lst.de> Reviewed-by: Baoquan He <bhe@redhat.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- kernel/dma/contiguous.c | 11 +---------- 1 file changed, 1 insertion(+), 10 deletions(-) --- a/kernel/dma/contiguous.c~dma-contiguous-simplify-cma_early_percent_memory +++ a/kernel/dma/contiguous.c @@ -73,16 +73,7 @@ early_param("cma", early_cma); static phys_addr_t __init __maybe_unused cma_early_percent_memory(void) { - struct memblock_region *reg; - unsigned long total_pages = 0; - - /* - * We cannot use memblock_phys_mem_size() here, because - * memblock_analyze() has not been called yet. - */ - for_each_memblock(memory, reg) - total_pages += memblock_region_memory_end_pfn(reg) - - memblock_region_memory_base_pfn(reg); + unsigned long total_pages = PHYS_PFN(memblock_phys_mem_size()); return (total_pages * CONFIG_CMA_SIZE_PERCENTAGE / 100) << PAGE_SHIFT; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 164/181] arm, xtensa: simplify initialization of high memory pages 2020-10-13 23:46 incoming Andrew Morton ` (162 preceding siblings ...) 2020-10-13 23:57 ` [patch 163/181] dma-contiguous: simplify cma_early_percent_memory() Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 165/181] arm64: numa: simplify dummy_numa_init() Andrew Morton ` (16 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: arm, xtensa: simplify initialization of high memory pages free_highpages() in both arm and xtensa essentially open-code for_each_free_mem_range() loop to detect high memory pages that were not reserved and that should be initialized and passed to the buddy allocator. Replace open-coded implementation of for_each_free_mem_range() with usage of memblock API to simplify the code. Link: https://lkml.kernel.org/r/20200818151634.14343-4-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Reviewed-by: Max Filippov <jcmvbkbc@gmail.com> [xtensa] Tested-by: Max Filippov <jcmvbkbc@gmail.com> [xtensa] Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm/mm/init.c | 48 +++++----------------------------- arch/xtensa/mm/init.c | 55 +++++++--------------------------------- 2 files changed, 18 insertions(+), 85 deletions(-) --- a/arch/arm/mm/init.c~arm-xtensa-simplify-initialization-of-high-memory-pages +++ a/arch/arm/mm/init.c @@ -347,61 +347,29 @@ static void __init free_unused_memmap(vo #endif } -#ifdef CONFIG_HIGHMEM -static inline void free_area_high(unsigned long pfn, unsigned long end) -{ - for (; pfn < end; pfn++) - free_highmem_page(pfn_to_page(pfn)); -} -#endif - static void __init free_highpages(void) { #ifdef CONFIG_HIGHMEM unsigned long max_low = max_low_pfn; - struct memblock_region *mem, *res; + phys_addr_t range_start, range_end; + u64 i; /* set highmem page free */ - for_each_memblock(memory, mem) { - unsigned long start = memblock_region_memory_base_pfn(mem); - unsigned long end = memblock_region_memory_end_pfn(mem); + for_each_free_mem_range(i, NUMA_NO_NODE, MEMBLOCK_NONE, + &range_start, &range_end, NULL) { + unsigned long start = PHYS_PFN(range_start); + unsigned long end = PHYS_PFN(range_end); /* Ignore complete lowmem entries */ if (end <= max_low) continue; - if (memblock_is_nomap(mem)) - continue; - /* Truncate partial highmem entries */ if (start < max_low) start = max_low; - /* Find and exclude any reserved regions */ - for_each_memblock(reserved, res) { - unsigned long res_start, res_end; - - res_start = memblock_region_reserved_base_pfn(res); - res_end = memblock_region_reserved_end_pfn(res); - - if (res_end < start) - continue; - if (res_start < start) - res_start = start; - if (res_start > end) - res_start = end; - if (res_end > end) - res_end = end; - if (res_start != start) - free_area_high(start, res_start); - start = res_end; - if (start == end) - break; - } - - /* And now free anything which remains */ - if (start < end) - free_area_high(start, end); + for (; start < end; start++) + free_highmem_page(pfn_to_page(start)); } #endif } --- a/arch/xtensa/mm/init.c~arm-xtensa-simplify-initialization-of-high-memory-pages +++ a/arch/xtensa/mm/init.c @@ -79,67 +79,32 @@ void __init zones_init(void) free_area_init(max_zone_pfn); } -#ifdef CONFIG_HIGHMEM -static void __init free_area_high(unsigned long pfn, unsigned long end) -{ - for (; pfn < end; pfn++) - free_highmem_page(pfn_to_page(pfn)); -} - static void __init free_highpages(void) { +#ifdef CONFIG_HIGHMEM unsigned long max_low = max_low_pfn; - struct memblock_region *mem, *res; + phys_addr_t range_start, range_end; + u64 i; - reset_all_zones_managed_pages(); /* set highmem page free */ - for_each_memblock(memory, mem) { - unsigned long start = memblock_region_memory_base_pfn(mem); - unsigned long end = memblock_region_memory_end_pfn(mem); + for_each_free_mem_range(i, NUMA_NO_NODE, MEMBLOCK_NONE, + &range_start, &range_end, NULL) { + unsigned long start = PHYS_PFN(range_start); + unsigned long end = PHYS_PFN(range_end); /* Ignore complete lowmem entries */ if (end <= max_low) continue; - if (memblock_is_nomap(mem)) - continue; - /* Truncate partial highmem entries */ if (start < max_low) start = max_low; - /* Find and exclude any reserved regions */ - for_each_memblock(reserved, res) { - unsigned long res_start, res_end; - - res_start = memblock_region_reserved_base_pfn(res); - res_end = memblock_region_reserved_end_pfn(res); - - if (res_end < start) - continue; - if (res_start < start) - res_start = start; - if (res_start > end) - res_start = end; - if (res_end > end) - res_end = end; - if (res_start != start) - free_area_high(start, res_start); - start = res_end; - if (start == end) - break; - } - - /* And now free anything which remains */ - if (start < end) - free_area_high(start, end); + for (; start < end; start++) + free_highmem_page(pfn_to_page(start)); } -} -#else -static void __init free_highpages(void) -{ -} #endif +} /* * Initialize memory pages. _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 165/181] arm64: numa: simplify dummy_numa_init() 2020-10-13 23:46 incoming Andrew Morton ` (163 preceding siblings ...) 2020-10-13 23:57 ` [patch 164/181] arm, xtensa: simplify initialization of high memory pages Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 166/181] h8300, nds32, openrisc: simplify detection of memory extents Andrew Morton ` (15 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: arm64: numa: simplify dummy_numa_init() dummy_numa_init() loops over memblock.memory and passes nid=0 to numa_add_memblk() which essentially wraps memblock_set_node(). However, memblock_set_node() can cope with entire memory span itself, so the loop over memblock.memory regions is redundant. Using a single call to memblock_set_node() rather than a loop also fixes an issue with a buggy ACPI firmware in which the SRAT table covers some but not all of the memory in the EFI memory map. Jonathan Cameron says: This issue can be easily triggered by having an SRAT table which fails to cover all elements of the EFI memory map. This firmware error is detected and a warning printed. e.g. "NUMA: Warning: invalid memblk node 64 [mem 0x240000000-0x27fffffff]" At that point we fall back to dummy_numa_init(). However, the failed ACPI init has left us with our memblocks all broken up as we split them when trying to assign them to NUMA nodes. We then iterate over the memblocks and add them to node 0. numa_add_memblk() calls memblock_set_node() which merges regions that were previously split up during the earlier attempt to add them to different nodes during parsing of SRAT. This means elements are moved in the memblock array and we can end up in a different memblock after the call to numa_add_memblk(). Result is: Unable to handle kernel paging request at virtual address 0000000000003a40 Mem abort info: ESR = 0x96000004 EC = 0x25: DABT (current EL), IL = 32 bits SET = 0, FnV = 0 EA = 0, S1PTW = 0 Data abort info: ISV = 0, ISS = 0x00000004 CM = 0, WnR = 0 [0000000000003a40] user address but active_mm is swapper Internal error: Oops: 96000004 [#1] PREEMPT SMP ... Call trace: sparse_init_nid+0x5c/0x2b0 sparse_init+0x138/0x170 bootmem_init+0x80/0xe0 setup_arch+0x2a0/0x5fc start_kernel+0x8c/0x648 Replace the loop with a single call to memblock_set_node() to the entire memory. Link: https://lkml.kernel.org/r/20200818151634.14343-5-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Acked-by: Jonathan Cameron <Jonathan.Cameron@huawei.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm64/mm/numa.c | 13 +++++-------- 1 file changed, 5 insertions(+), 8 deletions(-) --- a/arch/arm64/mm/numa.c~arm64-numa-simplify-dummy_numa_init +++ a/arch/arm64/mm/numa.c @@ -427,19 +427,16 @@ out_free_distance: */ static int __init dummy_numa_init(void) { + phys_addr_t start = memblock_start_of_DRAM(); + phys_addr_t end = memblock_end_of_DRAM(); int ret; - struct memblock_region *mblk; if (numa_off) pr_info("NUMA disabled\n"); /* Forced off on command line. */ - pr_info("Faking a node at [mem %#018Lx-%#018Lx]\n", - memblock_start_of_DRAM(), memblock_end_of_DRAM() - 1); - - for_each_memblock(memory, mblk) { - ret = numa_add_memblk(0, mblk->base, mblk->base + mblk->size); - if (!ret) - continue; + pr_info("Faking a node at [mem %#018Lx-%#018Lx]\n", start, end - 1); + ret = numa_add_memblk(0, start, end); + if (ret) { pr_err("NUMA init failed\n"); return ret; } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 166/181] h8300, nds32, openrisc: simplify detection of memory extents 2020-10-13 23:46 incoming Andrew Morton ` (164 preceding siblings ...) 2020-10-13 23:57 ` [patch 165/181] arm64: numa: simplify dummy_numa_init() Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 167/181] riscv: drop unneeded node initialization Andrew Morton ` (14 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: h8300, nds32, openrisc: simplify detection of memory extents Instead of traversing memblock.memory regions to find memory_start and memory_end, simply query memblock_{start,end}_of_DRAM(). Link: https://lkml.kernel.org/r/20200818151634.14343-6-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Acked-by: Stafford Horne <shorne@gmail.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/h8300/kernel/setup.c | 8 +++----- arch/nds32/kernel/setup.c | 8 ++------ arch/openrisc/kernel/setup.c | 9 ++------- 3 files changed, 7 insertions(+), 18 deletions(-) --- a/arch/h8300/kernel/setup.c~h8300-nds32-openrisc-simplify-detection-of-memory-extents +++ a/arch/h8300/kernel/setup.c @@ -74,17 +74,15 @@ static void __init bootmem_init(void) memory_end = memory_start = 0; /* Find main memory where is the kernel */ - for_each_memblock(memory, region) { - memory_start = region->base; - memory_end = region->base + region->size; - } + memory_start = memblock_start_of_DRAM(); + memory_end = memblock_end_of_DRAM(); if (!memory_end) panic("No memory!"); /* setup bootmem globals (we use no_bootmem, but mm still depends on this) */ min_low_pfn = PFN_UP(memory_start); - max_low_pfn = PFN_DOWN(memblock_end_of_DRAM()); + max_low_pfn = PFN_DOWN(memory_end); max_pfn = max_low_pfn; memblock_reserve(__pa(_stext), _end - _stext); --- a/arch/nds32/kernel/setup.c~h8300-nds32-openrisc-simplify-detection-of-memory-extents +++ a/arch/nds32/kernel/setup.c @@ -249,12 +249,8 @@ static void __init setup_memory(void) memory_end = memory_start = 0; /* Find main memory where is the kernel */ - for_each_memblock(memory, region) { - memory_start = region->base; - memory_end = region->base + region->size; - pr_info("%s: Memory: 0x%x-0x%x\n", __func__, - memory_start, memory_end); - } + memory_start = memblock_start_of_DRAM(); + memory_end = memblock_end_of_DRAM(); if (!memory_end) { panic("No memory!"); --- a/arch/openrisc/kernel/setup.c~h8300-nds32-openrisc-simplify-detection-of-memory-extents +++ a/arch/openrisc/kernel/setup.c @@ -48,17 +48,12 @@ static void __init setup_memory(void) unsigned long ram_start_pfn; unsigned long ram_end_pfn; phys_addr_t memory_start, memory_end; - struct memblock_region *region; memory_end = memory_start = 0; /* Find main memory where is the kernel, we assume its the only one */ - for_each_memblock(memory, region) { - memory_start = region->base; - memory_end = region->base + region->size; - printk(KERN_INFO "%s: Memory: 0x%x-0x%x\n", __func__, - memory_start, memory_end); - } + memory_start = memblock_start_of_DRAM(); + memory_end = memblock_end_of_DRAM(); if (!memory_end) { panic("No memory!"); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 167/181] riscv: drop unneeded node initialization 2020-10-13 23:46 incoming Andrew Morton ` (165 preceding siblings ...) 2020-10-13 23:57 ` [patch 166/181] h8300, nds32, openrisc: simplify detection of memory extents Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 168/181] mircoblaze: drop unneeded NUMA and sparsemem initializations Andrew Morton ` (13 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: riscv: drop unneeded node initialization RISC-V does not (yet) support NUMA and for UMA architectures node 0 is used implicitly during early memory initialization. There is no need to call memblock_set_node(), remove this call and the surrounding code. Link: https://lkml.kernel.org/r/20200818151634.14343-7-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/riscv/mm/init.c | 9 --------- 1 file changed, 9 deletions(-) --- a/arch/riscv/mm/init.c~riscv-drop-unneeded-node-initialization +++ a/arch/riscv/mm/init.c @@ -191,15 +191,6 @@ void __init setup_bootmem(void) early_init_fdt_scan_reserved_mem(); memblock_allow_resize(); memblock_dump_all(); - - for_each_memblock(memory, reg) { - unsigned long start_pfn = memblock_region_memory_base_pfn(reg); - unsigned long end_pfn = memblock_region_memory_end_pfn(reg); - - memblock_set_node(PFN_PHYS(start_pfn), - PFN_PHYS(end_pfn - start_pfn), - &memblock.memory, 0); - } } #ifdef CONFIG_MMU _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 168/181] mircoblaze: drop unneeded NUMA and sparsemem initializations 2020-10-13 23:46 incoming Andrew Morton ` (166 preceding siblings ...) 2020-10-13 23:57 ` [patch 167/181] riscv: drop unneeded node initialization Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 169/181] memblock: make for_each_memblock_type() iterator private Andrew Morton ` (12 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: mircoblaze: drop unneeded NUMA and sparsemem initializations microblaze does not support neither NUMA not SPARSMEM, so there is no point to call memblock_set_node() and sparse_memory_present_with_active_regions() functions during microblaze memory initialization. Remove these calls and the surrounding code. Link: https://lkml.kernel.org/r/20200818151634.14343-8-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/microblaze/mm/init.c | 14 +------------- 1 file changed, 1 insertion(+), 13 deletions(-) --- a/arch/microblaze/mm/init.c~mircoblaze-drop-unneeded-numa-and-sparsemem-initializations +++ a/arch/microblaze/mm/init.c @@ -108,9 +108,8 @@ static void __init paging_init(void) void __init setup_memory(void) { - struct memblock_region *reg; - #ifndef CONFIG_MMU + struct memblock_region *reg; u32 kernel_align_start, kernel_align_size; /* Find main memory where is the kernel */ @@ -164,17 +163,6 @@ void __init setup_memory(void) pr_info("%s: max_low_pfn: %#lx\n", __func__, max_low_pfn); pr_info("%s: max_pfn: %#lx\n", __func__, max_pfn); - /* Add active regions with valid PFNs */ - for_each_memblock(memory, reg) { - unsigned long start_pfn, end_pfn; - - start_pfn = memblock_region_memory_base_pfn(reg); - end_pfn = memblock_region_memory_end_pfn(reg); - memblock_set_node(start_pfn << PAGE_SHIFT, - (end_pfn - start_pfn) << PAGE_SHIFT, - &memblock.memory, 0); - } - paging_init(); } _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 169/181] memblock: make for_each_memblock_type() iterator private 2020-10-13 23:46 incoming Andrew Morton ` (167 preceding siblings ...) 2020-10-13 23:57 ` [patch 168/181] mircoblaze: drop unneeded NUMA and sparsemem initializations Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 170/181] memblock: make memblock_debug and related functionality private Andrew Morton ` (11 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: memblock: make for_each_memblock_type() iterator private for_each_memblock_type() is not used outside mm/memblock.c, move it there from include/linux/memblock.h Link: https://lkml.kernel.org/r/20200818151634.14343-9-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Reviewed-by: Baoquan He <bhe@redhat.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/memblock.h | 5 ----- mm/memblock.c | 5 +++++ 2 files changed, 5 insertions(+), 5 deletions(-) --- a/include/linux/memblock.h~memblock-make-for_each_memblock_type-iterator-private +++ a/include/linux/memblock.h @@ -552,11 +552,6 @@ static inline unsigned long memblock_reg region < (memblock.memblock_type.regions + memblock.memblock_type.cnt); \ region++) -#define for_each_memblock_type(i, memblock_type, rgn) \ - for (i = 0, rgn = &memblock_type->regions[0]; \ - i < memblock_type->cnt; \ - i++, rgn = &memblock_type->regions[i]) - extern void *alloc_large_system_hash(const char *tablename, unsigned long bucketsize, unsigned long numentries, --- a/mm/memblock.c~memblock-make-for_each_memblock_type-iterator-private +++ a/mm/memblock.c @@ -132,6 +132,11 @@ struct memblock_type physmem = { }; #endif +#define for_each_memblock_type(i, memblock_type, rgn) \ + for (i = 0, rgn = &memblock_type->regions[0]; \ + i < memblock_type->cnt; \ + i++, rgn = &memblock_type->regions[i]) + int memblock_debug __initdata_memblock; static bool system_has_some_mirror __initdata_memblock = false; static int memblock_can_resize __initdata_memblock; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 170/181] memblock: make memblock_debug and related functionality private 2020-10-13 23:46 incoming Andrew Morton ` (168 preceding siblings ...) 2020-10-13 23:57 ` [patch 169/181] memblock: make for_each_memblock_type() iterator private Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:57 ` [patch 171/181] memblock: reduce number of parameters in for_each_mem_range() Andrew Morton ` (10 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: memblock: make memblock_debug and related functionality private The only user of memblock_dbg() outside memblock was s390 setup code and it is converted to use pr_debug() instead. This allows to stop exposing memblock_debug and memblock_dbg() to the rest of the kernel. [akpm@linux-foundation.org: make memblock_dbg() safer and neater] Link: https://lkml.kernel.org/r/20200818151634.14343-10-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Reviewed-by: Baoquan He <bhe@redhat.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/s390/kernel/setup.c | 4 ++-- include/linux/memblock.h | 12 +----------- mm/memblock.c | 16 ++++++++++++++-- 3 files changed, 17 insertions(+), 15 deletions(-) --- a/arch/s390/kernel/setup.c~memblock-make-memblock_debug-and-related-functionality-private +++ a/arch/s390/kernel/setup.c @@ -776,8 +776,8 @@ static void __init memblock_add_mem_dete unsigned long start, end; int i; - memblock_dbg("physmem info source: %s (%hhd)\n", - get_mem_info_source(), mem_detect.info_source); + pr_debug("physmem info source: %s (%hhd)\n", + get_mem_info_source(), mem_detect.info_source); /* keep memblock lists close to the kernel */ memblock_set_bottom_up(true); for_each_mem_detect_block(i, &start, &end) { --- a/include/linux/memblock.h~memblock-make-memblock_debug-and-related-functionality-private +++ a/include/linux/memblock.h @@ -86,7 +86,6 @@ struct memblock { }; extern struct memblock memblock; -extern int memblock_debug; #ifndef CONFIG_ARCH_KEEP_MEMBLOCK #define __init_memblock __meminit @@ -98,9 +97,6 @@ void memblock_discard(void); static inline void memblock_discard(void) {} #endif -#define memblock_dbg(fmt, ...) \ - if (memblock_debug) printk(KERN_INFO pr_fmt(fmt), ##__VA_ARGS__) - phys_addr_t memblock_find_in_range(phys_addr_t start, phys_addr_t end, phys_addr_t size, phys_addr_t align); void memblock_allow_resize(void); @@ -476,13 +472,7 @@ bool memblock_is_region_memory(phys_addr bool memblock_is_reserved(phys_addr_t addr); bool memblock_is_region_reserved(phys_addr_t base, phys_addr_t size); -extern void __memblock_dump_all(void); - -static inline void memblock_dump_all(void) -{ - if (memblock_debug) - __memblock_dump_all(); -} +void memblock_dump_all(void); /** * memblock_set_current_limit - Set the current allocation limit to allow --- a/mm/memblock.c~memblock-make-memblock_debug-and-related-functionality-private +++ a/mm/memblock.c @@ -137,7 +137,13 @@ struct memblock_type physmem = { i < memblock_type->cnt; \ i++, rgn = &memblock_type->regions[i]) -int memblock_debug __initdata_memblock; +#define memblock_dbg(fmt, ...) \ + do { \ + if (memblock_debug) \ + pr_info(fmt, ##__VA_ARGS__); \ + } while (0) + +static int memblock_debug __initdata_memblock; static bool system_has_some_mirror __initdata_memblock = false; static int memblock_can_resize __initdata_memblock; static int memblock_memory_in_slab __initdata_memblock = 0; @@ -1920,7 +1926,7 @@ static void __init_memblock memblock_dum } } -void __init_memblock __memblock_dump_all(void) +static void __init_memblock __memblock_dump_all(void) { pr_info("MEMBLOCK configuration:\n"); pr_info(" memory size = %pa reserved size = %pa\n", @@ -1934,6 +1940,12 @@ void __init_memblock __memblock_dump_all #endif } +void __init_memblock memblock_dump_all(void) +{ + if (memblock_debug) + __memblock_dump_all(); +} + void __init memblock_allow_resize(void) { memblock_can_resize = 1; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 171/181] memblock: reduce number of parameters in for_each_mem_range() 2020-10-13 23:46 incoming Andrew Morton ` (169 preceding siblings ...) 2020-10-13 23:57 ` [patch 170/181] memblock: make memblock_debug and related functionality private Andrew Morton @ 2020-10-13 23:57 ` Andrew Morton 2020-10-13 23:58 ` [patch 172/181] arch, mm: replace for_each_memblock() with for_each_mem_pfn_range() Andrew Morton ` (9 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:57 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: memblock: reduce number of parameters in for_each_mem_range() Currently for_each_mem_range() and for_each_mem_range_rev() iterators are the most generic way to traverse memblock regions. As such, they have 8 parameters and they are hardly convenient to users. Most users choose to utilize one of their wrappers and the only user that actually needs most of the parameters is memblock itself. To avoid yet another naming for memblock iterators, rename the existing for_each_mem_range[_rev]() to __for_each_mem_range[_rev]() and add a new for_each_mem_range[_rev]() wrappers with only index, start and end parameters. The new wrapper nicely fits into init_unavailable_mem() and will be used in upcoming changes to simplify memblock traversals. Link: https://lkml.kernel.org/r/20200818151634.14343-11-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Acked-by: Thomas Bogendoerfer <tsbogend@alpha.franken.de> [MIPS] Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- .clang-format | 2 + arch/arm64/kernel/machine_kexec_file.c | 6 +-- arch/powerpc/kexec/file_load_64.c | 6 +-- include/linux/memblock.h | 41 +++++++++++++++++------ mm/page_alloc.c | 3 - 5 files changed, 38 insertions(+), 20 deletions(-) --- a/arch/arm64/kernel/machine_kexec_file.c~memblock-reduce-number-of-parameters-in-for_each_mem_range +++ a/arch/arm64/kernel/machine_kexec_file.c @@ -215,8 +215,7 @@ static int prepare_elf_headers(void **ad phys_addr_t start, end; nr_ranges = 1; /* for exclusion of crashkernel region */ - for_each_mem_range(i, &memblock.memory, NULL, NUMA_NO_NODE, - MEMBLOCK_NONE, &start, &end, NULL) + for_each_mem_range(i, &start, &end) nr_ranges++; cmem = kmalloc(struct_size(cmem, ranges, nr_ranges), GFP_KERNEL); @@ -225,8 +224,7 @@ static int prepare_elf_headers(void **ad cmem->max_nr_ranges = nr_ranges; cmem->nr_ranges = 0; - for_each_mem_range(i, &memblock.memory, NULL, NUMA_NO_NODE, - MEMBLOCK_NONE, &start, &end, NULL) { + for_each_mem_range(i, &start, &end) { cmem->ranges[cmem->nr_ranges].start = start; cmem->ranges[cmem->nr_ranges].end = end - 1; cmem->nr_ranges++; --- a/arch/powerpc/kexec/file_load_64.c~memblock-reduce-number-of-parameters-in-for_each_mem_range +++ a/arch/powerpc/kexec/file_load_64.c @@ -250,8 +250,7 @@ static int __locate_mem_hole_top_down(st phys_addr_t start, end; u64 i; - for_each_mem_range_rev(i, &memblock.memory, NULL, NUMA_NO_NODE, - MEMBLOCK_NONE, &start, &end, NULL) { + for_each_mem_range_rev(i, &start, &end) { /* * memblock uses [start, end) convention while it is * [start, end] here. Fix the off-by-one to have the @@ -350,8 +349,7 @@ static int __locate_mem_hole_bottom_up(s phys_addr_t start, end; u64 i; - for_each_mem_range(i, &memblock.memory, NULL, NUMA_NO_NODE, - MEMBLOCK_NONE, &start, &end, NULL) { + for_each_mem_range(i, &start, &end) { /* * memblock uses [start, end) convention while it is * [start, end] here. Fix the off-by-one to have the --- a/.clang-format~memblock-reduce-number-of-parameters-in-for_each_mem_range +++ a/.clang-format @@ -207,7 +207,9 @@ ForEachMacros: - 'for_each_memblock_type' - 'for_each_memcg_cache_index' - 'for_each_mem_pfn_range' + - '__for_each_mem_range' - 'for_each_mem_range' + - '__for_each_mem_range_rev' - 'for_each_mem_range_rev' - 'for_each_migratetype_order' - 'for_each_msi_entry' --- a/include/linux/memblock.h~memblock-reduce-number-of-parameters-in-for_each_mem_range +++ a/include/linux/memblock.h @@ -162,7 +162,7 @@ static inline void __next_physmem_range( #endif /* CONFIG_HAVE_MEMBLOCK_PHYS_MAP */ /** - * for_each_mem_range - iterate through memblock areas from type_a and not + * __for_each_mem_range - iterate through memblock areas from type_a and not * included in type_b. Or just type_a if type_b is NULL. * @i: u64 used as loop variable * @type_a: ptr to memblock_type to iterate @@ -173,7 +173,7 @@ static inline void __next_physmem_range( * @p_end: ptr to phys_addr_t for end address of the range, can be %NULL * @p_nid: ptr to int for nid of the range, can be %NULL */ -#define for_each_mem_range(i, type_a, type_b, nid, flags, \ +#define __for_each_mem_range(i, type_a, type_b, nid, flags, \ p_start, p_end, p_nid) \ for (i = 0, __next_mem_range(&i, nid, flags, type_a, type_b, \ p_start, p_end, p_nid); \ @@ -182,7 +182,7 @@ static inline void __next_physmem_range( p_start, p_end, p_nid)) /** - * for_each_mem_range_rev - reverse iterate through memblock areas from + * __for_each_mem_range_rev - reverse iterate through memblock areas from * type_a and not included in type_b. Or just type_a if type_b is NULL. * @i: u64 used as loop variable * @type_a: ptr to memblock_type to iterate @@ -193,16 +193,37 @@ static inline void __next_physmem_range( * @p_end: ptr to phys_addr_t for end address of the range, can be %NULL * @p_nid: ptr to int for nid of the range, can be %NULL */ -#define for_each_mem_range_rev(i, type_a, type_b, nid, flags, \ - p_start, p_end, p_nid) \ +#define __for_each_mem_range_rev(i, type_a, type_b, nid, flags, \ + p_start, p_end, p_nid) \ for (i = (u64)ULLONG_MAX, \ - __next_mem_range_rev(&i, nid, flags, type_a, type_b,\ + __next_mem_range_rev(&i, nid, flags, type_a, type_b, \ p_start, p_end, p_nid); \ i != (u64)ULLONG_MAX; \ __next_mem_range_rev(&i, nid, flags, type_a, type_b, \ p_start, p_end, p_nid)) /** + * for_each_mem_range - iterate through memory areas. + * @i: u64 used as loop variable + * @p_start: ptr to phys_addr_t for start address of the range, can be %NULL + * @p_end: ptr to phys_addr_t for end address of the range, can be %NULL + */ +#define for_each_mem_range(i, p_start, p_end) \ + __for_each_mem_range(i, &memblock.memory, NULL, NUMA_NO_NODE, \ + MEMBLOCK_NONE, p_start, p_end, NULL) + +/** + * for_each_mem_range_rev - reverse iterate through memblock areas from + * type_a and not included in type_b. Or just type_a if type_b is NULL. + * @i: u64 used as loop variable + * @p_start: ptr to phys_addr_t for start address of the range, can be %NULL + * @p_end: ptr to phys_addr_t for end address of the range, can be %NULL + */ +#define for_each_mem_range_rev(i, p_start, p_end) \ + __for_each_mem_range_rev(i, &memblock.memory, NULL, NUMA_NO_NODE, \ + MEMBLOCK_NONE, p_start, p_end, NULL) + +/** * for_each_reserved_mem_region - iterate over all reserved memblock areas * @i: u64 used as loop variable * @p_start: ptr to phys_addr_t for start address of the range, can be %NULL @@ -307,8 +328,8 @@ int __init deferred_page_init_max_thread * soon as memblock is initialized. */ #define for_each_free_mem_range(i, nid, flags, p_start, p_end, p_nid) \ - for_each_mem_range(i, &memblock.memory, &memblock.reserved, \ - nid, flags, p_start, p_end, p_nid) + __for_each_mem_range(i, &memblock.memory, &memblock.reserved, \ + nid, flags, p_start, p_end, p_nid) /** * for_each_free_mem_range_reverse - rev-iterate through free memblock areas @@ -324,8 +345,8 @@ int __init deferred_page_init_max_thread */ #define for_each_free_mem_range_reverse(i, nid, flags, p_start, p_end, \ p_nid) \ - for_each_mem_range_rev(i, &memblock.memory, &memblock.reserved, \ - nid, flags, p_start, p_end, p_nid) + __for_each_mem_range_rev(i, &memblock.memory, &memblock.reserved, \ + nid, flags, p_start, p_end, p_nid) int memblock_set_node(phys_addr_t base, phys_addr_t size, struct memblock_type *type, int nid); --- a/mm/page_alloc.c~memblock-reduce-number-of-parameters-in-for_each_mem_range +++ a/mm/page_alloc.c @@ -6990,8 +6990,7 @@ static void __init init_unavailable_mem( * Loop through unavailable ranges not covered by memblock.memory. */ pgcnt = 0; - for_each_mem_range(i, &memblock.memory, NULL, - NUMA_NO_NODE, MEMBLOCK_NONE, &start, &end, NULL) { + for_each_mem_range(i, &start, &end) { if (next < start) pgcnt += init_unavailable_range(PFN_DOWN(next), PFN_UP(start)); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 172/181] arch, mm: replace for_each_memblock() with for_each_mem_pfn_range() 2020-10-13 23:46 incoming Andrew Morton ` (170 preceding siblings ...) 2020-10-13 23:57 ` [patch 171/181] memblock: reduce number of parameters in for_each_mem_range() Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 173/181] arch, drivers: replace for_each_membock() with for_each_mem_range() Andrew Morton ` (8 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: arch, mm: replace for_each_memblock() with for_each_mem_pfn_range() There are several occurrences of the following pattern: for_each_memblock(memory, reg) { start_pfn = memblock_region_memory_base_pfn(reg); end_pfn = memblock_region_memory_end_pfn(reg); /* do something with start_pfn and end_pfn */ } Rather than iterate over all memblock.memory regions and each time query for their start and end PFNs, use for_each_mem_pfn_range() iterator to get simpler and clearer code. Link: https://lkml.kernel.org/r/20200818151634.14343-12-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Reviewed-by: Baoquan He <bhe@redhat.com> Acked-by: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> [.clang-format] Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm/mm/init.c | 11 ++++------- arch/arm64/mm/init.c | 11 ++++------- arch/powerpc/kernel/fadump.c | 11 ++++++----- arch/powerpc/mm/mem.c | 15 ++++++++------- arch/powerpc/mm/numa.c | 7 ++----- arch/s390/mm/page-states.c | 6 ++---- arch/sh/mm/init.c | 9 +++------ mm/memblock.c | 6 ++---- mm/sparse.c | 10 ++++------ 9 files changed, 35 insertions(+), 51 deletions(-) --- a/arch/arm64/mm/init.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/arch/arm64/mm/init.c @@ -471,12 +471,10 @@ static inline void free_memmap(unsigned */ static void __init free_unused_memmap(void) { - unsigned long start, prev_end = 0; - struct memblock_region *reg; - - for_each_memblock(memory, reg) { - start = __phys_to_pfn(reg->base); + unsigned long start, end, prev_end = 0; + int i; + for_each_mem_pfn_range(i, MAX_NUMNODES, &start, &end, NULL) { #ifdef CONFIG_SPARSEMEM /* * Take care not to free memmap entries that don't exist due @@ -496,8 +494,7 @@ static void __init free_unused_memmap(vo * memmap entries are valid from the bank end aligned to * MAX_ORDER_NR_PAGES. */ - prev_end = ALIGN(__phys_to_pfn(reg->base + reg->size), - MAX_ORDER_NR_PAGES); + prev_end = ALIGN(end, MAX_ORDER_NR_PAGES); } #ifdef CONFIG_SPARSEMEM --- a/arch/arm/mm/init.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/arch/arm/mm/init.c @@ -299,16 +299,14 @@ free_memmap(unsigned long start_pfn, uns */ static void __init free_unused_memmap(void) { - unsigned long start, prev_end = 0; - struct memblock_region *reg; + unsigned long start, end, prev_end = 0; + int i; /* * This relies on each bank being in address order. * The banks are sorted previously in bootmem_init(). */ - for_each_memblock(memory, reg) { - start = memblock_region_memory_base_pfn(reg); - + for_each_mem_pfn_range(i, MAX_NUMNODES, &start, &end, NULL) { #ifdef CONFIG_SPARSEMEM /* * Take care not to free memmap entries that don't exist @@ -336,8 +334,7 @@ static void __init free_unused_memmap(vo * memmap entries are valid from the bank end aligned to * MAX_ORDER_NR_PAGES. */ - prev_end = ALIGN(memblock_region_memory_end_pfn(reg), - MAX_ORDER_NR_PAGES); + prev_end = ALIGN(end, MAX_ORDER_NR_PAGES); } #ifdef CONFIG_SPARSEMEM --- a/arch/powerpc/kernel/fadump.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/arch/powerpc/kernel/fadump.c @@ -1242,14 +1242,15 @@ static void fadump_free_reserved_memory( */ static void fadump_release_reserved_area(u64 start, u64 end) { - u64 tstart, tend, spfn, epfn; - struct memblock_region *reg; + u64 tstart, tend, spfn, epfn, reg_spfn, reg_epfn, i; spfn = PHYS_PFN(start); epfn = PHYS_PFN(end); - for_each_memblock(memory, reg) { - tstart = max_t(u64, spfn, memblock_region_memory_base_pfn(reg)); - tend = min_t(u64, epfn, memblock_region_memory_end_pfn(reg)); + + for_each_mem_pfn_range(i, MAX_NUMNODES, ®_spfn, ®_epfn, NULL) { + tstart = max_t(u64, spfn, reg_spfn); + tend = min_t(u64, epfn, reg_epfn); + if (tstart < tend) { fadump_free_reserved_memory(tstart, tend); --- a/arch/powerpc/mm/mem.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/arch/powerpc/mm/mem.c @@ -184,15 +184,16 @@ void __init initmem_init(void) /* mark pages that don't exist as nosave */ static int __init mark_nonram_nosave(void) { - struct memblock_region *reg, *prev = NULL; + unsigned long spfn, epfn, prev = 0; + int i; - for_each_memblock(memory, reg) { - if (prev && - memblock_region_memory_end_pfn(prev) < memblock_region_memory_base_pfn(reg)) - register_nosave_region(memblock_region_memory_end_pfn(prev), - memblock_region_memory_base_pfn(reg)); - prev = reg; + for_each_mem_pfn_range(i, MAX_NUMNODES, &spfn, &epfn, NULL) { + if (prev && prev < spfn) + register_nosave_region(prev, spfn); + + prev = epfn; } + return 0; } #else /* CONFIG_NEED_MULTIPLE_NODES */ --- a/arch/powerpc/mm/numa.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/arch/powerpc/mm/numa.c @@ -804,17 +804,14 @@ static void __init setup_nonnuma(void) unsigned long total_ram = memblock_phys_mem_size(); unsigned long start_pfn, end_pfn; unsigned int nid = 0; - struct memblock_region *reg; + int i; printk(KERN_DEBUG "Top of RAM: 0x%lx, Total RAM: 0x%lx\n", top_of_ram, total_ram); printk(KERN_DEBUG "Memory hole size: %ldMB\n", (top_of_ram - total_ram) >> 20); - for_each_memblock(memory, reg) { - start_pfn = memblock_region_memory_base_pfn(reg); - end_pfn = memblock_region_memory_end_pfn(reg); - + for_each_mem_pfn_range(i, MAX_NUMNODES, &start_pfn, &end_pfn, NULL) { fake_numa_create_new_node(end_pfn, &nid); memblock_set_node(PFN_PHYS(start_pfn), PFN_PHYS(end_pfn - start_pfn), --- a/arch/s390/mm/page-states.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/arch/s390/mm/page-states.c @@ -183,9 +183,9 @@ static void mark_kernel_pgd(void) void __init cmma_init_nodat(void) { - struct memblock_region *reg; struct page *page; unsigned long start, end, ix; + int i; if (cmma_flag < 2) return; @@ -193,9 +193,7 @@ void __init cmma_init_nodat(void) mark_kernel_pgd(); /* Set all kernel pages not used for page tables to stable/no-dat */ - for_each_memblock(memory, reg) { - start = memblock_region_memory_base_pfn(reg); - end = memblock_region_memory_end_pfn(reg); + for_each_mem_pfn_range(i, MAX_NUMNODES, &start, &end, NULL) { page = pfn_to_page(start); for (ix = start; ix < end; ix++, page++) { if (__test_and_clear_bit(PG_arch_1, &page->flags)) --- a/arch/sh/mm/init.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/arch/sh/mm/init.c @@ -226,15 +226,12 @@ void __init allocate_pgdat(unsigned int static void __init do_init_bootmem(void) { - struct memblock_region *reg; + unsigned long start_pfn, end_pfn; + int i; /* Add active regions with valid PFNs. */ - for_each_memblock(memory, reg) { - unsigned long start_pfn, end_pfn; - start_pfn = memblock_region_memory_base_pfn(reg); - end_pfn = memblock_region_memory_end_pfn(reg); + for_each_mem_pfn_range(i, MAX_NUMNODES, &start_pfn, &end_pfn, NULL) __add_active_range(0, start_pfn, end_pfn); - } /* All of system RAM sits in node 0 for the non-NUMA case */ allocate_pgdat(0); --- a/mm/memblock.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/mm/memblock.c @@ -1663,12 +1663,10 @@ phys_addr_t __init_memblock memblock_res phys_addr_t __init memblock_mem_size(unsigned long limit_pfn) { unsigned long pages = 0; - struct memblock_region *r; unsigned long start_pfn, end_pfn; + int i; - for_each_memblock(memory, r) { - start_pfn = memblock_region_memory_base_pfn(r); - end_pfn = memblock_region_memory_end_pfn(r); + for_each_mem_pfn_range(i, MAX_NUMNODES, &start_pfn, &end_pfn, NULL) { start_pfn = min_t(unsigned long, start_pfn, limit_pfn); end_pfn = min_t(unsigned long, end_pfn, limit_pfn); pages += end_pfn - start_pfn; --- a/mm/sparse.c~arch-mm-replace-for_each_memblock-with-for_each_mem_pfn_range +++ a/mm/sparse.c @@ -291,13 +291,11 @@ static void __init memory_present(int ni */ static void __init memblocks_present(void) { - struct memblock_region *reg; + unsigned long start, end; + int i, nid; - for_each_memblock(memory, reg) { - memory_present(memblock_get_region_node(reg), - memblock_region_memory_base_pfn(reg), - memblock_region_memory_end_pfn(reg)); - } + for_each_mem_pfn_range(i, MAX_NUMNODES, &start, &end, &nid) + memory_present(nid, start, end); } /* _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 173/181] arch, drivers: replace for_each_membock() with for_each_mem_range() 2020-10-13 23:46 incoming Andrew Morton ` (171 preceding siblings ...) 2020-10-13 23:58 ` [patch 172/181] arch, mm: replace for_each_memblock() with for_each_mem_pfn_range() Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 174/181] x86/setup: simplify initrd relocation and reservation Andrew Morton ` (7 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: arch, drivers: replace for_each_membock() with for_each_mem_range() There are several occurrences of the following pattern: for_each_memblock(memory, reg) { start = __pfn_to_phys(memblock_region_memory_base_pfn(reg); end = __pfn_to_phys(memblock_region_memory_end_pfn(reg)); /* do something with start and end */ } Using for_each_mem_range() iterator is more appropriate in such cases and allows simpler and cleaner code. [akpm@linux-foundation.org: fix arch/arm/mm/pmsa-v7.c build] [rppt@linux.ibm.com: mips: fix cavium-octeon build caused by memblock refactoring] Link: http://lkml.kernel.org/r/20200827124549.GD167163@linux.ibm.com Link: https://lkml.kernel.org/r/20200818151634.14343-13-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm/kernel/setup.c | 18 +++++-- arch/arm/mm/mmu.c | 39 +++++----------- arch/arm/mm/pmsa-v7.c | 23 ++++----- arch/arm/mm/pmsa-v8.c | 17 +++---- arch/arm/xen/mm.c | 7 +- arch/arm64/mm/kasan_init.c | 10 ++-- arch/arm64/mm/mmu.c | 11 +--- arch/c6x/kernel/setup.c | 9 ++- arch/microblaze/mm/init.c | 9 ++- arch/mips/cavium-octeon/dma-octeon.c | 14 ++--- arch/mips/kernel/setup.c | 31 ++++++------- arch/openrisc/mm/init.c | 8 ++- arch/powerpc/kernel/fadump.c | 50 +++++++++------------ arch/powerpc/kexec/file_load_64.c | 10 +--- arch/powerpc/mm/book3s64/hash_utils.c | 16 +++--- arch/powerpc/mm/book3s64/radix_pgtable.c | 10 ++-- arch/powerpc/mm/kasan/kasan_init_32.c | 8 +-- arch/powerpc/mm/mem.c | 16 ++++-- arch/powerpc/mm/pgtable_32.c | 8 +-- arch/riscv/mm/init.c | 25 ++++------ arch/riscv/mm/kasan_init.c | 10 ++-- arch/s390/kernel/setup.c | 23 ++++++--- arch/s390/mm/vmem.c | 7 +- arch/sparc/mm/init_64.c | 12 +---- drivers/bus/mvebu-mbus.c | 12 ++--- 25 files changed, 195 insertions(+), 208 deletions(-) --- a/arch/arm64/mm/kasan_init.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/arm64/mm/kasan_init.c @@ -212,8 +212,8 @@ void __init kasan_init(void) { u64 kimg_shadow_start, kimg_shadow_end; u64 mod_shadow_start, mod_shadow_end; - struct memblock_region *reg; - int i; + phys_addr_t pa_start, pa_end; + u64 i; kimg_shadow_start = (u64)kasan_mem_to_shadow(_text) & PAGE_MASK; kimg_shadow_end = PAGE_ALIGN((u64)kasan_mem_to_shadow(_end)); @@ -246,9 +246,9 @@ void __init kasan_init(void) kasan_populate_early_shadow((void *)mod_shadow_end, (void *)kimg_shadow_start); - for_each_memblock(memory, reg) { - void *start = (void *)__phys_to_virt(reg->base); - void *end = (void *)__phys_to_virt(reg->base + reg->size); + for_each_mem_range(i, &pa_start, &pa_end) { + void *start = (void *)__phys_to_virt(pa_start); + void *end = (void *)__phys_to_virt(pa_end); if (start >= end) break; --- a/arch/arm64/mm/mmu.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/arm64/mm/mmu.c @@ -473,8 +473,9 @@ static void __init map_mem(pgd_t *pgdp) { phys_addr_t kernel_start = __pa_symbol(_text); phys_addr_t kernel_end = __pa_symbol(__init_begin); - struct memblock_region *reg; + phys_addr_t start, end; int flags = 0; + u64 i; if (rodata_full || debug_pagealloc_enabled()) flags = NO_BLOCK_MAPPINGS | NO_CONT_MAPPINGS; @@ -493,15 +494,9 @@ static void __init map_mem(pgd_t *pgdp) #endif /* map all the memory banks */ - for_each_memblock(memory, reg) { - phys_addr_t start = reg->base; - phys_addr_t end = start + reg->size; - + for_each_mem_range(i, &start, &end) { if (start >= end) break; - if (memblock_is_nomap(reg)) - continue; - /* * The linear map must allow allocation tags reading/writing * if MTE is present. Otherwise, it has the same attributes as --- a/arch/arm/kernel/setup.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/arm/kernel/setup.c @@ -843,20 +843,26 @@ early_param("mem", early_mem); static void __init request_standard_resources(const struct machine_desc *mdesc) { - struct memblock_region *region; + phys_addr_t start, end, res_end; struct resource *res; + u64 i; kernel_code.start = virt_to_phys(_text); kernel_code.end = virt_to_phys(__init_begin - 1); kernel_data.start = virt_to_phys(_sdata); kernel_data.end = virt_to_phys(_end - 1); - for_each_memblock(memory, region) { - phys_addr_t start = __pfn_to_phys(memblock_region_memory_base_pfn(region)); - phys_addr_t end = __pfn_to_phys(memblock_region_memory_end_pfn(region)) - 1; + for_each_mem_range(i, &start, &end) { unsigned long boot_alias_start; /* + * In memblock, end points to the first byte after the + * range while in resourses, end points to the last byte in + * the range. + */ + res_end = end - 1; + + /* * Some systems have a special memory alias which is only * used for booting. We need to advertise this region to * kexec-tools so they know where bootable RAM is located. @@ -869,7 +875,7 @@ static void __init request_standard_reso __func__, sizeof(*res)); res->name = "System RAM (boot alias)"; res->start = boot_alias_start; - res->end = phys_to_idmap(end); + res->end = phys_to_idmap(res_end); res->flags = IORESOURCE_MEM | IORESOURCE_BUSY; request_resource(&iomem_resource, res); } @@ -880,7 +886,7 @@ static void __init request_standard_reso sizeof(*res)); res->name = "System RAM"; res->start = start; - res->end = end; + res->end = res_end; res->flags = IORESOURCE_SYSTEM_RAM | IORESOURCE_BUSY; request_resource(&iomem_resource, res); --- a/arch/arm/mm/mmu.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/arm/mm/mmu.c @@ -1154,9 +1154,8 @@ phys_addr_t arm_lowmem_limit __initdata void __init adjust_lowmem_bounds(void) { - phys_addr_t memblock_limit = 0; - u64 vmalloc_limit; - struct memblock_region *reg; + phys_addr_t block_start, block_end, memblock_limit = 0; + u64 vmalloc_limit, i; phys_addr_t lowmem_limit = 0; /* @@ -1172,26 +1171,18 @@ void __init adjust_lowmem_bounds(void) * The first usable region must be PMD aligned. Mark its start * as MEMBLOCK_NOMAP if it isn't */ - for_each_memblock(memory, reg) { - if (!memblock_is_nomap(reg)) { - if (!IS_ALIGNED(reg->base, PMD_SIZE)) { - phys_addr_t len; + for_each_mem_range(i, &block_start, &block_end) { + if (!IS_ALIGNED(block_start, PMD_SIZE)) { + phys_addr_t len; - len = round_up(reg->base, PMD_SIZE) - reg->base; - memblock_mark_nomap(reg->base, len); - } - break; + len = round_up(block_start, PMD_SIZE) - block_start; + memblock_mark_nomap(block_start, len); } + break; } - for_each_memblock(memory, reg) { - phys_addr_t block_start = reg->base; - phys_addr_t block_end = reg->base + reg->size; - - if (memblock_is_nomap(reg)) - continue; - - if (reg->base < vmalloc_limit) { + for_each_mem_range(i, &block_start, &block_end) { + if (block_start < vmalloc_limit) { if (block_end > lowmem_limit) /* * Compare as u64 to ensure vmalloc_limit does @@ -1440,19 +1431,15 @@ static void __init kmap_init(void) static void __init map_lowmem(void) { - struct memblock_region *reg; phys_addr_t kernel_x_start = round_down(__pa(KERNEL_START), SECTION_SIZE); phys_addr_t kernel_x_end = round_up(__pa(__init_end), SECTION_SIZE); + phys_addr_t start, end; + u64 i; /* Map all the lowmem memory banks. */ - for_each_memblock(memory, reg) { - phys_addr_t start = reg->base; - phys_addr_t end = start + reg->size; + for_each_mem_range(i, &start, &end) { struct map_desc map; - if (memblock_is_nomap(reg)) - continue; - if (end > arm_lowmem_limit) end = arm_lowmem_limit; if (start >= end) --- a/arch/arm/mm/pmsa-v7.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/arm/mm/pmsa-v7.c @@ -231,12 +231,12 @@ static int __init allocate_region(phys_a void __init pmsav7_adjust_lowmem_bounds(void) { phys_addr_t specified_mem_size = 0, total_mem_size = 0; - struct memblock_region *reg; - bool first = true; phys_addr_t mem_start; phys_addr_t mem_end; + phys_addr_t reg_start, reg_end; unsigned int mem_max_regions; - int num, i; + int num; + u64 i; /* Free-up PMSAv7_PROBE_REGION */ mpu_min_region_order = __mpu_min_region_order(); @@ -262,20 +262,19 @@ void __init pmsav7_adjust_lowmem_bounds( mem_max_regions -= num; #endif - for_each_memblock(memory, reg) { - if (first) { + for_each_mem_range(i, ®_start, ®_end) { + if (i == 0) { phys_addr_t phys_offset = PHYS_OFFSET; /* * Initially only use memory continuous from * PHYS_OFFSET */ - if (reg->base != phys_offset) + if (reg_start != phys_offset) panic("First memory bank must be contiguous from PHYS_OFFSET"); - mem_start = reg->base; - mem_end = reg->base + reg->size; - specified_mem_size = reg->size; - first = false; + mem_start = reg_start; + mem_end = reg_end; + specified_mem_size = mem_end - mem_start; } else { /* * memblock auto merges contiguous blocks, remove @@ -283,8 +282,8 @@ void __init pmsav7_adjust_lowmem_bounds( * blocks separately while iterating) */ pr_notice("Ignoring RAM after %pa, memory at %pa ignored\n", - &mem_end, ®->base); - memblock_remove(reg->base, 0 - reg->base); + &mem_end, ®_start); + memblock_remove(reg_start, 0 - reg_start); break; } } --- a/arch/arm/mm/pmsa-v8.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/arm/mm/pmsa-v8.c @@ -94,20 +94,19 @@ static __init bool is_region_fixed(int n void __init pmsav8_adjust_lowmem_bounds(void) { phys_addr_t mem_end; - struct memblock_region *reg; - bool first = true; + phys_addr_t reg_start, reg_end; + u64 i; - for_each_memblock(memory, reg) { - if (first) { + for_each_mem_range(i, ®_start, ®_end) { + if (i == 0) { phys_addr_t phys_offset = PHYS_OFFSET; /* * Initially only use memory continuous from * PHYS_OFFSET */ - if (reg->base != phys_offset) + if (reg_start != phys_offset) panic("First memory bank must be contiguous from PHYS_OFFSET"); - mem_end = reg->base + reg->size; - first = false; + mem_end = reg_end; } else { /* * memblock auto merges contiguous blocks, remove @@ -115,8 +114,8 @@ void __init pmsav8_adjust_lowmem_bounds( * blocks separately while iterating) */ pr_notice("Ignoring RAM after %pa, memory at %pa ignored\n", - &mem_end, ®->base); - memblock_remove(reg->base, 0 - reg->base); + &mem_end, ®_start); + memblock_remove(reg_start, 0 - reg_start); break; } } --- a/arch/arm/xen/mm.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/arm/xen/mm.c @@ -25,11 +25,12 @@ unsigned long xen_get_swiotlb_free_pages(unsigned int order) { - struct memblock_region *reg; + phys_addr_t base; gfp_t flags = __GFP_NOWARN|__GFP_KSWAPD_RECLAIM; + u64 i; - for_each_memblock(memory, reg) { - if (reg->base < (phys_addr_t)0xffffffff) { + for_each_mem_range(i, &base, NULL) { + if (base < (phys_addr_t)0xffffffff) { if (IS_ENABLED(CONFIG_ZONE_DMA32)) flags |= __GFP_DMA32; else --- a/arch/c6x/kernel/setup.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/c6x/kernel/setup.c @@ -287,7 +287,8 @@ notrace void __init machine_init(unsigne void __init setup_arch(char **cmdline_p) { - struct memblock_region *reg; + phys_addr_t start, end; + u64 i; printk(KERN_INFO "Initializing kernel\n"); @@ -351,9 +352,9 @@ void __init setup_arch(char **cmdline_p) disable_caching(ram_start, ram_end - 1); /* Set caching of external RAM used by Linux */ - for_each_memblock(memory, reg) - enable_caching(CACHE_REGION_START(reg->base), - CACHE_REGION_START(reg->base + reg->size - 1)); + for_each_mem_range(i, &start, &end) + enable_caching(CACHE_REGION_START(start), + CACHE_REGION_START(end - 1)); #ifdef CONFIG_BLK_DEV_INITRD /* --- a/arch/microblaze/mm/init.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/microblaze/mm/init.c @@ -109,13 +109,14 @@ static void __init paging_init(void) void __init setup_memory(void) { #ifndef CONFIG_MMU - struct memblock_region *reg; u32 kernel_align_start, kernel_align_size; + phys_addr_t start, end; + u64 i; /* Find main memory where is the kernel */ - for_each_memblock(memory, reg) { - memory_start = (u32)reg->base; - lowmem_size = reg->size; + for_each_mem_range(i, &start, &end) { + memory_start = start; + lowmem_size = end - start; if ((memory_start <= (u32)_text) && ((u32)_text <= (memory_start + lowmem_size - 1))) { memory_size = lowmem_size; --- a/arch/mips/cavium-octeon/dma-octeon.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/mips/cavium-octeon/dma-octeon.c @@ -190,25 +190,25 @@ char *octeon_swiotlb; void __init plat_swiotlb_setup(void) { - struct memblock_region *mem; + phys_addr_t start, end; phys_addr_t max_addr; phys_addr_t addr_size; size_t swiotlbsize; unsigned long swiotlb_nslabs; + u64 i; max_addr = 0; addr_size = 0; - for_each_memblock(memory, mem) { + for_each_mem_range(i, &start, &end) { /* These addresses map low for PCI. */ - if (mem->base > 0x410000000ull && !OCTEON_IS_OCTEON2()) + if (start > 0x410000000ull && !OCTEON_IS_OCTEON2()) continue; - addr_size += mem->size; - - if (max_addr < mem->base + mem->size) - max_addr = mem->base + mem->size; + addr_size += (end - start); + if (max_addr < end) + max_addr = end; } swiotlbsize = PAGE_SIZE; --- a/arch/mips/kernel/setup.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/mips/kernel/setup.c @@ -300,8 +300,9 @@ static void __init bootmem_init(void) static void __init bootmem_init(void) { - struct memblock_region *mem; phys_addr_t ramstart, ramend; + phys_addr_t start, end; + u64 i; ramstart = memblock_start_of_DRAM(); ramend = memblock_end_of_DRAM(); @@ -338,18 +339,13 @@ static void __init bootmem_init(void) min_low_pfn = ARCH_PFN_OFFSET; max_pfn = PFN_DOWN(ramend); - for_each_memblock(memory, mem) { - unsigned long start = memblock_region_memory_base_pfn(mem); - unsigned long end = memblock_region_memory_end_pfn(mem); - + for_each_mem_range(i, &start, &end) { /* * Skip highmem here so we get an accurate max_low_pfn if low * memory stops short of high memory. * If the region overlaps HIGHMEM_START, end is clipped so * max_pfn excludes the highmem portion. */ - if (memblock_is_nomap(mem)) - continue; if (start >= PFN_DOWN(HIGHMEM_START)) continue; if (end > PFN_DOWN(HIGHMEM_START)) @@ -450,13 +446,12 @@ early_param("memmap", early_parse_memmap unsigned long setup_elfcorehdr, setup_elfcorehdr_size; static int __init early_parse_elfcorehdr(char *p) { - struct memblock_region *mem; + phys_addr_t start, end; + u64 i; setup_elfcorehdr = memparse(p, &p); - for_each_memblock(memory, mem) { - unsigned long start = mem->base; - unsigned long end = start + mem->size; + for_each_mem_range(i, &start, &end) { if (setup_elfcorehdr >= start && setup_elfcorehdr < end) { /* * Reserve from the elf core header to the end of @@ -720,7 +715,8 @@ static void __init arch_mem_init(char ** static void __init resource_init(void) { - struct memblock_region *region; + phys_addr_t start, end; + u64 i; if (UNCAC_BASE != IO_BASE) return; @@ -732,9 +728,7 @@ static void __init resource_init(void) bss_resource.start = __pa_symbol(&__bss_start); bss_resource.end = __pa_symbol(&__bss_stop) - 1; - for_each_memblock(memory, region) { - phys_addr_t start = PFN_PHYS(memblock_region_memory_base_pfn(region)); - phys_addr_t end = PFN_PHYS(memblock_region_memory_end_pfn(region)) - 1; + for_each_mem_range(i, &start, &end) { struct resource *res; res = memblock_alloc(sizeof(struct resource), SMP_CACHE_BYTES); @@ -743,7 +737,12 @@ static void __init resource_init(void) sizeof(struct resource)); res->start = start; - res->end = end; + /* + * In memblock, end points to the first byte after the + * range while in resourses, end points to the last byte in + * the range. + */ + res->end = end - 1; res->flags = IORESOURCE_SYSTEM_RAM | IORESOURCE_BUSY; res->name = "System RAM"; --- a/arch/openrisc/mm/init.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/openrisc/mm/init.c @@ -64,6 +64,7 @@ extern const char _s_kernel_ro[], _e_ker */ static void __init map_ram(void) { + phys_addr_t start, end; unsigned long v, p, e; pgprot_t prot; pgd_t *pge; @@ -71,6 +72,7 @@ static void __init map_ram(void) pud_t *pue; pmd_t *pme; pte_t *pte; + u64 i; /* These mark extents of read-only kernel pages... * ...from vmlinux.lds.S */ @@ -78,9 +80,9 @@ static void __init map_ram(void) v = PAGE_OFFSET; - for_each_memblock(memory, region) { - p = (u32) region->base & PAGE_MASK; - e = p + (u32) region->size; + for_each_mem_range(i, &start, &end) { + p = (u32) start & PAGE_MASK; + e = (u32) end; v = (u32) __va(p); pge = pgd_offset_k(v); --- a/arch/powerpc/kernel/fadump.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/powerpc/kernel/fadump.c @@ -191,13 +191,13 @@ int is_fadump_active(void) */ static bool is_fadump_mem_area_contiguous(u64 d_start, u64 d_end) { - struct memblock_region *reg; + phys_addr_t reg_start, reg_end; bool ret = false; - u64 start, end; + u64 i, start, end; - for_each_memblock(memory, reg) { - start = max_t(u64, d_start, reg->base); - end = min_t(u64, d_end, (reg->base + reg->size)); + for_each_mem_range(i, ®_start, ®_end) { + start = max_t(u64, d_start, reg_start); + end = min_t(u64, d_end, reg_end); if (d_start < end) { /* Memory hole from d_start to start */ if (start > d_start) @@ -422,34 +422,34 @@ static int __init add_boot_mem_regions(u static int __init fadump_get_boot_mem_regions(void) { - unsigned long base, size, cur_size, hole_size, last_end; + unsigned long size, cur_size, hole_size, last_end; unsigned long mem_size = fw_dump.boot_memory_size; - struct memblock_region *reg; + phys_addr_t reg_start, reg_end; int ret = 1; + u64 i; fw_dump.boot_mem_regs_cnt = 0; last_end = 0; hole_size = 0; cur_size = 0; - for_each_memblock(memory, reg) { - base = reg->base; - size = reg->size; - hole_size += (base - last_end); + for_each_mem_range(i, ®_start, ®_end) { + size = reg_end - reg_start; + hole_size += (reg_start - last_end); if ((cur_size + size) >= mem_size) { size = (mem_size - cur_size); - ret = add_boot_mem_regions(base, size); + ret = add_boot_mem_regions(reg_start, size); break; } mem_size -= size; cur_size += size; - ret = add_boot_mem_regions(base, size); + ret = add_boot_mem_regions(reg_start, size); if (!ret) break; - last_end = base + size; + last_end = reg_end; } fw_dump.boot_mem_top = PAGE_ALIGN(fw_dump.boot_memory_size + hole_size); @@ -985,9 +985,8 @@ static int fadump_init_elfcore_header(ch */ static int fadump_setup_crash_memory_ranges(void) { - struct memblock_region *reg; - u64 start, end; - int i, ret; + u64 i, start, end; + int ret; pr_debug("Setup crash memory ranges.\n"); crash_mrange_info.mem_range_cnt = 0; @@ -1005,10 +1004,7 @@ static int fadump_setup_crash_memory_ran return ret; } - for_each_memblock(memory, reg) { - start = (u64)reg->base; - end = start + (u64)reg->size; - + for_each_mem_range(i, &start, &end) { /* * skip the memory chunk that is already added * (0 through boot_memory_top). @@ -1242,7 +1238,9 @@ static void fadump_free_reserved_memory( */ static void fadump_release_reserved_area(u64 start, u64 end) { - u64 tstart, tend, spfn, epfn, reg_spfn, reg_epfn, i; + unsigned long reg_spfn, reg_epfn; + u64 tstart, tend, spfn, epfn; + int i; spfn = PHYS_PFN(start); epfn = PHYS_PFN(end); @@ -1685,12 +1683,10 @@ int __init fadump_reserve_mem(void) /* Preserve everything above the base address */ static void __init fadump_reserve_crash_area(u64 base) { - struct memblock_region *reg; - u64 mstart, msize; + u64 i, mstart, mend, msize; - for_each_memblock(memory, reg) { - mstart = reg->base; - msize = reg->size; + for_each_mem_range(i, &mstart, &mend) { + msize = mend - mstart; if ((mstart + msize) < base) continue; --- a/arch/powerpc/kexec/file_load_64.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/powerpc/kexec/file_load_64.c @@ -138,15 +138,13 @@ out: */ static int get_crash_memory_ranges(struct crash_mem **mem_ranges) { - struct memblock_region *reg; + phys_addr_t base, end; struct crash_mem *tmem; + u64 i; int ret; - for_each_memblock(memory, reg) { - u64 base, size; - - base = (u64)reg->base; - size = (u64)reg->size; + for_each_mem_range(i, &base, &end) { + u64 size = end - base; /* Skip backup memory region, which needs a separate entry */ if (base == BACKUP_SRC_START) { --- a/arch/powerpc/mm/book3s64/hash_utils.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/powerpc/mm/book3s64/hash_utils.c @@ -7,7 +7,7 @@ * * SMP scalability work: * Copyright (C) 2001 Anton Blanchard <anton@au.ibm.com>, IBM - * + * * Module name: htab.c * * Description: @@ -867,8 +867,8 @@ static void __init htab_initialize(void) unsigned long table; unsigned long pteg_count; unsigned long prot; - unsigned long base = 0, size = 0; - struct memblock_region *reg; + phys_addr_t base = 0, size = 0, end; + u64 i; DBG(" -> htab_initialize()\n"); @@ -884,7 +884,7 @@ static void __init htab_initialize(void) /* * Calculate the required size of the htab. We want the number of * PTEGs to equal one half the number of real pages. - */ + */ htab_size_bytes = htab_get_table_size(); pteg_count = htab_size_bytes >> 7; @@ -894,7 +894,7 @@ static void __init htab_initialize(void) firmware_has_feature(FW_FEATURE_PS3_LV1)) { /* Using a hypervisor which owns the htab */ htab_address = NULL; - _SDR1 = 0; + _SDR1 = 0; #ifdef CONFIG_FA_DUMP /* * If firmware assisted dump is active firmware preserves @@ -960,9 +960,9 @@ static void __init htab_initialize(void) #endif /* CONFIG_DEBUG_PAGEALLOC */ /* create bolted the linear mapping in the hash table */ - for_each_memblock(memory, reg) { - base = (unsigned long)__va(reg->base); - size = reg->size; + for_each_mem_range(i, &base, &end) { + size = end - base; + base = (unsigned long)__va(base); DBG("creating mapping for region: %lx..%lx (prot: %lx)\n", base, size, prot); --- a/arch/powerpc/mm/book3s64/radix_pgtable.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/powerpc/mm/book3s64/radix_pgtable.c @@ -329,7 +329,8 @@ static int __meminit create_physical_map static void __init radix_init_pgtable(void) { unsigned long rts_field; - struct memblock_region *reg; + phys_addr_t start, end; + u64 i; /* We don't support slb for radix */ mmu_slb_size = 0; @@ -337,20 +338,19 @@ static void __init radix_init_pgtable(vo /* * Create the linear mapping */ - for_each_memblock(memory, reg) { + for_each_mem_range(i, &start, &end) { /* * The memblock allocator is up at this point, so the * page tables will be allocated within the range. No * need or a node (which we don't have yet). */ - if ((reg->base + reg->size) >= RADIX_VMALLOC_START) { + if (end >= RADIX_VMALLOC_START) { pr_warn("Outside the supported range\n"); continue; } - WARN_ON(create_physical_mapping(reg->base, - reg->base + reg->size, + WARN_ON(create_physical_mapping(start, end, radix_mem_block_size, -1, PAGE_KERNEL)); } --- a/arch/powerpc/mm/kasan/kasan_init_32.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/powerpc/mm/kasan/kasan_init_32.c @@ -138,11 +138,11 @@ void __init kasan_mmu_init(void) void __init kasan_init(void) { - struct memblock_region *reg; + phys_addr_t base, end; + u64 i; - for_each_memblock(memory, reg) { - phys_addr_t base = reg->base; - phys_addr_t top = min(base + reg->size, total_lowmem); + for_each_mem_range(i, &base, &end) { + phys_addr_t top = min(end, total_lowmem); int ret; if (base >= top) --- a/arch/powerpc/mm/mem.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/powerpc/mm/mem.c @@ -585,20 +585,24 @@ void flush_icache_user_page(struct vm_ar */ static int __init add_system_ram_resources(void) { - struct memblock_region *reg; + phys_addr_t start, end; + u64 i; - for_each_memblock(memory, reg) { + for_each_mem_range(i, &start, &end) { struct resource *res; - unsigned long base = reg->base; - unsigned long size = reg->size; res = kzalloc(sizeof(struct resource), GFP_KERNEL); WARN_ON(!res); if (res) { res->name = "System RAM"; - res->start = base; - res->end = base + size - 1; + res->start = start; + /* + * In memblock, end points to the first byte after + * the range while in resourses, end points to the + * last byte in the range. + */ + res->end = end - 1; res->flags = IORESOURCE_SYSTEM_RAM | IORESOURCE_BUSY; WARN_ON(request_resource(&iomem_resource, res) < 0); } --- a/arch/powerpc/mm/pgtable_32.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/powerpc/mm/pgtable_32.c @@ -123,11 +123,11 @@ static void __init __mapin_ram_chunk(uns void __init mapin_ram(void) { - struct memblock_region *reg; + phys_addr_t base, end; + u64 i; - for_each_memblock(memory, reg) { - phys_addr_t base = reg->base; - phys_addr_t top = min(base + reg->size, total_lowmem); + for_each_mem_range(i, &base, &end) { + phys_addr_t top = min(end, total_lowmem); if (base >= top) continue; --- a/arch/riscv/mm/init.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/riscv/mm/init.c @@ -145,21 +145,21 @@ static phys_addr_t dtb_early_pa __initda void __init setup_bootmem(void) { - struct memblock_region *reg; phys_addr_t mem_size = 0; phys_addr_t total_mem = 0; - phys_addr_t mem_start, end = 0; + phys_addr_t mem_start, start, end = 0; phys_addr_t vmlinux_end = __pa_symbol(&_end); phys_addr_t vmlinux_start = __pa_symbol(&_start); + u64 i; /* Find the memory region containing the kernel */ - for_each_memblock(memory, reg) { - end = reg->base + reg->size; + for_each_mem_range(i, &start, &end) { + phys_addr_t size = end - start; if (!total_mem) - mem_start = reg->base; - if (reg->base <= vmlinux_start && vmlinux_end <= end) - BUG_ON(reg->size == 0); - total_mem = total_mem + reg->size; + mem_start = start; + if (start <= vmlinux_start && vmlinux_end <= end) + BUG_ON(size == 0); + total_mem = total_mem + size; } /* @@ -455,7 +455,7 @@ static void __init setup_vm_final(void) { uintptr_t va, map_size; phys_addr_t pa, start, end; - struct memblock_region *reg; + u64 i; /* Set mmu_enabled flag */ mmu_enabled = true; @@ -466,14 +466,9 @@ static void __init setup_vm_final(void) PGDIR_SIZE, PAGE_TABLE); /* Map all memory banks */ - for_each_memblock(memory, reg) { - start = reg->base; - end = start + reg->size; - + for_each_mem_range(i, &start, &end) { if (start >= end) break; - if (memblock_is_nomap(reg)) - continue; if (start <= __pa(PAGE_OFFSET) && __pa(PAGE_OFFSET) < end) start = __pa(PAGE_OFFSET); --- a/arch/riscv/mm/kasan_init.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/riscv/mm/kasan_init.c @@ -85,16 +85,16 @@ static void __init populate(void *start, void __init kasan_init(void) { - struct memblock_region *reg; - unsigned long i; + phys_addr_t _start, _end; + u64 i; kasan_populate_early_shadow((void *)KASAN_SHADOW_START, (void *)kasan_mem_to_shadow((void *) VMALLOC_END)); - for_each_memblock(memory, reg) { - void *start = (void *)__va(reg->base); - void *end = (void *)__va(reg->base + reg->size); + for_each_mem_range(i, &_start, &_end) { + void *start = (void *)_start; + void *end = (void *)_end; if (start >= end) break; --- a/arch/s390/kernel/setup.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/s390/kernel/setup.c @@ -484,8 +484,9 @@ static struct resource __initdata *stand static void __init setup_resources(void) { struct resource *res, *std_res, *sub_res; - struct memblock_region *reg; + phys_addr_t start, end; int j; + u64 i; code_resource.start = (unsigned long) _text; code_resource.end = (unsigned long) _etext - 1; @@ -494,7 +495,7 @@ static void __init setup_resources(void) bss_resource.start = (unsigned long) __bss_start; bss_resource.end = (unsigned long) __bss_stop - 1; - for_each_memblock(memory, reg) { + for_each_mem_range(i, &start, &end) { res = memblock_alloc(sizeof(*res), 8); if (!res) panic("%s: Failed to allocate %zu bytes align=0x%x\n", @@ -502,8 +503,13 @@ static void __init setup_resources(void) res->flags = IORESOURCE_BUSY | IORESOURCE_SYSTEM_RAM; res->name = "System RAM"; - res->start = reg->base; - res->end = reg->base + reg->size - 1; + res->start = start; + /* + * In memblock, end points to the first byte after the + * range while in resourses, end points to the last byte in + * the range. + */ + res->end = end - 1; request_resource(&iomem_resource, res); for (j = 0; j < ARRAY_SIZE(standard_resources); j++) { @@ -819,14 +825,15 @@ static void __init reserve_kernel(void) static void __init setup_memory(void) { - struct memblock_region *reg; + phys_addr_t start, end; + u64 i; /* * Init storage key for present memory */ - for_each_memblock(memory, reg) { - storage_key_init_range(reg->base, reg->base + reg->size); - } + for_each_mem_range(i, &start, &end) + storage_key_init_range(start, end); + psw_set_key(PAGE_DEFAULT_KEY); /* Only cosmetics */ --- a/arch/s390/mm/vmem.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/s390/mm/vmem.c @@ -555,10 +555,11 @@ int vmem_add_mapping(unsigned long start */ void __init vmem_map_init(void) { - struct memblock_region *reg; + phys_addr_t base, end; + u64 i; - for_each_memblock(memory, reg) - vmem_add_range(reg->base, reg->size); + for_each_mem_range(i, &base, &end) + vmem_add_range(base, end - base); __set_memory((unsigned long)_stext, (unsigned long)(_etext - _stext) >> PAGE_SHIFT, SET_MEMORY_RO | SET_MEMORY_X); --- a/arch/sparc/mm/init_64.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/arch/sparc/mm/init_64.c @@ -1192,18 +1192,14 @@ int of_node_to_nid(struct device_node *d static void __init add_node_ranges(void) { - struct memblock_region *reg; + phys_addr_t start, end; unsigned long prev_max; + u64 i; memblock_resized: prev_max = memblock.memory.max; - for_each_memblock(memory, reg) { - unsigned long size = reg->size; - unsigned long start, end; - - start = reg->base; - end = start + size; + for_each_mem_range(i, &start, &end) { while (start < end) { unsigned long this_end; int nid; @@ -1211,7 +1207,7 @@ memblock_resized: this_end = memblock_nid_range(start, end, &nid); numadbg("Setting memblock NUMA node nid[%d] " - "start[%lx] end[%lx]\n", + "start[%llx] end[%lx]\n", nid, start, this_end); memblock_set_node(start, this_end - start, --- a/drivers/bus/mvebu-mbus.c~arch-drivers-replace-for_each_membock-with-for_each_mem_range +++ a/drivers/bus/mvebu-mbus.c @@ -610,23 +610,23 @@ static unsigned int armada_xp_mbus_win_r static void __init mvebu_mbus_find_bridge_hole(uint64_t *start, uint64_t *end) { - struct memblock_region *r; - uint64_t s = 0; + phys_addr_t reg_start, reg_end; + uint64_t i, s = 0; - for_each_memblock(memory, r) { + for_each_mem_range(i, ®_start, ®_end) { /* * This part of the memory is above 4 GB, so we don't * care for the MBus bridge hole. */ - if (r->base >= 0x100000000ULL) + if (reg_start >= 0x100000000ULL) continue; /* * The MBus bridge hole is at the end of the RAM under * the 4 GB limit. */ - if (r->base + r->size > s) - s = r->base + r->size; + if (reg_end > s) + s = reg_end; } *start = s; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 174/181] x86/setup: simplify initrd relocation and reservation 2020-10-13 23:46 incoming Andrew Morton ` (172 preceding siblings ...) 2020-10-13 23:58 ` [patch 173/181] arch, drivers: replace for_each_membock() with for_each_mem_range() Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 175/181] x86/setup: simplify reserve_crashkernel() Andrew Morton ` (6 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: x86/setup: simplify initrd relocation and reservation Currently, initrd image is reserved very early during setup and then it might be relocated and re-reserved after the initial physical memory mapping is created. The "late" reservation of memblock verifies that mapped memory size exceeds the size of initrd, then checks whether the relocation required and, if yes, relocates inirtd to a new memory allocated from memblock and frees the old location. The check for memory size is excessive as memblock allocation will anyway fail if there is not enough memory. Besides, there is no point to allocate memory from memblock using memblock_find_in_range() + memblock_reserve() when there exists memblock_phys_alloc_range() with required functionality. Remove the redundant check and simplify memblock allocation. Link: https://lkml.kernel.org/r/20200818151634.14343-14-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Acked-by: Ingo Molnar <mingo@kernel.org> Reviewed-by: Baoquan He <bhe@redhat.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/x86/kernel/setup.c | 16 +++------------- 1 file changed, 3 insertions(+), 13 deletions(-) --- a/arch/x86/kernel/setup.c~x86-setup-simplify-initrd-relocation-and-reservation +++ a/arch/x86/kernel/setup.c @@ -264,16 +264,12 @@ static void __init relocate_initrd(void) u64 area_size = PAGE_ALIGN(ramdisk_size); /* We need to move the initrd down into directly mapped mem */ - relocated_ramdisk = memblock_find_in_range(0, PFN_PHYS(max_pfn_mapped), - area_size, PAGE_SIZE); - + relocated_ramdisk = memblock_phys_alloc_range(area_size, PAGE_SIZE, 0, + PFN_PHYS(max_pfn_mapped)); if (!relocated_ramdisk) panic("Cannot find place for new RAMDISK of size %lld\n", ramdisk_size); - /* Note: this includes all the mem currently occupied by - the initrd, we rely on that fact to keep the data intact. */ - memblock_reserve(relocated_ramdisk, area_size); initrd_start = relocated_ramdisk + PAGE_OFFSET; initrd_end = initrd_start + ramdisk_size; printk(KERN_INFO "Allocated new RAMDISK: [mem %#010llx-%#010llx]\n", @@ -300,13 +296,13 @@ static void __init early_reserve_initrd( memblock_reserve(ramdisk_image, ramdisk_end - ramdisk_image); } + static void __init reserve_initrd(void) { /* Assume only end is not page aligned */ u64 ramdisk_image = get_ramdisk_image(); u64 ramdisk_size = get_ramdisk_size(); u64 ramdisk_end = PAGE_ALIGN(ramdisk_image + ramdisk_size); - u64 mapped_size; if (!boot_params.hdr.type_of_loader || !ramdisk_image || !ramdisk_size) @@ -314,12 +310,6 @@ static void __init reserve_initrd(void) initrd_start = 0; - mapped_size = memblock_mem_size(max_pfn_mapped); - if (ramdisk_size >= (mapped_size>>1)) - panic("initrd too large to handle, " - "disabling initrd (%lld needed, %lld available)\n", - ramdisk_size, mapped_size>>1); - printk(KERN_INFO "RAMDISK: [mem %#010llx-%#010llx]\n", ramdisk_image, ramdisk_end - 1); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 175/181] x86/setup: simplify reserve_crashkernel() 2020-10-13 23:46 incoming Andrew Morton ` (173 preceding siblings ...) 2020-10-13 23:58 ` [patch 174/181] x86/setup: simplify initrd relocation and reservation Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 176/181] memblock: remove unused memblock_mem_size() Andrew Morton ` (5 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: x86/setup: simplify reserve_crashkernel() * Replace magic numbers with defines * Replace memblock_find_in_range() + memblock_reserve() with memblock_phys_alloc_range() * Stop checking for low memory size in reserve_crashkernel_low(). The allocation from limited range will anyway fail if there is no enough memory, so there is no need for extra traversal of memblock.memory Link: https://lkml.kernel.org/r/20200818151634.14343-15-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Acked-by: Ingo Molnar <mingo@kernel.org> Reviewed-by: Baoquan He <bhe@redhat.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/x86/kernel/setup.c | 40 +++++++++++++------------------------- 1 file changed, 14 insertions(+), 26 deletions(-) --- a/arch/x86/kernel/setup.c~x86-setup-simplify-reserve_crashkernel +++ a/arch/x86/kernel/setup.c @@ -421,13 +421,13 @@ static int __init reserve_crashkernel_lo { #ifdef CONFIG_X86_64 unsigned long long base, low_base = 0, low_size = 0; - unsigned long total_low_mem; + unsigned long low_mem_limit; int ret; - total_low_mem = memblock_mem_size(1UL << (32 - PAGE_SHIFT)); + low_mem_limit = min(memblock_phys_mem_size(), CRASH_ADDR_LOW_MAX); /* crashkernel=Y,low */ - ret = parse_crashkernel_low(boot_command_line, total_low_mem, &low_size, &base); + ret = parse_crashkernel_low(boot_command_line, low_mem_limit, &low_size, &base); if (ret) { /* * two parts from kernel/dma/swiotlb.c: @@ -445,23 +445,17 @@ static int __init reserve_crashkernel_lo return 0; } - low_base = memblock_find_in_range(0, 1ULL << 32, low_size, CRASH_ALIGN); + low_base = memblock_phys_alloc_range(low_size, CRASH_ALIGN, 0, CRASH_ADDR_LOW_MAX); if (!low_base) { pr_err("Cannot reserve %ldMB crashkernel low memory, please try smaller size.\n", (unsigned long)(low_size >> 20)); return -ENOMEM; } - ret = memblock_reserve(low_base, low_size); - if (ret) { - pr_err("%s: Error reserving crashkernel low memblock.\n", __func__); - return ret; - } - - pr_info("Reserving %ldMB of low memory at %ldMB for crashkernel (System low RAM: %ldMB)\n", + pr_info("Reserving %ldMB of low memory at %ldMB for crashkernel (low RAM limit: %ldMB)\n", (unsigned long)(low_size >> 20), (unsigned long)(low_base >> 20), - (unsigned long)(total_low_mem >> 20)); + (unsigned long)(low_mem_limit >> 20)); crashk_low_res.start = low_base; crashk_low_res.end = low_base + low_size - 1; @@ -505,13 +499,13 @@ static void __init reserve_crashkernel(v * unless "crashkernel=size[KMG],high" is specified. */ if (!high) - crash_base = memblock_find_in_range(CRASH_ALIGN, - CRASH_ADDR_LOW_MAX, - crash_size, CRASH_ALIGN); + crash_base = memblock_phys_alloc_range(crash_size, + CRASH_ALIGN, CRASH_ALIGN, + CRASH_ADDR_LOW_MAX); if (!crash_base) - crash_base = memblock_find_in_range(CRASH_ALIGN, - CRASH_ADDR_HIGH_MAX, - crash_size, CRASH_ALIGN); + crash_base = memblock_phys_alloc_range(crash_size, + CRASH_ALIGN, CRASH_ALIGN, + CRASH_ADDR_HIGH_MAX); if (!crash_base) { pr_info("crashkernel reservation failed - No suitable area found.\n"); return; @@ -519,19 +513,13 @@ static void __init reserve_crashkernel(v } else { unsigned long long start; - start = memblock_find_in_range(crash_base, - crash_base + crash_size, - crash_size, 1 << 20); + start = memblock_phys_alloc_range(crash_size, SZ_1M, crash_base, + crash_base + crash_size); if (start != crash_base) { pr_info("crashkernel reservation failed - memory is in use.\n"); return; } } - ret = memblock_reserve(crash_base, crash_size); - if (ret) { - pr_err("%s: Error reserving crashkernel memblock.\n", __func__); - return; - } if (crash_base >= (1ULL << 32) && reserve_crashkernel_low()) { memblock_free(crash_base, crash_size); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 176/181] memblock: remove unused memblock_mem_size() 2020-10-13 23:46 incoming Andrew Morton ` (174 preceding siblings ...) 2020-10-13 23:58 ` [patch 175/181] x86/setup: simplify reserve_crashkernel() Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 177/181] memblock: implement for_each_reserved_mem_region() using __next_mem_region() Andrew Morton ` (4 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: memblock: remove unused memblock_mem_size() The only user of memblock_mem_size() was x86 setup code, it is gone now and memblock_mem_size() funciton can be removed. Link: https://lkml.kernel.org/r/20200818151634.14343-16-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Reviewed-by: Baoquan He <bhe@redhat.com> Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- include/linux/memblock.h | 1 - mm/memblock.c | 15 --------------- 2 files changed, 16 deletions(-) --- a/include/linux/memblock.h~memblock-remove-unused-memblock_mem_size +++ a/include/linux/memblock.h @@ -481,7 +481,6 @@ static inline bool memblock_bottom_up(vo phys_addr_t memblock_phys_mem_size(void); phys_addr_t memblock_reserved_size(void); -phys_addr_t memblock_mem_size(unsigned long limit_pfn); phys_addr_t memblock_start_of_DRAM(void); phys_addr_t memblock_end_of_DRAM(void); void memblock_enforce_memory_limit(phys_addr_t memory_limit); --- a/mm/memblock.c~memblock-remove-unused-memblock_mem_size +++ a/mm/memblock.c @@ -1660,21 +1660,6 @@ phys_addr_t __init_memblock memblock_res return memblock.reserved.total_size; } -phys_addr_t __init memblock_mem_size(unsigned long limit_pfn) -{ - unsigned long pages = 0; - unsigned long start_pfn, end_pfn; - int i; - - for_each_mem_pfn_range(i, MAX_NUMNODES, &start_pfn, &end_pfn, NULL) { - start_pfn = min_t(unsigned long, start_pfn, limit_pfn); - end_pfn = min_t(unsigned long, end_pfn, limit_pfn); - pages += end_pfn - start_pfn; - } - - return PFN_PHYS(pages); -} - /* lowest address */ phys_addr_t __init_memblock memblock_start_of_DRAM(void) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 177/181] memblock: implement for_each_reserved_mem_region() using __next_mem_region() 2020-10-13 23:46 incoming Andrew Morton ` (175 preceding siblings ...) 2020-10-13 23:58 ` [patch 176/181] memblock: remove unused memblock_mem_size() Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 178/181] memblock: use separate iterators for memory and reserved regions Andrew Morton ` (3 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: memblock: implement for_each_reserved_mem_region() using __next_mem_region() Iteration over memblock.reserved with for_each_reserved_mem_region() used __next_reserved_mem_region() that implemented a subset of __next_mem_region(). Use __for_each_mem_range() and, essentially, __next_mem_region() with appropriate parameters to reduce code duplication. While on it, rename for_each_reserved_mem_region() to for_each_reserved_mem_range() for consistency. Link: https://lkml.kernel.org/r/20200818151634.14343-17-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Acked-by: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> [.clang-format] Cc: Andy Lutomirski <luto@kernel.org> Cc: Baoquan He <bhe@redhat.com> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- .clang-format | 2 - arch/arm64/kernel/setup.c | 2 - drivers/irqchip/irq-gic-v3-its.c | 2 - include/linux/memblock.h | 12 ++---- mm/memblock.c | 56 ++++++++++------------------- 5 files changed, 27 insertions(+), 47 deletions(-) --- a/arch/arm64/kernel/setup.c~memblock-implement-for_each_reserved_mem_region-using-__next_mem_region +++ a/arch/arm64/kernel/setup.c @@ -257,7 +257,7 @@ static int __init reserve_memblock_reser if (!memblock_is_region_reserved(mem->start, mem_size)) continue; - for_each_reserved_mem_region(j, &r_start, &r_end) { + for_each_reserved_mem_range(j, &r_start, &r_end) { resource_size_t start, end; start = max(PFN_PHYS(PFN_DOWN(r_start)), mem->start); --- a/.clang-format~memblock-implement-for_each_reserved_mem_region-using-__next_mem_region +++ a/.clang-format @@ -273,7 +273,7 @@ ForEachMacros: - 'for_each_registered_fb' - 'for_each_requested_gpio' - 'for_each_requested_gpio_in_range' - - 'for_each_reserved_mem_region' + - 'for_each_reserved_mem_range' - 'for_each_rtd_codec_dais' - 'for_each_rtd_codec_dais_rollback' - 'for_each_rtd_components' --- a/drivers/irqchip/irq-gic-v3-its.c~memblock-implement-for_each_reserved_mem_region-using-__next_mem_region +++ a/drivers/irqchip/irq-gic-v3-its.c @@ -2198,7 +2198,7 @@ static bool gic_check_reserved_range(phy addr_end = addr + size - 1; - for_each_reserved_mem_region(i, &start, &end) { + for_each_reserved_mem_range(i, &start, &end) { if (addr >= start && addr_end <= end) return true; } --- a/include/linux/memblock.h~memblock-implement-for_each_reserved_mem_region-using-__next_mem_region +++ a/include/linux/memblock.h @@ -132,9 +132,6 @@ void __next_mem_range_rev(u64 *idx, int struct memblock_type *type_b, phys_addr_t *out_start, phys_addr_t *out_end, int *out_nid); -void __next_reserved_mem_region(u64 *idx, phys_addr_t *out_start, - phys_addr_t *out_end); - void __memblock_free_late(phys_addr_t base, phys_addr_t size); #ifdef CONFIG_HAVE_MEMBLOCK_PHYS_MAP @@ -224,7 +221,7 @@ static inline void __next_physmem_range( MEMBLOCK_NONE, p_start, p_end, NULL) /** - * for_each_reserved_mem_region - iterate over all reserved memblock areas + * for_each_reserved_mem_range - iterate over all reserved memblock areas * @i: u64 used as loop variable * @p_start: ptr to phys_addr_t for start address of the range, can be %NULL * @p_end: ptr to phys_addr_t for end address of the range, can be %NULL @@ -232,10 +229,9 @@ static inline void __next_physmem_range( * Walks over reserved areas of memblock. Available as soon as memblock * is initialized. */ -#define for_each_reserved_mem_region(i, p_start, p_end) \ - for (i = 0UL, __next_reserved_mem_region(&i, p_start, p_end); \ - i != (u64)ULLONG_MAX; \ - __next_reserved_mem_region(&i, p_start, p_end)) +#define for_each_reserved_mem_range(i, p_start, p_end) \ + __for_each_mem_range(i, &memblock.reserved, NULL, NUMA_NO_NODE, \ + MEMBLOCK_NONE, p_start, p_end, NULL) static inline bool memblock_is_hotpluggable(struct memblock_region *m) { --- a/mm/memblock.c~memblock-implement-for_each_reserved_mem_region-using-__next_mem_region +++ a/mm/memblock.c @@ -132,6 +132,14 @@ struct memblock_type physmem = { }; #endif +/* + * keep a pointer to &memblock.memory in the text section to use it in + * __next_mem_range() and its helpers. + * For architectures that do not keep memblock data after init, this + * pointer will be reset to NULL at memblock_discard() + */ +static __refdata struct memblock_type *memblock_memory = &memblock.memory; + #define for_each_memblock_type(i, memblock_type, rgn) \ for (i = 0, rgn = &memblock_type->regions[0]; \ i < memblock_type->cnt; \ @@ -402,6 +410,8 @@ void __init memblock_discard(void) memblock.memory.max); __memblock_free_late(addr, size); } + + memblock_memory = NULL; } #endif @@ -952,42 +962,16 @@ int __init_memblock memblock_clear_nomap return memblock_setclr_flag(base, size, 0, MEMBLOCK_NOMAP); } -/** - * __next_reserved_mem_region - next function for for_each_reserved_region() - * @idx: pointer to u64 loop variable - * @out_start: ptr to phys_addr_t for start address of the region, can be %NULL - * @out_end: ptr to phys_addr_t for end address of the region, can be %NULL - * - * Iterate over all reserved memory regions. - */ -void __init_memblock __next_reserved_mem_region(u64 *idx, - phys_addr_t *out_start, - phys_addr_t *out_end) -{ - struct memblock_type *type = &memblock.reserved; - - if (*idx < type->cnt) { - struct memblock_region *r = &type->regions[*idx]; - phys_addr_t base = r->base; - phys_addr_t size = r->size; - - if (out_start) - *out_start = base; - if (out_end) - *out_end = base + size - 1; - - *idx += 1; - return; - } - - /* signal end of iteration */ - *idx = ULLONG_MAX; -} - -static bool should_skip_region(struct memblock_region *m, int nid, int flags) +static bool should_skip_region(struct memblock_type *type, + struct memblock_region *m, + int nid, int flags) { int m_nid = memblock_get_region_node(m); + /* we never skip regions when iterating memblock.reserved or physmem */ + if (type != memblock_memory) + return false; + /* only memory regions are associated with nodes, check it */ if (nid != NUMA_NO_NODE && nid != m_nid) return true; @@ -1052,7 +1036,7 @@ void __next_mem_range(u64 *idx, int nid, phys_addr_t m_end = m->base + m->size; int m_nid = memblock_get_region_node(m); - if (should_skip_region(m, nid, flags)) + if (should_skip_region(type_a, m, nid, flags)) continue; if (!type_b) { @@ -1156,7 +1140,7 @@ void __init_memblock __next_mem_range_re phys_addr_t m_end = m->base + m->size; int m_nid = memblock_get_region_node(m); - if (should_skip_region(m, nid, flags)) + if (should_skip_region(type_a, m, nid, flags)) continue; if (!type_b) { @@ -1981,7 +1965,7 @@ static unsigned long __init free_low_mem memblock_clear_hotplug(0, -1); - for_each_reserved_mem_region(i, &start, &end) + for_each_reserved_mem_range(i, &start, &end) reserve_bootmem_region(start, end); /* _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 178/181] memblock: use separate iterators for memory and reserved regions 2020-10-13 23:46 incoming Andrew Morton ` (176 preceding siblings ...) 2020-10-13 23:58 ` [patch 177/181] memblock: implement for_each_reserved_mem_region() using __next_mem_region() Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 179/181] mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary Andrew Morton ` (2 subsequent siblings) 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, benh, bhe, bp, catalin.marinas, dave.hansen, dja, hbathini, hch, jcmvbkbc, Jonathan.Cameron, kernel, linux-mm, linux, luto, m.szyprowski, miguel.ojeda.sandonis, mingo, mingo, mm-commits, monstr, mpe, palmer, paul.walmsley, paulus, peterz, rppt, shorne, tglx, torvalds, tsbogend, will, ysato From: Mike Rapoport <rppt@linux.ibm.com> Subject: memblock: use separate iterators for memory and reserved regions for_each_memblock() is used to iterate over memblock.memory in a few places that use data from memblock_region rather than the memory ranges. Introduce separate for_each_mem_region() and for_each_reserved_mem_region() to improve encapsulation of memblock internals from its users. Link: https://lkml.kernel.org/r/20200818151634.14343-18-rppt@kernel.org Signed-off-by: Mike Rapoport <rppt@linux.ibm.com> Reviewed-by: Baoquan He <bhe@redhat.com> Acked-by: Ingo Molnar <mingo@kernel.org> [x86] Acked-by: Thomas Bogendoerfer <tsbogend@alpha.franken.de> [MIPS] Acked-by: Miguel Ojeda <miguel.ojeda.sandonis@gmail.com> [.clang-format] Cc: Andy Lutomirski <luto@kernel.org> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Borislav Petkov <bp@alien8.de> Cc: Catalin Marinas <catalin.marinas@arm.com> Cc: Christoph Hellwig <hch@lst.de> Cc: Daniel Axtens <dja@axtens.net> Cc: Dave Hansen <dave.hansen@linux.intel.com> Cc: Emil Renner Berthing <kernel@esmil.dk> Cc: Hari Bathini <hbathini@linux.ibm.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Jonathan Cameron <Jonathan.Cameron@huawei.com> Cc: Marek Szyprowski <m.szyprowski@samsung.com> Cc: Max Filippov <jcmvbkbc@gmail.com> Cc: Michael Ellerman <mpe@ellerman.id.au> Cc: Michal Simek <monstr@monstr.eu> Cc: Palmer Dabbelt <palmer@dabbelt.com> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Russell King <linux@armlinux.org.uk> Cc: Stafford Horne <shorne@gmail.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Will Deacon <will@kernel.org> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- .clang-format | 3 ++- arch/arm64/kernel/setup.c | 2 +- arch/arm64/mm/numa.c | 2 +- arch/mips/netlogic/xlp/setup.c | 2 +- arch/riscv/mm/init.c | 2 +- arch/x86/mm/numa.c | 2 +- include/linux/memblock.h | 19 ++++++++++++++++--- mm/memblock.c | 4 ++-- mm/page_alloc.c | 8 ++++---- 9 files changed, 29 insertions(+), 15 deletions(-) --- a/arch/arm64/kernel/setup.c~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/arch/arm64/kernel/setup.c @@ -217,7 +217,7 @@ static void __init request_standard_reso if (!standard_resources) panic("%s: Failed to allocate %zu bytes\n", __func__, res_size); - for_each_memblock(memory, region) { + for_each_mem_region(region) { res = &standard_resources[i++]; if (memblock_is_nomap(region)) { res->name = "reserved"; --- a/arch/arm64/mm/numa.c~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/arch/arm64/mm/numa.c @@ -354,7 +354,7 @@ static int __init numa_register_nodes(vo struct memblock_region *mblk; /* Check that valid nid is set to memblks */ - for_each_memblock(memory, mblk) { + for_each_mem_region(mblk) { int mblk_nid = memblock_get_region_node(mblk); if (mblk_nid == NUMA_NO_NODE || mblk_nid >= MAX_NUMNODES) { --- a/arch/mips/netlogic/xlp/setup.c~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/arch/mips/netlogic/xlp/setup.c @@ -70,7 +70,7 @@ static void nlm_fixup_mem(void) const int pref_backup = 512; struct memblock_region *mem; - for_each_memblock(memory, mem) { + for_each_mem_region(mem) { memblock_remove(mem->base + mem->size - pref_backup, pref_backup); } --- a/arch/riscv/mm/init.c~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/arch/riscv/mm/init.c @@ -531,7 +531,7 @@ static void __init resource_init(void) { struct memblock_region *region; - for_each_memblock(memory, region) { + for_each_mem_region(region) { struct resource *res; res = memblock_alloc(sizeof(struct resource), SMP_CACHE_BYTES); --- a/arch/x86/mm/numa.c~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/arch/x86/mm/numa.c @@ -514,7 +514,7 @@ static void __init numa_clear_kernel_nod * memory ranges, because quirks such as trim_snb_memory() * reserve specific pages for Sandy Bridge graphics. ] */ - for_each_memblock(reserved, mb_region) { + for_each_reserved_mem_region(mb_region) { int nid = memblock_get_region_node(mb_region); if (nid != MAX_NUMNODES) --- a/.clang-format~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/.clang-format @@ -203,7 +203,7 @@ ForEachMacros: - 'for_each_matching_node' - 'for_each_matching_node_and_match' - 'for_each_member' - - 'for_each_memblock' + - 'for_each_mem_region' - 'for_each_memblock_type' - 'for_each_memcg_cache_index' - 'for_each_mem_pfn_range' @@ -274,6 +274,7 @@ ForEachMacros: - 'for_each_requested_gpio' - 'for_each_requested_gpio_in_range' - 'for_each_reserved_mem_range' + - 'for_each_reserved_mem_region' - 'for_each_rtd_codec_dais' - 'for_each_rtd_codec_dais_rollback' - 'for_each_rtd_components' --- a/include/linux/memblock.h~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/include/linux/memblock.h @@ -553,9 +553,22 @@ static inline unsigned long memblock_reg return PFN_UP(reg->base + reg->size); } -#define for_each_memblock(memblock_type, region) \ - for (region = memblock.memblock_type.regions; \ - region < (memblock.memblock_type.regions + memblock.memblock_type.cnt); \ +/** + * for_each_mem_region - itereate over memory regions + * @region: loop variable + */ +#define for_each_mem_region(region) \ + for (region = memblock.memory.regions; \ + region < (memblock.memory.regions + memblock.memory.cnt); \ + region++) + +/** + * for_each_reserved_mem_region - itereate over reserved memory regions + * @region: loop variable + */ +#define for_each_reserved_mem_region(region) \ + for (region = memblock.reserved.regions; \ + region < (memblock.reserved.regions + memblock.reserved.cnt); \ region++) extern void *alloc_large_system_hash(const char *tablename, --- a/mm/memblock.c~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/mm/memblock.c @@ -1667,7 +1667,7 @@ static phys_addr_t __init_memblock __fin * the memory memblock regions, if the @limit exceeds the total size * of those regions, max_addr will keep original value PHYS_ADDR_MAX */ - for_each_memblock(memory, r) { + for_each_mem_region(r) { if (limit <= r->size) { max_addr = r->base + limit; break; @@ -1837,7 +1837,7 @@ void __init_memblock memblock_trim_memor phys_addr_t start, end, orig_start, orig_end; struct memblock_region *r; - for_each_memblock(memory, r) { + for_each_mem_region(r) { orig_start = r->base; orig_end = r->base + r->size; start = round_up(orig_start, align); --- a/mm/page_alloc.c~memblock-use-separate-iterators-for-memory-and-reserved-regions +++ a/mm/page_alloc.c @@ -5961,7 +5961,7 @@ overlap_memmap_init(unsigned long zone, if (mirrored_kernelcore && zone == ZONE_MOVABLE) { if (!r || *pfn >= memblock_region_memory_end_pfn(r)) { - for_each_memblock(memory, r) { + for_each_mem_region(r) { if (*pfn < memblock_region_memory_end_pfn(r)) break; } @@ -6546,7 +6546,7 @@ static unsigned long __init zone_absent_ unsigned long start_pfn, end_pfn; struct memblock_region *r; - for_each_memblock(memory, r) { + for_each_mem_region(r) { start_pfn = clamp(memblock_region_memory_base_pfn(r), zone_start_pfn, zone_end_pfn); end_pfn = clamp(memblock_region_memory_end_pfn(r), @@ -7140,7 +7140,7 @@ static void __init find_zone_movable_pfn * options. */ if (movable_node_is_enabled()) { - for_each_memblock(memory, r) { + for_each_mem_region(r) { if (!memblock_is_hotpluggable(r)) continue; @@ -7161,7 +7161,7 @@ static void __init find_zone_movable_pfn if (mirrored_kernelcore) { bool mem_below_4gb_not_mirrored = false; - for_each_memblock(memory, r) { + for_each_mem_region(r) { if (memblock_is_mirror(r)) continue; _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 179/181] mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary 2020-10-13 23:46 incoming Andrew Morton ` (177 preceding siblings ...) 2020-10-13 23:58 ` [patch 178/181] memblock: use separate iterators for memory and reserved regions Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 180/181] mm/migrate: remove cpages-- in migrate_vma_finalize() Andrew Morton 2020-10-13 23:58 ` [patch 181/181] mm/migrate: remove obsolete comment about device public Andrew Morton 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: adobriyan, akpm, areber, avagin, bernd.edlinger, christian.brauner, christian, cyphar, daniel.m.jordan, ebiederm, esyr, gladkov.alexey, john.johansen, laoar.shao, linux-mm, mhocko, mhocko, minchan, mingo, mm-commits, oleg, peterz, shakeelb, surenb, tglx, timmurray, torvalds, walken From: Suren Baghdasaryan <surenb@google.com> Subject: mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary Currently __set_oom_adj loops through all processes in the system to keep oom_score_adj and oom_score_adj_min in sync between processes sharing their mm. This is done for any task with more that one mm_users, which includes processes with multiple threads (sharing mm and signals). However for such processes the loop is unnecessary because their signal structure is shared as well. Android updates oom_score_adj whenever a tasks changes its role (background/foreground/...) or binds to/unbinds from a service, making it more/less important. Such operation can happen frequently. We noticed that updates to oom_score_adj became more expensive and after further investigation found out that the patch mentioned in "Fixes" introduced a regression. Using Pixel 4 with a typical Android workload, write time to oom_score_adj increased from ~3.57us to ~362us. Moreover this regression linearly depends on the number of multi-threaded processes running on the system. Mark the mm with a new MMF_MULTIPROCESS flag bit when task is created with (CLONE_VM && !CLONE_THREAD && !CLONE_VFORK). Change __set_oom_adj to use MMF_MULTIPROCESS instead of mm_users to decide whether oom_score_adj update should be synchronized between multiple processes. To prevent races between clone() and __set_oom_adj(), when oom_score_adj of the process being cloned might be modified from userspace, we use oom_adj_mutex. Its scope is changed to global. The combination of (CLONE_VM && !CLONE_THREAD) is rarely used except for the case of vfork(). To prevent performance regressions of vfork(), we skip taking oom_adj_mutex and setting MMF_MULTIPROCESS when CLONE_VFORK is specified. Clearing the MMF_MULTIPROCESS flag (when the last process sharing the mm exits) is left out of this patch to keep it simple and because it is believed that this threading model is rare. Should there ever be a need for optimizing that case as well, it can be done by hooking into the exit path, likely following the mm_update_next_owner pattern. With the combination of (CLONE_VM && !CLONE_THREAD && !CLONE_VFORK) being quite rare, the regression is gone after the change is applied. [surenb@google.com: v3] Link: https://lkml.kernel.org/r/20200902012558.2335613-1-surenb@google.com Link: https://lkml.kernel.org/r/20200824153036.3201505-1-surenb@google.com Fixes: 44a70adec910 ("mm, oom_adj: make sure processes sharing mm have same view of oom_score_adj") Signed-off-by: Suren Baghdasaryan <surenb@google.com> Reported-by: Tim Murray <timmurray@google.com> Debugged-by: Minchan Kim <minchan@kernel.org> Suggested-by: Michal Hocko <mhocko@kernel.org> Acked-by: Christian Brauner <christian.brauner@ubuntu.com> Acked-by: Michal Hocko <mhocko@suse.com> Acked-by: Oleg Nesterov <oleg@redhat.com> Cc: Ingo Molnar <mingo@kernel.org> Cc: Peter Zijlstra <peterz@infradead.org> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Eugene Syromiatnikov <esyr@redhat.com> Cc: Christian Kellner <christian@kellner.me> Cc: Adrian Reber <areber@redhat.com> Cc: Shakeel Butt <shakeelb@google.com> Cc: Aleksa Sarai <cyphar@cyphar.com> Cc: Alexey Dobriyan <adobriyan@gmail.com> Cc: "Eric W. Biederman" <ebiederm@xmission.com> Cc: Alexey Gladkov <gladkov.alexey@gmail.com> Cc: Michel Lespinasse <walken@google.com> Cc: Daniel Jordan <daniel.m.jordan@oracle.com> Cc: Andrei Vagin <avagin@gmail.com> Cc: Bernd Edlinger <bernd.edlinger@hotmail.de> Cc: John Johansen <john.johansen@canonical.com> Cc: Yafang Shao <laoar.shao@gmail.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- fs/proc/base.c | 3 +-- include/linux/oom.h | 1 + include/linux/sched/coredump.h | 1 + kernel/fork.c | 21 +++++++++++++++++++++ mm/oom_kill.c | 2 ++ 5 files changed, 26 insertions(+), 2 deletions(-) --- a/fs/proc/base.c~mm-oom_adj-dont-loop-through-tasks-in-__set_oom_adj-when-not-necessary +++ a/fs/proc/base.c @@ -1055,7 +1055,6 @@ static ssize_t oom_adj_read(struct file static int __set_oom_adj(struct file *file, int oom_adj, bool legacy) { - static DEFINE_MUTEX(oom_adj_mutex); struct mm_struct *mm = NULL; struct task_struct *task; int err = 0; @@ -1095,7 +1094,7 @@ static int __set_oom_adj(struct file *fi struct task_struct *p = find_lock_task_mm(task); if (p) { - if (atomic_read(&p->mm->mm_users) > 1) { + if (test_bit(MMF_MULTIPROCESS, &p->mm->flags)) { mm = p->mm; mmgrab(mm); } --- a/include/linux/oom.h~mm-oom_adj-dont-loop-through-tasks-in-__set_oom_adj-when-not-necessary +++ a/include/linux/oom.h @@ -55,6 +55,7 @@ struct oom_control { }; extern struct mutex oom_lock; +extern struct mutex oom_adj_mutex; static inline void set_current_oom_origin(void) { --- a/include/linux/sched/coredump.h~mm-oom_adj-dont-loop-through-tasks-in-__set_oom_adj-when-not-necessary +++ a/include/linux/sched/coredump.h @@ -72,6 +72,7 @@ static inline int get_dumpable(struct mm #define MMF_DISABLE_THP 24 /* disable THP for all VMAs */ #define MMF_OOM_VICTIM 25 /* mm is the oom victim */ #define MMF_OOM_REAP_QUEUED 26 /* mm was queued for oom_reaper */ +#define MMF_MULTIPROCESS 27 /* mm is shared between processes */ #define MMF_DISABLE_THP_MASK (1 << MMF_DISABLE_THP) #define MMF_INIT_MASK (MMF_DUMPABLE_MASK | MMF_DUMP_FILTER_MASK |\ --- a/kernel/fork.c~mm-oom_adj-dont-loop-through-tasks-in-__set_oom_adj-when-not-necessary +++ a/kernel/fork.c @@ -1812,6 +1812,25 @@ static __always_inline void delayed_free free_task(tsk); } +static void copy_oom_score_adj(u64 clone_flags, struct task_struct *tsk) +{ + /* Skip if kernel thread */ + if (!tsk->mm) + return; + + /* Skip if spawning a thread or using vfork */ + if ((clone_flags & (CLONE_VM | CLONE_THREAD | CLONE_VFORK)) != CLONE_VM) + return; + + /* We need to synchronize with __set_oom_adj */ + mutex_lock(&oom_adj_mutex); + set_bit(MMF_MULTIPROCESS, &tsk->mm->flags); + /* Update the values in case they were changed after copy_signal */ + tsk->signal->oom_score_adj = current->signal->oom_score_adj; + tsk->signal->oom_score_adj_min = current->signal->oom_score_adj_min; + mutex_unlock(&oom_adj_mutex); +} + /* * This creates a new process as a copy of the old one, * but does not actually start it yet. @@ -2288,6 +2307,8 @@ static __latent_entropy struct task_stru trace_task_newtask(p, clone_flags); uprobe_copy_process(p, clone_flags); + copy_oom_score_adj(clone_flags, p); + return p; bad_fork_cancel_cgroup: --- a/mm/oom_kill.c~mm-oom_adj-dont-loop-through-tasks-in-__set_oom_adj-when-not-necessary +++ a/mm/oom_kill.c @@ -64,6 +64,8 @@ int sysctl_oom_dump_tasks = 1; * and mark_oom_victim */ DEFINE_MUTEX(oom_lock); +/* Serializes oom_score_adj and oom_score_adj_min updates */ +DEFINE_MUTEX(oom_adj_mutex); static inline bool is_memcg_oom(struct oom_control *oc) { _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 180/181] mm/migrate: remove cpages-- in migrate_vma_finalize() 2020-10-13 23:46 incoming Andrew Morton ` (178 preceding siblings ...) 2020-10-13 23:58 ` [patch 179/181] mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 2020-10-13 23:58 ` [patch 181/181] mm/migrate: remove obsolete comment about device public Andrew Morton 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, hch, jgg, jglisse, jhubbard, linux-mm, mm-commits, rcampbell, torvalds From: Ralph Campbell <rcampbell@nvidia.com> Subject: mm/migrate: remove cpages-- in migrate_vma_finalize() The variable struct migrate_vma->cpages is only used in migrate_vma_setup(). There is no need to decrement it in migrate_vma_finalize() since it is never checked. Link: http://lkml.kernel.org/r/20200827190735.12752-1-rcampbell@nvidia.com Signed-off-by: Ralph Campbell <rcampbell@nvidia.com> Cc: Jason Gunthorpe <jgg@nvidia.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Christoph Hellwig <hch@lst.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/migrate.c | 1 - 1 file changed, 1 deletion(-) --- a/mm/migrate.c~mm-migrate-remove-cpages-in-migrate_vma_finalize +++ a/mm/migrate.c @@ -3077,7 +3077,6 @@ void migrate_vma_finalize(struct migrate remove_migration_ptes(page, newpage, false); unlock_page(page); - migrate->cpages--; if (is_zone_device_page(page)) put_page(page); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* [patch 181/181] mm/migrate: remove obsolete comment about device public 2020-10-13 23:46 incoming Andrew Morton ` (179 preceding siblings ...) 2020-10-13 23:58 ` [patch 180/181] mm/migrate: remove cpages-- in migrate_vma_finalize() Andrew Morton @ 2020-10-13 23:58 ` Andrew Morton 180 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-13 23:58 UTC (permalink / raw) To: akpm, hch, jgg, jglisse, jhubbard, linux-mm, mm-commits, rcampbell, torvalds From: Ralph Campbell <rcampbell@nvidia.com> Subject: mm/migrate: remove obsolete comment about device public Device public memory never had an in tree consumer and was removed in commit 25b2995a35b6 ("mm: remove MEMORY_DEVICE_PUBLIC support"). Delete the obsolete comment. Link: http://lkml.kernel.org/r/20200827190735.12752-2-rcampbell@nvidia.com Signed-off-by: Ralph Campbell <rcampbell@nvidia.com> Reviewed-by: Jason Gunthorpe <jgg@nvidia.com> Cc: Jerome Glisse <jglisse@redhat.com> Cc: John Hubbard <jhubbard@nvidia.com> Cc: Christoph Hellwig <hch@lst.de> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- mm/migrate.c | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) --- a/mm/migrate.c~mm-migrate-remove-obsolete-comment-about-device-public +++ a/mm/migrate.c @@ -381,7 +381,7 @@ static int expected_page_refs(struct add int expected_count = 1; /* - * Device public or private pages have an extra refcount as they are + * Device private pages have an extra refcount as they are * ZONE_DEVICE pages. */ expected_count += is_device_private_page(page); _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-04-27 19:41 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-04-27 19:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 2 patches, based on d615b5416f8a1afeb82d13b238f8152c572d59c0. Subsystems affected by this patch series: mm/kasan mm/debug Subsystem: mm/kasan Zqiang <qiang1.zhang@intel.com>: kasan: prevent cpu_quarantine corruption when CPU offline and cache shrink occur at same time Subsystem: mm/debug Akira Yokosawa <akiyks@gmail.com>: docs: vm/page_owner: use literal blocks for param description Documentation/vm/page_owner.rst | 5 +++-- mm/kasan/quarantine.c | 7 +++++++ 2 files changed, 10 insertions(+), 2 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-04-21 23:35 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-04-21 23:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 13 patches, based on b253435746d9a4a701b5f09211b9c14d3370d0da. Subsystems affected by this patch series: mm/memory-failure mm/memcg mm/userfaultfd mm/hugetlbfs mm/mremap mm/oom-kill mm/kasan kcov mm/hmm Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: fix race between hugetlb free/demotion and memory_failure_hugetlb() Xu Yu <xuyu@linux.alibaba.com>: mm/memory-failure.c: skip huge_zero_page in memory_failure() Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: sync flush only if periodic flush is delayed Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: userfaultfd: mark uffd_wp regardless of VM_WRITE flag Subsystem: mm/hugetlbfs Christophe Leroy <christophe.leroy@csgroup.eu>: mm, hugetlb: allow for "high" userspace addresses Subsystem: mm/mremap Sidhartha Kumar <sidhartha.kumar@oracle.com>: selftest/vm: verify mmap addr in mremap_test selftest/vm: verify remap destination address in mremap_test selftest/vm: support xfail in mremap_test selftest/vm: add skip support to mremap_test Subsystem: mm/oom-kill Nico Pache <npache@redhat.com>: oom_kill.c: futex: delay the OOM reaper to allow time for proper futex cleanup Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: MAINTAINERS: add Vincenzo Frascino to KASAN reviewers Subsystem: kcov Aleksandr Nogikh <nogikh@google.com>: kcov: don't generate a warning on vm_insert_page()'s failure Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: mm/mmu_notifier.c: fix race in mmu_interval_notifier_remove() MAINTAINERS | 1 fs/hugetlbfs/inode.c | 9 - include/linux/hugetlb.h | 6 + include/linux/memcontrol.h | 5 include/linux/mm.h | 8 + include/linux/sched.h | 1 include/linux/sched/mm.h | 8 + kernel/kcov.c | 7 - mm/hugetlb.c | 10 + mm/memcontrol.c | 12 ++ mm/memory-failure.c | 158 ++++++++++++++++++++++-------- mm/mmap.c | 8 - mm/mmu_notifier.c | 14 ++ mm/oom_kill.c | 54 +++++++--- mm/userfaultfd.c | 15 +- mm/workingset.c | 2 tools/testing/selftests/vm/mremap_test.c | 85 +++++++++++++++- tools/testing/selftests/vm/run_vmtests.sh | 11 +- 18 files changed, 327 insertions(+), 87 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-04-15 2:12 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-04-15 2:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 14 patches, based on 115acbb56978941bb7537a97dfc303da286106c1. Subsystems affected by this patch series: MAINTAINERS mm/tmpfs m/secretmem mm/kasan mm/kfence mm/pagealloc mm/zram mm/compaction mm/hugetlb binfmt mm/vmalloc mm/kmemleak Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: MAINTAINERS: Broadcom internal lists aren't maintainers Subsystem: mm/tmpfs Hugh Dickins <hughd@google.com>: tmpfs: fix regressions from wider use of ZERO_PAGE Subsystem: m/secretmem Axel Rasmussen <axelrasmussen@google.com>: mm/secretmem: fix panic when growing a memfd_secret Subsystem: mm/kasan Zqiang <qiang1.zhang@intel.com>: irq_work: use kasan_record_aux_stack_noalloc() record callstack Vincenzo Frascino <vincenzo.frascino@arm.com>: kasan: fix hw tags enablement when KUNIT tests are disabled Subsystem: mm/kfence Marco Elver <elver@google.com>: mm, kfence: support kmem_dump_obj() for KFENCE objects Subsystem: mm/pagealloc Juergen Gross <jgross@suse.com>: mm, page_alloc: fix build_zonerefs_node() Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: mm: fix unexpected zeroed page mapping with zram swap Subsystem: mm/compaction Charan Teja Kalla <quic_charante@quicinc.com>: mm: compaction: fix compiler warning when CONFIG_COMPACTION=n Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: do not demote poisoned hugetlb pages Subsystem: binfmt Andrew Morton <akpm@linux-foundation.org>: revert "fs/binfmt_elf: fix PT_LOAD p_align values for loaders" revert "fs/binfmt_elf: use PT_LOAD p_align values for static PIE" Subsystem: mm/vmalloc Omar Sandoval <osandov@fb.com>: mm/vmalloc: fix spinning drain_vmap_work after reading from /proc/vmcore Subsystem: mm/kmemleak Patrick Wang <patrick.wang.shcn@gmail.com>: mm: kmemleak: take a full lowmem check in kmemleak_*_phys() MAINTAINERS | 64 ++++++++++++++++++++-------------------- arch/x86/include/asm/io.h | 2 - arch/x86/kernel/crash_dump_64.c | 1 fs/binfmt_elf.c | 6 +-- include/linux/kfence.h | 24 +++++++++++++++ kernel/irq_work.c | 2 - mm/compaction.c | 10 +++--- mm/filemap.c | 6 --- mm/hugetlb.c | 17 ++++++---- mm/kasan/hw_tags.c | 5 +-- mm/kasan/kasan.h | 10 +++--- mm/kfence/core.c | 21 ------------- mm/kfence/kfence.h | 21 +++++++++++++ mm/kfence/report.c | 47 +++++++++++++++++++++++++++++ mm/kmemleak.c | 8 ++--- mm/page_alloc.c | 2 - mm/page_io.c | 54 --------------------------------- mm/secretmem.c | 17 ++++++++++ mm/shmem.c | 31 ++++++++++++------- mm/slab.c | 2 - mm/slab.h | 2 - mm/slab_common.c | 9 +++++ mm/slob.c | 2 - mm/slub.c | 2 - mm/vmalloc.c | 11 ------ 25 files changed, 207 insertions(+), 169 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-04-08 20:08 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-04-08 20:08 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 9 patches, based on d00c50b35101b862c3db270ffeba53a63a1063d9. Subsystems affected by this patch series: mm/migration mm/highmem lz4 mm/sparsemem mm/mremap mm/mempolicy mailmap mm/memcg MAINTAINERS Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm: migrate: use thp_order instead of HPAGE_PMD_ORDER for new page allocation. Subsystem: mm/highmem Max Filippov <jcmvbkbc@gmail.com>: highmem: fix checks in __kmap_local_sched_{in,out} Subsystem: lz4 Guo Xuenan <guoxuenan@huawei.com>: lz4: fix LZ4_decompress_safe_partial read out of bound Subsystem: mm/sparsemem Waiman Long <longman@redhat.com>: mm/sparsemem: fix 'mem_section' will never be NULL gcc 12 warning Subsystem: mm/mremap Paolo Bonzini <pbonzini@redhat.com>: mmmremap.c: avoid pointless invalidate_range_start/end on mremap(old_size=0) Subsystem: mm/mempolicy Miaohe Lin <linmiaohe@huawei.com>: mm/mempolicy: fix mpol_new leak in shared_policy_replace Subsystem: mailmap Vasily Averin <vasily.averin@linux.dev>: mailmap: update Vasily Averin's email address Subsystem: mm/memcg Andrew Morton <akpm@linux-foundation.org>: mm/list_lru.c: revert "mm/list_lru: optimize memcg_reparent_list_lru_node()" Subsystem: MAINTAINERS Tom Rix <trix@redhat.com>: MAINTAINERS: add Tom as clang reviewer .mailmap | 4 ++++ MAINTAINERS | 1 + include/linux/mmzone.h | 11 +++++++---- lib/lz4/lz4_decompress.c | 8 ++++++-- mm/highmem.c | 4 ++-- mm/list_lru.c | 6 ------ mm/mempolicy.c | 3 ++- mm/migrate.c | 2 +- mm/mremap.c | 3 +++ 9 files changed, 26 insertions(+), 16 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-04-01 18:27 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696. Subsystems affected by this patch series: mm/madvise ofs2 nilfs2 mm/mlock mm/mfence mailmap mm/memory-failure mm/kasan mm/debug mm/kmemleak mm/damon Subsystem: mm/madvise Charan Teja Kalla <quic_charante@quicinc.com>: Revert "mm: madvise: skip unmapped vma holes passed to process_madvise" Subsystem: ofs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when mount with quota enabled Subsystem: nilfs2 Ryusuke Konishi <konishi.ryusuke@gmail.com>: Patch series "nilfs2 lockdep warning fixes": nilfs2: fix lockdep warnings in page operations for btree nodes nilfs2: fix lockdep warnings during disk space reclamation nilfs2: get rid of nilfs_mapping_init() Subsystem: mm/mlock Hugh Dickins <hughd@google.com>: mm/munlock: add lru_add_drain() to fix memcg_stat_test mm/munlock: update Documentation/vm/unevictable-lru.rst Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/munlock: protect the per-CPU pagevec by a local_lock_t Subsystem: mm/kfence Muchun Song <songmuchun@bytedance.com>: mm: kfence: fix objcgs vector allocation Subsystem: mailmap Kirill Tkhai <kirill.tkhai@openvz.org>: mailmap: update Kirill's email Subsystem: mm/memory-failure Rik van Riel <riel@surriel.com>: mm,hwpoison: unmap poisoned page before invalidation Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP Subsystem: mm/debug Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: remove -c option doc/vm/page_owner.rst: remove content related to -c option Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: mm/kmemleak: reset tag when compare object pointer Subsystem: mm/damon Jonghyeon Kim <tome01@ajou.ac.kr>: mm/damon: prevent activated scheme from sleeping by deactivated schemes .mailmap | 1 Documentation/vm/page_owner.rst | 1 Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++-------------------- fs/nilfs2/btnode.c | 23 + fs/nilfs2/btnode.h | 1 fs/nilfs2/btree.c | 27 + fs/nilfs2/dat.c | 4 fs/nilfs2/gcinode.c | 7 fs/nilfs2/inode.c | 167 +++++++++++- fs/nilfs2/mdt.c | 45 ++- fs/nilfs2/mdt.h | 6 fs/nilfs2/nilfs.h | 16 - fs/nilfs2/page.c | 16 - fs/nilfs2/page.h | 1 fs/nilfs2/segment.c | 9 fs/nilfs2/super.c | 5 fs/ocfs2/quota_global.c | 23 - fs/ocfs2/quota_local.c | 2 include/linux/gfp.h | 4 mm/damon/core.c | 5 mm/gup.c | 10 mm/internal.h | 6 mm/kfence/core.c | 11 mm/kfence/kfence.h | 3 mm/kmemleak.c | 9 mm/madvise.c | 9 mm/memory.c | 12 mm/migrate.c | 2 mm/mlock.c | 46 ++- mm/page_alloc.c | 1 mm/rmap.c | 4 mm/swap.c | 4 tools/vm/page_owner_sort.c | 6 33 files changed, 560 insertions(+), 399 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-04-01 18:20 Andrew Morton 2022-04-01 18:27 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2022-04-01 18:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696. Subsystems affected by this patch series: mm/madvise ofs2 nilfs2 mm/mlock mm/mfence mailmap mm/memory-failure mm/kasan mm/debug mm/kmemleak mm/damon Subsystem: mm/madvise Charan Teja Kalla <quic_charante@quicinc.com>: Revert "mm: madvise: skip unmapped vma holes passed to process_madvise" Subsystem: ofs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when mount with quota enabled Subsystem: nilfs2 Ryusuke Konishi <konishi.ryusuke@gmail.com>: Patch series "nilfs2 lockdep warning fixes": nilfs2: fix lockdep warnings in page operations for btree nodes nilfs2: fix lockdep warnings during disk space reclamation nilfs2: get rid of nilfs_mapping_init() Subsystem: mm/mlock Hugh Dickins <hughd@google.com>: mm/munlock: add lru_add_drain() to fix memcg_stat_test mm/munlock: update Documentation/vm/unevictable-lru.rst Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/munlock: protect the per-CPU pagevec by a local_lock_t Subsystem: mm/kfence Muchun Song <songmuchun@bytedance.com>: mm: kfence: fix objcgs vector allocation Subsystem: mailmap Kirill Tkhai <kirill.tkhai@openvz.org>: mailmap: update Kirill's email Subsystem: mm/memory-failure Rik van Riel <riel@surriel.com>: mm,hwpoison: unmap poisoned page before invalidation Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP Subsystem: mm/debug Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: remove -c option doc/vm/page_owner.rst: remove content related to -c option Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: mm/kmemleak: reset tag when compare object pointer Subsystem: mm/damon Jonghyeon Kim <tome01@ajou.ac.kr>: mm/damon: prevent activated scheme from sleeping by deactivated schemes .mailmap | 1 Documentation/vm/page_owner.rst | 1 Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++-------------------- fs/nilfs2/btnode.c | 23 + fs/nilfs2/btnode.h | 1 fs/nilfs2/btree.c | 27 + fs/nilfs2/dat.c | 4 fs/nilfs2/gcinode.c | 7 fs/nilfs2/inode.c | 167 +++++++++++- fs/nilfs2/mdt.c | 45 ++- fs/nilfs2/mdt.h | 6 fs/nilfs2/nilfs.h | 16 - fs/nilfs2/page.c | 16 - fs/nilfs2/page.h | 1 fs/nilfs2/segment.c | 9 fs/nilfs2/super.c | 5 fs/ocfs2/quota_global.c | 23 - fs/ocfs2/quota_local.c | 2 include/linux/gfp.h | 4 mm/damon/core.c | 5 mm/gup.c | 10 mm/internal.h | 6 mm/kfence/core.c | 11 mm/kfence/kfence.h | 3 mm/kmemleak.c | 9 mm/madvise.c | 9 mm/memory.c | 12 mm/migrate.c | 2 mm/mlock.c | 46 ++- mm/page_alloc.c | 1 mm/rmap.c | 4 mm/swap.c | 4 tools/vm/page_owner_sort.c | 6 33 files changed, 560 insertions(+), 399 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2022-04-01 18:20 incoming Andrew Morton @ 2022-04-01 18:27 ` Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits, patches Argh, messed up in-reply-to. Let me redo... ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-03-25 1:07 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-03-25 1:07 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches This is the material which was staged after willystuff in linux-next. Everything applied seamlessly on your latest, all looks well. 114 patches, based on 52deda9551a01879b3562e7b41748e85c591f14c. Subsystems affected by this patch series: mm/debug mm/selftests mm/pagecache mm/thp mm/rmap mm/migration mm/kasan mm/hugetlb mm/pagemap mm/madvise selftests Subsystem: mm/debug Sean Anderson <seanga2@gmail.com>: tools/vm/page_owner_sort.c: sort by stacktrace before culling tools/vm/page_owner_sort.c: support sorting by stack trace Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: support sorting pid and time Shenghong Han <hanshenghong2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: two trivial fixes Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: tools/vm/page_owner_sort.c: delete invalid duplicate code Shenghong Han <hanshenghong2019@email.szu.edu.cn>: Documentation/vm/page_owner.rst: update the documentation Shuah Khan <skhan@linuxfoundation.org>: Documentation/vm/page_owner.rst: fix unexpected indentation warns Waiman Long <longman@redhat.com>: Patch series "mm/page_owner: Extend page_owner to show memcg information", v4: lib/vsprintf: avoid redundant work with 0 size mm/page_owner: use scnprintf() to avoid excessive buffer overrun check mm/page_owner: print memcg information mm/page_owner: record task command name Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: mm/page_owner.c: record tgid tools/vm/page_owner_sort.c: fix the instructions for use Jiajian Ye <yejiajian2018@email.szu.edu.cn>: tools/vm/page_owner_sort.c: fix comments tools/vm/page_owner_sort.c: add a security check tools/vm/page_owner_sort.c: support sorting by tgid and update documentation tools/vm/page_owner_sort: fix three trivival places tools/vm/page_owner_sort: support for sorting by task command name tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name tools/vm/page_owner_sort.c: support for user-defined culling rules Christoph Hellwig <hch@lst.de>: mm: unexport page_init_poison Subsystem: mm/selftests "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: add util.h and and move helper functions there Mike Rapoport <rppt@kernel.org>: selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT Subsystem: mm/pagecache Hugh Dickins <hughd@google.com>: mm: delete __ClearPageWaiters() mm: filemap_unaccount_folio() large skip mapcount fixup Subsystem: mm/thp Hugh Dickins <hughd@google.com>: mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap() Subsystem: mm/rmap Subsystem: mm/migration Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/migration: Add trace events", v3: mm/migration: add trace events for THP migrations mm/migration: add trace events for base page and HugeTLB migrations Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6: kasan, page_alloc: deduplicate should_skip_kasan_poison kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages kasan, page_alloc: merge kasan_free_pages into free_pages_prepare kasan, page_alloc: simplify kasan_poison_pages call site kasan, page_alloc: init memory of skipped pages on free kasan: drop skip_kasan_poison variable in free_pages_prepare mm: clarify __GFP_ZEROTAGS comment kasan: only apply __GFP_ZEROTAGS when memory is zeroed kasan, page_alloc: refactor init checks in post_alloc_hook kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook kasan, page_alloc: rework kasan_unpoison_pages call site kasan: clean up metadata byte definitions kasan: define KASAN_VMALLOC_INVALID for SW_TAGS kasan, x86, arm64, s390: rename functions for modules shadow kasan, vmalloc: drop outdated VM_KASAN comment kasan: reorder vmalloc hooks kasan: add wrappers for vmalloc hooks kasan, vmalloc: reset tags in vmalloc functions kasan, fork: reset pointer tags of vmapped stacks kasan, arm64: reset pointer tags of vmapped stacks kasan, vmalloc: add vmalloc tagging for SW_TAGS kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged kasan, vmalloc: unpoison VM_ALLOC pages after mapping kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS kasan, page_alloc: allow skipping unpoisoning for HW_TAGS kasan, page_alloc: allow skipping memory init for HW_TAGS kasan, vmalloc: add vmalloc tagging for HW_TAGS kasan, vmalloc: only tag normal vmalloc allocations kasan, arm64: don't tag executable vmalloc allocations kasan: mark kasan_arg_stacktrace as __initdata kasan: clean up feature flags for HW_TAGS mode kasan: add kasan.vmalloc command line flag kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS arm64: select KASAN_VMALLOC for SW/HW_TAGS modes kasan: documentation updates kasan: improve vmalloc tests kasan: test: support async (again) and asymm modes for HW_TAGS tangmeng <tangmeng@uniontech.com>: mm/kasan: remove unnecessary CONFIG_KASAN option Peter Collingbourne <pcc@google.com>: kasan: update function name in comments Andrey Konovalov <andreyknvl@google.com>: kasan: print virtual mapping info in reports Patch series "kasan: report clean-ups and improvements": kasan: drop addr check from describe_object_addr kasan: more line breaks in reports kasan: rearrange stack frame info in reports kasan: improve stack frame info in reports kasan: print basic stack frame info for SW_TAGS kasan: simplify async check in end_report() kasan: simplify kasan_update_kunit_status() and call sites kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT kasan: move update_kunit_status to start_report kasan: move disable_trace_on_warning to start_report kasan: split out print_report from __kasan_report kasan: simplify kasan_find_first_bad_addr call sites kasan: restructure kasan_report kasan: merge __kasan_report into kasan_report kasan: call print_report from kasan_report_invalid_free kasan: move and simplify kasan_report_async kasan: rename kasan_access_info to kasan_report_info kasan: add comment about UACCESS regions to kasan_report kasan: respect KASAN_BIT_REPORTED in all reporting routines kasan: reorder reporting functions kasan: move and hide kasan_save_enable/restore_multi_shot kasan: disable LOCKDEP when printing reports Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Add hugetlb MADV_DONTNEED support", v3: mm: enable MADV_DONTNEED for hugetlb mappings selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test userfaultfd/selftests: enable hugetlb remap and remove event testing Miaohe Lin <linmiaohe@huawei.com>: mm/huge_memory: make is_transparent_hugepage() static Subsystem: mm/pagemap David Hildenbrand <david@redhat.com>: Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3: mm: optimize do_wp_page() for exclusive pages in the swapcache mm: optimize do_wp_page() for fresh pages in local LRU pagevecs mm: slightly clarify KSM logic in do_swap_page() mm: streamline COW logic in do_swap_page() mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page() mm/khugepaged: remove reuse_swap_page() usage mm/swapfile: remove stale reuse_swap_page() mm/huge_memory: remove stale page_trans_huge_mapcount() mm/huge_memory: remove stale locking logic from __split_huge_pmd() Hugh Dickins <hughd@google.com>: mm: warn on deleting redirtied only if accounted mm: unmap_mapping_range_tree() with i_mmap_rwsem shared Anshuman Khandual <anshuman.khandual@arm.com>: mm: generalize ARCH_HAS_FILTER_PGPROT Subsystem: mm/madvise Mauricio Faria de Oliveira <mfo@canonical.com>: mm: fix race between MADV_FREE reclaim and blkdev direct IO read Johannes Weiner <hannes@cmpxchg.org>: mm: madvise: MADV_DONTNEED_LOCKED Subsystem: selftests Muhammad Usama Anjum <usama.anjum@collabora.com>: selftests: vm: remove dependecy from internal kernel macros Kees Cook <keescook@chromium.org>: selftests: kselftest framework: provide "finished" helper Documentation/dev-tools/kasan.rst | 17 Documentation/vm/page_owner.rst | 72 ++ arch/alpha/include/uapi/asm/mman.h | 2 arch/arm64/Kconfig | 2 arch/arm64/include/asm/vmalloc.h | 6 arch/arm64/include/asm/vmap_stack.h | 5 arch/arm64/kernel/module.c | 5 arch/arm64/mm/pageattr.c | 2 arch/arm64/net/bpf_jit_comp.c | 3 arch/mips/include/uapi/asm/mman.h | 2 arch/parisc/include/uapi/asm/mman.h | 2 arch/powerpc/mm/book3s64/trace.c | 1 arch/s390/kernel/module.c | 2 arch/x86/Kconfig | 3 arch/x86/kernel/module.c | 2 arch/x86/mm/init.c | 1 arch/xtensa/include/uapi/asm/mman.h | 2 include/linux/gfp.h | 53 +- include/linux/huge_mm.h | 6 include/linux/kasan.h | 136 +++-- include/linux/mm.h | 5 include/linux/page-flags.h | 2 include/linux/pagemap.h | 3 include/linux/swap.h | 4 include/linux/vmalloc.h | 18 include/trace/events/huge_memory.h | 1 include/trace/events/migrate.h | 31 + include/trace/events/mmflags.h | 18 include/trace/events/thp.h | 27 + include/uapi/asm-generic/mman-common.h | 2 kernel/fork.c | 13 kernel/scs.c | 16 lib/Kconfig.kasan | 18 lib/test_kasan.c | 239 ++++++++- lib/vsprintf.c | 8 mm/Kconfig | 3 mm/debug.c | 1 mm/filemap.c | 63 +- mm/huge_memory.c | 109 ---- mm/kasan/Makefile | 2 mm/kasan/common.c | 4 mm/kasan/hw_tags.c | 243 +++++++--- mm/kasan/kasan.h | 76 ++- mm/kasan/report.c | 516 +++++++++++---------- mm/kasan/report_generic.c | 34 - mm/kasan/report_hw_tags.c | 1 mm/kasan/report_sw_tags.c | 16 mm/kasan/report_tags.c | 2 mm/kasan/shadow.c | 76 +-- mm/khugepaged.c | 11 mm/madvise.c | 57 +- mm/memory.c | 129 +++-- mm/memremap.c | 2 mm/migrate.c | 4 mm/page-writeback.c | 18 mm/page_alloc.c | 270 ++++++----- mm/page_owner.c | 86 ++- mm/rmap.c | 62 +- mm/swap.c | 4 mm/swapfile.c | 104 ---- mm/vmalloc.c | 167 ++++-- tools/testing/selftests/kselftest.h | 10 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/gup_test.c | 3 tools/testing/selftests/vm/hugetlb-madvise.c | 410 ++++++++++++++++ tools/testing/selftests/vm/ksm_tests.c | 38 - tools/testing/selftests/vm/memfd_secret.c | 2 tools/testing/selftests/vm/run_vmtests.sh | 15 tools/testing/selftests/vm/transhuge-stress.c | 41 - tools/testing/selftests/vm/userfaultfd.c | 72 +- tools/testing/selftests/vm/util.h | 75 ++- tools/vm/page_owner_sort.c | 628 +++++++++++++++++++++----- 73 files changed, 2797 insertions(+), 1288 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-03-23 23:04 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-03-23 23:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches Various misc subsystems, before getting into the post-linux-next material. This is all based on v5.17. I tested applying and compiling against today's 1bc191051dca28fa6. One patch required an extra whack, all looks good. 41 patches, based on f443e374ae131c168a065ea1748feac6b2e76613. Subsystems affected by this patch series: procfs misc core-kernel lib checkpatch init pipe minix fat cgroups kexec kdump taskstats panic kcov resource ubsan Subsystem: procfs Hao Lee <haolee.swjtu@gmail.com>: proc: alloc PATH_MAX bytes for /proc/${pid}/fd/ symlinks David Hildenbrand <david@redhat.com>: proc/vmcore: fix possible deadlock on concurrent mmap and read Yang Li <yang.lee@linux.alibaba.com>: proc/vmcore: fix vmcore_alloc_buf() kernel-doc comment Subsystem: misc Bjorn Helgaas <bhelgaas@google.com>: linux/types.h: remove unnecessary __bitwise__ Documentation/sparse: add hints about __CHECKER__ Subsystem: core-kernel Miaohe Lin <linmiaohe@huawei.com>: kernel/ksysfs.c: use helper macro __ATTR_RW Subsystem: lib Kees Cook <keescook@chromium.org>: Kconfig.debug: make DEBUG_INFO selectable from a choice Rasmus Villemoes <linux@rasmusvillemoes.dk>: include: drop pointless __compiler_offsetof indirection Christophe Leroy <christophe.leroy@csgroup.eu>: ilog2: force inlining of __ilog2_u32() and __ilog2_u64() Andy Shevchenko <andriy.shevchenko@linux.intel.com>: bitfield: add explicit inclusions to the example Feng Tang <feng.tang@intel.com>: lib/Kconfig.debug: add ARCH dependency for FUNCTION_ALIGN option Randy Dunlap <rdunlap@infradead.org>: lib: bitmap: fix many kernel-doc warnings Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: prefer MODULE_LICENSE("GPL") over MODULE_LICENSE("GPL v2") checkpatch: add --fix option for some TRAILING_STATEMENTS checkpatch: add early_param exception to blank line after struct/function test Sagar Patel <sagarmp@cs.unc.edu>: checkpatch: use python3 to find codespell dictionary Subsystem: init Mark-PK Tsai <mark-pk.tsai@mediatek.com>: init: use ktime_us_delta() to make initcall_debug log more precise Randy Dunlap <rdunlap@infradead.org>: init.h: improve __setup and early_param documentation init/main.c: return 1 from handled __setup() functions Subsystem: pipe Andrei Vagin <avagin@gmail.com>: fs/pipe: use kvcalloc to allocate a pipe_buffer array fs/pipe.c: local vars have to match types of proper pipe_inode_info fields Subsystem: minix Qinghua Jin <qhjin.dev@gmail.com>: minix: fix bug when opening a file with O_DIRECT Subsystem: fat Helge Deller <deller@gmx.de>: fat: use pointer to simple type in put_user() Subsystem: cgroups Sebastian Andrzej Siewior <bigeasy@linutronix.de>: cgroup: use irqsave in cgroup_rstat_flush_locked(). cgroup: add a comment to cgroup_rstat_flush_locked(). Subsystem: kexec Jisheng Zhang <jszhang@kernel.org>: Patch series "kexec: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef", v2: kexec: make crashk_res, crashk_low_res and crash_notes symbols always visible riscv: mm: init: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef x86/setup: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef arm64: mm: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef Subsystem: kdump Tiezhu Yang <yangtiezhu@loongson.cn>: Patch series "Update doc and fix some issues about kdump", v2: docs: kdump: update description about sysfs file system support docs: kdump: add scp example to write out the dump file panic: unset panic_on_warn inside panic() ubsan: no need to unset panic_on_warn in ubsan_epilogue() kasan: no need to unset panic_on_warn in end_report() Subsystem: taskstats Lukas Bulwahn <lukas.bulwahn@gmail.com>: taskstats: remove unneeded dead assignment Subsystem: panic "Guilherme G. Piccoli" <gpiccoli@igalia.com>: Patch series "Some improvements on panic_print": docs: sysctl/kernel: add missing bit to panic_print panic: add option to dump all CPUs backtraces in panic_print panic: move panic_print before kmsg dumpers Subsystem: kcov Aleksandr Nogikh <nogikh@google.com>: Patch series "kcov: improve mmap processing", v3: kcov: split ioctl handling into locked and unlocked parts kcov: properly handle subsequent mmap calls Subsystem: resource Miaohe Lin <linmiaohe@huawei.com>: kernel/resource: fix kfree() of bootmem memory again Subsystem: ubsan Marco Elver <elver@google.com>: Revert "ubsan, kcsan: Don't combine sanitizer with kcov on clang" Documentation/admin-guide/kdump/kdump.rst | 10 + Documentation/admin-guide/kernel-parameters.txt | 5 Documentation/admin-guide/sysctl/kernel.rst | 2 Documentation/dev-tools/sparse.rst | 2 arch/arm64/mm/init.c | 9 - arch/riscv/mm/init.c | 6 - arch/x86/kernel/setup.c | 10 - fs/fat/dir.c | 2 fs/minix/inode.c | 3 fs/pipe.c | 13 +- fs/proc/base.c | 8 - fs/proc/vmcore.c | 43 +++---- include/linux/bitfield.h | 3 include/linux/compiler_types.h | 3 include/linux/init.h | 11 + include/linux/kexec.h | 12 +- include/linux/log2.h | 4 include/linux/stddef.h | 6 - include/uapi/linux/types.h | 6 - init/main.c | 14 +- kernel/cgroup/rstat.c | 13 +- kernel/kcov.c | 102 ++++++++--------- kernel/ksysfs.c | 3 kernel/panic.c | 37 ++++-- kernel/resource.c | 41 +----- kernel/taskstats.c | 5 lib/Kconfig.debug | 142 ++++++++++++------------ lib/Kconfig.kcsan | 11 - lib/Kconfig.ubsan | 12 -- lib/bitmap.c | 24 ++-- lib/ubsan.c | 10 - mm/kasan/report.c | 10 - scripts/checkpatch.pl | 31 ++++- tools/include/linux/types.h | 5 34 files changed, 313 insertions(+), 305 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-03-22 21:38 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-03-22 21:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches - A few misc subsystems - There is a lot of MM material in Willy's tree. Folio work and non-folio patches which depended on that work. Here I send almost all the MM patches which precede the patches in Willy's tree. The remaining ~100 MM patches are staged on Willy's tree and I'll send those along once Willy is merged up. I tried this batch against your current tree (as of 51912904076680281) and a couple need some extra persuasion to apply, but all looks OK otherwise. 227 patches, based on f443e374ae131c168a065ea1748feac6b2e76613 Subsystems affected by this patch series: kthread scripts ntfs ocfs2 block vfs mm/kasan mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/selftests mm/pagemap mm/mremap mm/sparsemem mm/vmalloc mm/pagealloc mm/memory-failure mm/mlock mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/mempolicy mm/oom-kill mm/migration mm/thp mm/cma mm/autonuma mm/psi mm/ksm mm/page-poison mm/madvise mm/memory-hotplug mm/rmap mm/zswap mm/uaccess mm/ioremap mm/highmem mm/cleanups mm/kfence mm/hmm mm/damon Subsystem: kthread Rasmus Villemoes <linux@rasmusvillemoes.dk>: linux/kthread.h: remove unused macros Subsystem: scripts Colin Ian King <colin.i.king@gmail.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Dongliang Mu <mudongliangabcd@gmail.com>: ntfs: add sanity check on allocation size Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: cleanup some return variables hongnanli <hongnan.li@linux.alibaba.com>: fs/ocfs2: fix comments mentioning i_mutex Subsystem: block NeilBrown <neilb@suse.de>: Patch series "Remove remaining parts of congestion tracking code", v2: doc: convert 'subsection' to 'section' in gfp.h mm: document and polish read-ahead code mm: improve cleanup when ->readpages doesn't process all pages fuse: remove reliance on bdi congestion nfs: remove reliance on bdi congestion ceph: remove reliance on bdi congestion remove inode_congested() remove bdi_congested() and wb_congested() and related functions f2fs: replace congestion_wait() calls with io_schedule_timeout() block/bfq-iosched.c: use "false" rather than "BLK_RW_ASYNC" remove congestion tracking framework Subsystem: vfs Anthony Iliopoulos <ailiop@suse.com>: mount: warn only once about timestamp range expiration Subsystem: mm/kasan Miaohe Lin <linmiaohe@huawei.com>: mm/memremap: avoid calling kasan_remove_zero_shadow() for device private memory Subsystem: mm/pagecache Miaohe Lin <linmiaohe@huawei.com>: filemap: remove find_get_pages() mm/writeback: minor clean up for highmem_dirtyable_memory Minchan Kim <minchan@kernel.org>: mm: fs: fix lru_cache_disabled race in bh_lru Subsystem: mm/gup Peter Xu <peterx@redhat.com>: Patch series "mm/gup: some cleanups", v5: mm: fix invalid page pointer returned with FOLL_PIN gups John Hubbard <jhubbard@nvidia.com>: mm/gup: follow_pfn_pte(): -EEXIST cleanup mm/gup: remove unused pin_user_pages_locked() mm: change lookup_node() to use get_user_pages_fast() mm/gup: remove unused get_user_pages_locked() Subsystem: mm/swap Bang Li <libang.linuxer@gmail.com>: mm/swap: fix confusing comment in folio_mark_accessed Subsystem: mm/shmem Xavier Roche <xavier.roche@algolia.com>: tmpfs: support for file creation time Hugh Dickins <hughd@google.com>: shmem: mapping_set_exiting() to help mapped resilience tmpfs: do not allocate pages on read Miaohe Lin <linmiaohe@huawei.com>: mm: shmem: use helper macro __ATTR_RW Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: replace in_interrupt() with !in_task() Yosry Ahmed <yosryahmed@google.com>: memcg: add per-memcg total kernel memory stat Wei Yang <richard.weiyang@gmail.com>: mm/memcg: mem_cgroup_per_node is already set to 0 on allocation mm/memcg: retrieve parent memcg from css.parent Shakeel Butt <shakeelb@google.com>: Patch series "memcg: robust enforcement of memory.high", v2: memcg: refactor mem_cgroup_oom memcg: unify force charging conditions selftests: memcg: test high limit for single entry allocation memcg: synchronously enforce memory.high for large overcharges Randy Dunlap <rdunlap@infradead.org>: mm/memcontrol: return 1 from cgroup.memory __setup() handler Michal Hocko <mhocko@suse.com>: Patch series "mm/memcg: Address PREEMPT_RT problems instead of disabling it", v5: mm/memcg: revert ("mm/memcg: optimize user context object stock access") Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/memcg: disable threshold event handlers on PREEMPT_RT mm/memcg: protect per-CPU counter by disabling preemption on PREEMPT_RT where needed. Johannes Weiner <hannes@cmpxchg.org>: mm/memcg: opencode the inner part of obj_cgroup_uncharge_pages() in drain_obj_stock() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/memcg: protect memcg_stock with a local_lock_t mm/memcg: disable migration instead of preemption in drain_all_stock(). Muchun Song <songmuchun@bytedance.com>: Patch series "Optimize list lru memory consumption", v6: mm: list_lru: transpose the array of per-node per-memcg lru lists mm: introduce kmem_cache_alloc_lru fs: introduce alloc_inode_sb() to allocate filesystems specific inode fs: allocate inode by using alloc_inode_sb() f2fs: allocate inode by using alloc_inode_sb() mm: dcache: use kmem_cache_alloc_lru() to allocate dentry xarray: use kmem_cache_alloc_lru to allocate xa_node mm: memcontrol: move memcg_online_kmem() to mem_cgroup_css_online() mm: list_lru: allocate list_lru_one only when needed mm: list_lru: rename memcg_drain_all_list_lrus to memcg_reparent_list_lrus mm: list_lru: replace linear array with xarray mm: memcontrol: reuse memory cgroup ID for kmem ID mm: memcontrol: fix cannot alloc the maximum memcg ID mm: list_lru: rename list_lru_per_memcg to list_lru_memcg mm: memcontrol: rename memcg_cache_id to memcg_kmem_id Vasily Averin <vvs@virtuozzo.com>: memcg: enable accounting for tty-related objects Subsystem: mm/selftests Guillaume Tucker <guillaume.tucker@collabora.com>: selftests, x86: fix how check_cc.sh is being invoked Subsystem: mm/pagemap Anshuman Khandual <anshuman.khandual@arm.com>: mm: merge pte_mkhuge() call into arch_make_huge_pte() Stafford Horne <shorne@gmail.com>: mm: remove mmu_gathers storage from remaining architectures Muchun Song <songmuchun@bytedance.com>: Patch series "Fix some cache flush bugs", v5: mm: thp: fix wrong cache flush in remove_migration_pmd() mm: fix missing cache flush for all tail pages of compound page mm: hugetlb: fix missing cache flush in copy_huge_page_from_user() mm: hugetlb: fix missing cache flush in hugetlb_mcopy_atomic_pte() mm: shmem: fix missing cache flush in shmem_mfill_atomic_pte() mm: userfaultfd: fix missing cache flush in mcopy_atomic_pte() and __mcopy_atomic() mm: replace multiple dcache flush with flush_dcache_folio() Peter Xu <peterx@redhat.com>: Patch series "mm: Rework zap ptes on swap entries", v5: mm: don't skip swap entry even if zap_details specified mm: rename zap_skip_check_mapping() to should_zap_page() mm: change zap_details.zap_mapping into even_cows mm: rework swap handling of zap_pte_range Randy Dunlap <rdunlap@infradead.org>: mm/mmap: return 1 from stack_guard_gap __setup() handler Miaohe Lin <linmiaohe@huawei.com>: mm/memory.c: use helper function range_in_vma() mm/memory.c: use helper macro min and max in unmap_mapping_range_tree() Hugh Dickins <hughd@google.com>: mm: _install_special_mapping() apply VM_LOCKED_CLEAR_MASK Miaohe Lin <linmiaohe@huawei.com>: mm/mmap: remove obsolete comment in ksys_mmap_pgoff Subsystem: mm/mremap Miaohe Lin <linmiaohe@huawei.com>: mm/mremap:: use vma_lookup() instead of find_vma() Subsystem: mm/sparsemem Miaohe Lin <linmiaohe@huawei.com>: mm/sparse: make mminit_validate_memmodel_limits() static Subsystem: mm/vmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/vmalloc: remove unneeded function forward declaration "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: Move draining areas out of caller context Uladzislau Rezki <uladzislau.rezki@sony.com>: mm/vmalloc: add adjust_search_size parameter "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: eliminate an extra orig_gfp_mask Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: mm/vmalloc.c: fix "unused function" warning Bang Li <libang.linuxer@gmail.com>: mm/vmalloc: fix comments about vmap_area struct Subsystem: mm/pagealloc Zi Yan <ziy@nvidia.com>: mm: page_alloc: avoid merging non-fallbackable pageblocks with others Peter Collingbourne <pcc@google.com>: mm/mmzone.c: use try_cmpxchg() in page_cpupid_xchg_last() Miaohe Lin <linmiaohe@huawei.com>: mm/mmzone.h: remove unused macros Nicolas Saenz Julienne <nsaenzju@redhat.com>: mm/page_alloc: don't pass pfn to free_unref_page_commit() David Hildenbrand <david@redhat.com>: Patch series "mm: enforce pageblock_order < MAX_ORDER": cma: factor out minimum alignment requirement mm: enforce pageblock_order < MAX_ORDER Nathan Chancellor <nathan@kernel.org>: mm/page_alloc: mark pagesets as __maybe_unused Alistair Popple <apopple@nvidia.com>: mm/pages_alloc.c: don't create ZONE_MOVABLE beyond the end of a node Mel Gorman <mgorman@techsingularity.net>: Patch series "Follow-up on high-order PCP caching", v2: mm/page_alloc: fetch the correct pcp buddy during bulk free mm/page_alloc: track range of active PCP lists during bulk free mm/page_alloc: simplify how many pages are selected per pcp list during bulk free mm/page_alloc: drain the requested list first during bulk free mm/page_alloc: free pages in a single pass during bulk free mm/page_alloc: limit number of high-order pages on PCP during bulk free mm/page_alloc: do not prefetch buddies during bulk free Oscar Salvador <osalvador@suse.de>: arch/x86/mm/numa: Do not initialize nodes twice Suren Baghdasaryan <surenb@google.com>: mm: count time in drain_all_pages during direct reclaim as memory pressure Eric Dumazet <edumazet@google.com>: mm/page_alloc: call check_new_pages() while zone spinlock is not held Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: check high-order pages for corruption during PCP operations Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/memory-failure.c: remove obsolete comment mm/hwpoison: fix error page recovered but reported "not recovered" Rik van Riel <riel@surriel.com>: mm: invalidate hwpoison page cache page in fault path Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few cleanup and fixup patches for memory failure", v3: mm/memory-failure.c: minor clean up for memory_failure_dev_pagemap mm/memory-failure.c: catch unexpected -EFAULT from vma_address() mm/memory-failure.c: rework the signaling logic in kill_proc mm/memory-failure.c: fix race with changing page more robustly mm/memory-failure.c: remove PageSlab check in hwpoison_filter_dev mm/memory-failure.c: rework the try_to_unmap logic in hwpoison_user_mappings() mm/memory-failure.c: remove obsolete comment in __soft_offline_page mm/memory-failure.c: remove unnecessary PageTransTail check mm/hwpoison-inject: support injecting hwpoison to free page luofei <luofei@unicloud.com>: mm/hwpoison: avoid the impact of hwpoison_filter() return value on mce handler mm/hwpoison: add in-use hugepage hwpoison filter judgement Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few fixup patches for memory failure", v2: mm/memory-failure.c: fix race with changing page compound again mm/memory-failure.c: avoid calling invalidate_inode_page() with unexpected pages mm/memory-failure.c: make non-LRU movable pages unhandlable Vlastimil Babka <vbabka@suse.cz>: mm, fault-injection: declare should_fail_alloc_page() Subsystem: mm/mlock Miaohe Lin <linmiaohe@huawei.com>: mm/mlock: fix potential imbalanced rlimit ucounts adjustment Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: Patch series "Free the 2nd vmemmap page associated with each HugeTLB page", v7: mm: hugetlb: free the 2nd vmemmap page associated with each HugeTLB page mm: hugetlb: replace hugetlb_free_vmemmap_enabled with a static_key mm: sparsemem: use page table lock to protect kernel pmd operations selftests: vm: add a hugetlb test case mm: sparsemem: move vmemmap related to HugeTLB to CONFIG_HUGETLB_PAGE_FREE_VMEMMAP Anshuman Khandual <anshuman.khandual@arm.com>: mm/hugetlb: generalize ARCH_WANT_GENERAL_HUGETLB Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: clean up potential spectre issue warnings Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: use helper macro __ATTR_RW David Howells <dhowells@redhat.com>: mm/hugetlb.c: export PageHeadHuge() Miaohe Lin <linmiaohe@huawei.com>: mm: remove unneeded local variable follflags Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: userfaultfd: provide unmasked address on page-fault Guo Zhengkui <guozhengkui@vivo.com>: userfaultfd/selftests: fix uninitialized_var.cocci warning Subsystem: mm/vmscan Hugh Dickins <hughd@google.com>: mm/fs: delete PF_SWAPWRITE mm: __isolate_lru_page_prepare() in isolate_migratepages_block() Waiman Long <longman@redhat.com>: mm/list_lru: optimize memcg_reparent_list_lru_node() Marcelo Tosatti <mtosatti@redhat.com>: mm: lru_cache_disable: replace work queue synchronization with synchronize_rcu Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: workingset: replace IRQ-off check with a lockdep assert. Charan Teja Kalla <quic_charante@quicinc.com>: mm: vmscan: fix documentation for page_check_references() Subsystem: mm/compaction Baolin Wang <baolin.wang@linux.alibaba.com>: mm: compaction: cleanup the compaction trace events Subsystem: mm/mempolicy Hugh Dickins <hughd@google.com>: mempolicy: mbind_range() set_policy() after vma_merge() Subsystem: mm/oom-kill Miaohe Lin <linmiaohe@huawei.com>: mm/oom_kill: remove unneeded is_memcg_oom check Subsystem: mm/migration Huang Ying <ying.huang@intel.com>: mm,migrate: fix establishing demotion target "andrew.yang" <andrew.yang@mediatek.com>: mm/migrate: fix race between lock page and clear PG_Isolated Subsystem: mm/thp Hugh Dickins <hughd@google.com>: mm/thp: refix __split_huge_pmd_locked() for migration PMD Subsystem: mm/cma Hari Bathini <hbathini@linux.ibm.com>: Patch series "powerpc/fadump: handle CMA activation failure appropriately", v3: mm/cma: provide option to opt out from exposing pages on activation failure powerpc/fadump: opt out from freeing pages on cma activation failure Subsystem: mm/autonuma Huang Ying <ying.huang@intel.com>: Patch series "NUMA balancing: optimize memory placement for memory tiering system", v13: NUMA Balancing: add page promotion counter NUMA balancing: optimize page placement for memory tiering system memory tiering: skip to scan fast memory Subsystem: mm/psi Johannes Weiner <hannes@cmpxchg.org>: mm: page_io: fix psi memory pressure error on cold swapins Subsystem: mm/ksm Yang Yang <yang.yang29@zte.com.cn>: mm/vmstat: add event for ksm swapping in copy Miaohe Lin <linmiaohe@huawei.com>: mm/ksm: use helper macro __ATTR_RW Subsystem: mm/page-poison "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/hwpoison: check the subpage, not the head page Subsystem: mm/madvise Miaohe Lin <linmiaohe@huawei.com>: mm/madvise: use vma_lookup() instead of find_vma() Charan Teja Kalla <quic_charante@quicinc.com>: Patch series "mm: madvise: return correct bytes processed with: mm: madvise: return correct bytes advised with process_madvise mm: madvise: skip unmapped vma holes passed to process_madvise Subsystem: mm/memory-hotplug Michal Hocko <mhocko@suse.com>: Patch series "mm, memory_hotplug: handle unitialized numa node gracefully": mm, memory_hotplug: make arch_alloc_nodedata independent on CONFIG_MEMORY_HOTPLUG mm: handle uninitialized numa nodes gracefully mm, memory_hotplug: drop arch_free_nodedata mm, memory_hotplug: reorganize new pgdat initialization mm: make free_area_init_node aware of memory less nodes Wei Yang <richard.weiyang@gmail.com>: memcg: do not tweak node in alloc_mem_cgroup_per_node_info David Hildenbrand <david@redhat.com>: drivers/base/memory: add memory block to memory group after registration succeeded drivers/base/node: consolidate node device subsystem initialization in node_dev_init() Miaohe Lin <linmiaohe@huawei.com>: Patch series "A few cleanup patches around memory_hotplug": mm/memory_hotplug: remove obsolete comment of __add_pages mm/memory_hotplug: avoid calling zone_intersects() for ZONE_NORMAL mm/memory_hotplug: clean up try_offline_node mm/memory_hotplug: fix misplaced comment in offline_pages David Hildenbrand <david@redhat.com>: Patch series "drivers/base/memory: determine and store zone for single-zone memory blocks", v2: drivers/base/node: rename link_mem_sections() to register_memory_block_under_node() drivers/base/memory: determine and store zone for single-zone memory blocks drivers/base/memory: clarify adding and removing of memory blocks Oscar Salvador <osalvador@suse.de>: mm: only re-generate demotion targets when a numa node changes its N_CPU state Subsystem: mm/rmap Hugh Dickins <hughd@google.com>: mm/thp: ClearPageDoubleMap in first page_add_file_rmap() Subsystem: mm/zswap "Maciej S. Szmigiero" <maciej.szmigiero@oracle.com>: mm/zswap.c: allow handling just same-value filled pages Subsystem: mm/uaccess Christophe Leroy <christophe.leroy@csgroup.eu>: mm: remove usercopy_warn() mm: uninline copy_overflow() Randy Dunlap <rdunlap@infradead.org>: mm/usercopy: return 1 from hardened_usercopy __setup() handler Subsystem: mm/ioremap Vlastimil Babka <vbabka@suse.cz>: mm/early_ioremap: declare early_memremap_pgprot_adjust() Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: highmem: document kunmap_local() Miaohe Lin <linmiaohe@huawei.com>: mm/highmem: remove unnecessary done label Subsystem: mm/cleanups "Dr. David Alan Gilbert" <linux@treblig.org>: mm/page_table_check.c: use strtobool for param parsing Subsystem: mm/kfence tangmeng <tangmeng@uniontech.com>: mm/kfence: remove unnecessary CONFIG_KFENCE option Tianchen Ding <dtcccc@linux.alibaba.com>: Patch series "provide the flexibility to enable KFENCE", v3: kfence: allow re-enabling KFENCE after system startup kfence: alloc kfence_pool after system startup Peng Liu <liupeng256@huawei.com>: Patch series "kunit: fix a UAF bug and do some optimization", v2: kunit: fix UAF when run kfence test case test_gfpzero kunit: make kunit_test_timeout compatible with comment kfence: test: try to avoid test_gfpzero trigger rcu_stall Marco Elver <elver@google.com>: kfence: allow use of a deferrable timer Subsystem: mm/hmm Miaohe Lin <linmiaohe@huawei.com>: mm/hmm.c: remove unneeded local variable ret Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "Remove the type-unclear target id concept": mm/damon/dbgfs/init_regions: use target index instead of target id Docs/admin-guide/mm/damon/usage: update for changed initail_regions file input mm/damon/core: move damon_set_targets() into dbgfs mm/damon: remove the target id concept Baolin Wang <baolin.wang@linux.alibaba.com>: mm/damon: remove redundant page validation SeongJae Park <sj@kernel.org>: Patch series "Allow DAMON user code independent of monitoring primitives": mm/damon: rename damon_primitives to damon_operations mm/damon: let monitoring operations can be registered and selected mm/damon/paddr,vaddr: register themselves to DAMON in subsys_initcall mm/damon/reclaim: use damon_select_ops() instead of damon_{v,p}a_set_operations() mm/damon/dbgfs: use damon_select_ops() instead of damon_{v,p}a_set_operations() mm/damon/dbgfs: use operations id for knowing if the target has pid mm/damon/dbgfs-test: fix is_target_id() change mm/damon/paddr,vaddr: remove damon_{p,v}a_{target_valid,set_operations}() tangmeng <tangmeng@uniontech.com>: mm/damon: remove unnecessary CONFIG_DAMON option SeongJae Park <sj@kernel.org>: Patch series "Docs/damon: Update documents for better consistency": Docs/vm/damon: call low level monitoring primitives the operations Docs/vm/damon/design: update DAMON-Idle Page Tracking interference handling Docs/damon: update outdated term 'regions update interval' Patch series "Introduce DAMON sysfs interface", v3: mm/damon/core: allow non-exclusive DAMON start/stop mm/damon/core: add number of each enum type values mm/damon: implement a minimal stub for sysfs-based DAMON interface mm/damon/sysfs: link DAMON for virtual address spaces monitoring mm/damon/sysfs: support the physical address space monitoring mm/damon/sysfs: support DAMON-based Operation Schemes mm/damon/sysfs: support DAMOS quotas mm/damon/sysfs: support schemes prioritization mm/damon/sysfs: support DAMOS watermarks mm/damon/sysfs: support DAMOS stats selftests/damon: add a test for DAMON sysfs interface Docs/admin-guide/mm/damon/usage: document DAMON sysfs interface Docs/ABI/testing: add DAMON sysfs interface ABI document Xin Hao <xhao@linux.alibaba.com>: mm/damon/sysfs: remove repeat container_of() in damon_sysfs_kdamond_release() Documentation/ABI/testing/sysfs-kernel-mm-damon | 274 ++ Documentation/admin-guide/cgroup-v1/memory.rst | 2 Documentation/admin-guide/cgroup-v2.rst | 5 Documentation/admin-guide/kernel-parameters.txt | 2 Documentation/admin-guide/mm/damon/usage.rst | 380 +++ Documentation/admin-guide/mm/zswap.rst | 22 Documentation/admin-guide/sysctl/kernel.rst | 31 Documentation/core-api/mm-api.rst | 19 Documentation/dev-tools/kfence.rst | 12 Documentation/filesystems/porting.rst | 6 Documentation/filesystems/vfs.rst | 16 Documentation/vm/damon/design.rst | 43 Documentation/vm/damon/faq.rst | 2 MAINTAINERS | 1 arch/arm/Kconfig | 4 arch/arm64/kernel/setup.c | 3 arch/arm64/mm/hugetlbpage.c | 1 arch/hexagon/mm/init.c | 2 arch/ia64/kernel/topology.c | 10 arch/ia64/mm/discontig.c | 11 arch/mips/kernel/topology.c | 5 arch/nds32/mm/init.c | 1 arch/openrisc/mm/init.c | 2 arch/powerpc/include/asm/fadump-internal.h | 5 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 4 arch/powerpc/kernel/fadump.c | 8 arch/powerpc/kernel/sysfs.c | 17 arch/riscv/Kconfig | 4 arch/riscv/kernel/setup.c | 3 arch/s390/kernel/numa.c | 7 arch/sh/kernel/topology.c | 5 arch/sparc/kernel/sysfs.c | 12 arch/sparc/mm/hugetlbpage.c | 1 arch/x86/Kconfig | 4 arch/x86/kernel/cpu/mce/core.c | 8 arch/x86/kernel/topology.c | 5 arch/x86/mm/numa.c | 33 block/bdev.c | 2 block/bfq-iosched.c | 2 drivers/base/init.c | 1 drivers/base/memory.c | 149 + drivers/base/node.c | 48 drivers/block/drbd/drbd_int.h | 3 drivers/block/drbd/drbd_req.c | 3 drivers/dax/super.c | 2 drivers/of/of_reserved_mem.c | 9 drivers/tty/tty_io.c | 2 drivers/virtio/virtio_mem.c | 9 fs/9p/vfs_inode.c | 2 fs/adfs/super.c | 2 fs/affs/super.c | 2 fs/afs/super.c | 2 fs/befs/linuxvfs.c | 2 fs/bfs/inode.c | 2 fs/btrfs/inode.c | 2 fs/buffer.c | 8 fs/ceph/addr.c | 22 fs/ceph/inode.c | 2 fs/ceph/super.c | 1 fs/ceph/super.h | 1 fs/cifs/cifsfs.c | 2 fs/coda/inode.c | 2 fs/dcache.c | 3 fs/ecryptfs/super.c | 2 fs/efs/super.c | 2 fs/erofs/super.c | 2 fs/exfat/super.c | 2 fs/ext2/ialloc.c | 5 fs/ext2/super.c | 2 fs/ext4/super.c | 2 fs/f2fs/compress.c | 4 fs/f2fs/data.c | 3 fs/f2fs/f2fs.h | 6 fs/f2fs/segment.c | 8 fs/f2fs/super.c | 14 fs/fat/inode.c | 2 fs/freevxfs/vxfs_super.c | 2 fs/fs-writeback.c | 40 fs/fuse/control.c | 17 fs/fuse/dev.c | 8 fs/fuse/file.c | 17 fs/fuse/inode.c | 2 fs/gfs2/super.c | 2 fs/hfs/super.c | 2 fs/hfsplus/super.c | 2 fs/hostfs/hostfs_kern.c | 2 fs/hpfs/super.c | 2 fs/hugetlbfs/inode.c | 2 fs/inode.c | 2 fs/isofs/inode.c | 2 fs/jffs2/super.c | 2 fs/jfs/super.c | 2 fs/minix/inode.c | 2 fs/namespace.c | 2 fs/nfs/inode.c | 2 fs/nfs/write.c | 14 fs/nilfs2/segbuf.c | 16 fs/nilfs2/super.c | 2 fs/ntfs/inode.c | 6 fs/ntfs3/super.c | 2 fs/ocfs2/alloc.c | 2 fs/ocfs2/aops.c | 2 fs/ocfs2/cluster/nodemanager.c | 2 fs/ocfs2/dir.c | 4 fs/ocfs2/dlmfs/dlmfs.c | 2 fs/ocfs2/file.c | 13 fs/ocfs2/inode.c | 2 fs/ocfs2/localalloc.c | 6 fs/ocfs2/namei.c | 2 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/quota_global.c | 2 fs/ocfs2/stack_user.c | 18 fs/ocfs2/super.c | 2 fs/ocfs2/xattr.c | 2 fs/openpromfs/inode.c | 2 fs/orangefs/super.c | 2 fs/overlayfs/super.c | 2 fs/proc/inode.c | 2 fs/qnx4/inode.c | 2 fs/qnx6/inode.c | 2 fs/reiserfs/super.c | 2 fs/romfs/super.c | 2 fs/squashfs/super.c | 2 fs/sysv/inode.c | 2 fs/ubifs/super.c | 2 fs/udf/super.c | 2 fs/ufs/super.c | 2 fs/userfaultfd.c | 5 fs/vboxsf/super.c | 2 fs/xfs/libxfs/xfs_btree.c | 2 fs/xfs/xfs_buf.c | 3 fs/xfs/xfs_icache.c | 2 fs/zonefs/super.c | 2 include/linux/backing-dev-defs.h | 8 include/linux/backing-dev.h | 50 include/linux/cma.h | 14 include/linux/damon.h | 95 include/linux/fault-inject.h | 2 include/linux/fs.h | 21 include/linux/gfp.h | 10 include/linux/highmem-internal.h | 10 include/linux/hugetlb.h | 8 include/linux/kthread.h | 22 include/linux/list_lru.h | 45 include/linux/memcontrol.h | 46 include/linux/memory.h | 12 include/linux/memory_hotplug.h | 132 - include/linux/migrate.h | 8 include/linux/mm.h | 11 include/linux/mmzone.h | 22 include/linux/nfs_fs_sb.h | 1 include/linux/node.h | 25 include/linux/page-flags.h | 96 include/linux/pageblock-flags.h | 7 include/linux/pagemap.h | 7 include/linux/sched.h | 1 include/linux/sched/sysctl.h | 10 include/linux/shmem_fs.h | 1 include/linux/slab.h | 3 include/linux/swap.h | 6 include/linux/thread_info.h | 5 include/linux/uaccess.h | 2 include/linux/vm_event_item.h | 3 include/linux/vmalloc.h | 4 include/linux/xarray.h | 9 include/ras/ras_event.h | 1 include/trace/events/compaction.h | 26 include/trace/events/writeback.h | 28 include/uapi/linux/userfaultfd.h | 8 ipc/mqueue.c | 2 kernel/dma/contiguous.c | 4 kernel/sched/core.c | 21 kernel/sysctl.c | 2 lib/Kconfig.kfence | 12 lib/kunit/try-catch.c | 3 lib/xarray.c | 10 mm/Kconfig | 6 mm/backing-dev.c | 57 mm/cma.c | 31 mm/cma.h | 1 mm/compaction.c | 60 mm/damon/Kconfig | 19 mm/damon/Makefile | 7 mm/damon/core-test.h | 23 mm/damon/core.c | 190 + mm/damon/dbgfs-test.h | 103 mm/damon/dbgfs.c | 264 +- mm/damon/ops-common.c | 133 + mm/damon/ops-common.h | 16 mm/damon/paddr.c | 62 mm/damon/prmtv-common.c | 133 - mm/damon/prmtv-common.h | 16 mm/damon/reclaim.c | 11 mm/damon/sysfs.c | 2632 ++++++++++++++++++++++- mm/damon/vaddr-test.h | 8 mm/damon/vaddr.c | 67 mm/early_ioremap.c | 1 mm/fadvise.c | 5 mm/filemap.c | 17 mm/gup.c | 103 mm/highmem.c | 9 mm/hmm.c | 3 mm/huge_memory.c | 41 mm/hugetlb.c | 23 mm/hugetlb_vmemmap.c | 74 mm/hwpoison-inject.c | 7 mm/internal.h | 19 mm/kfence/Makefile | 2 mm/kfence/core.c | 147 + mm/kfence/kfence_test.c | 3 mm/ksm.c | 6 mm/list_lru.c | 690 ++---- mm/maccess.c | 6 mm/madvise.c | 18 mm/memcontrol.c | 549 ++-- mm/memory-failure.c | 148 - mm/memory.c | 116 - mm/memory_hotplug.c | 136 - mm/mempolicy.c | 29 mm/memremap.c | 3 mm/migrate.c | 128 - mm/mlock.c | 1 mm/mmap.c | 5 mm/mmzone.c | 7 mm/mprotect.c | 13 mm/mremap.c | 4 mm/oom_kill.c | 3 mm/page-writeback.c | 12 mm/page_alloc.c | 429 +-- mm/page_io.c | 7 mm/page_table_check.c | 10 mm/ptdump.c | 16 mm/readahead.c | 124 + mm/rmap.c | 15 mm/shmem.c | 46 mm/slab.c | 39 mm/slab.h | 25 mm/slob.c | 6 mm/slub.c | 42 mm/sparse-vmemmap.c | 70 mm/sparse.c | 2 mm/swap.c | 25 mm/swapfile.c | 1 mm/usercopy.c | 16 mm/userfaultfd.c | 3 mm/vmalloc.c | 102 mm/vmscan.c | 138 - mm/vmstat.c | 19 mm/workingset.c | 7 mm/zswap.c | 15 net/socket.c | 2 net/sunrpc/rpc_pipe.c | 2 scripts/spelling.txt | 16 tools/testing/selftests/cgroup/cgroup_util.c | 15 tools/testing/selftests/cgroup/cgroup_util.h | 1 tools/testing/selftests/cgroup/test_memcontrol.c | 78 tools/testing/selftests/damon/Makefile | 1 tools/testing/selftests/damon/sysfs.sh | 306 ++ tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 7 tools/testing/selftests/vm/hugepage-vmemmap.c | 144 + tools/testing/selftests/vm/run_vmtests.sh | 11 tools/testing/selftests/vm/userfaultfd.c | 2 tools/testing/selftests/x86/Makefile | 6 264 files changed, 7205 insertions(+), 3090 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-03-16 23:14 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-03-16 23:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 4 patches, based on 56e337f2cf1326323844927a04e9dbce9a244835. Subsystems affected by this patch series: mm/swap kconfig ocfs2 selftests Subsystem: mm/swap Guo Ziliang <guo.ziliang@zte.com.cn>: mm: swap: get rid of deadloop in swapin readahead Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs/debug: restore DEBUG_INFO=y for overriding Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: fix crash when initialize filecheck kobj fails Subsystem: selftests Yosry Ahmed <yosryahmed@google.com>: selftests: vm: fix clang build error multiple output files fs/ocfs2/super.c | 22 +++++++++++----------- kernel/configs/debug.config | 1 + mm/swap_state.c | 2 +- tools/testing/selftests/vm/Makefile | 6 ++---- 4 files changed, 15 insertions(+), 16 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-03-05 4:28 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-03-05 4:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 8 patches, based on 07ebd38a0da24d2534da57b4841346379db9f354. Subsystems affected by this patch series: mm/hugetlb mm/pagemap memfd selftests mm/userfaultfd kconfig Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: selftests/vm: cleanup hugetlb file after mremap test Subsystem: mm/pagemap Suren Baghdasaryan <surenb@google.com>: mm: refactor vm_area_struct::anon_vma_name usage code mm: prevent vm_area_struct::anon_name refcount saturation mm: fix use-after-free when anon vma name is used after vma is freed Subsystem: memfd Hugh Dickins <hughd@google.com>: memfd: fix F_SEAL_WRITE after shmem huge page allocated Subsystem: selftests Chengming Zhou <zhouchengming@bytedance.com>: kselftest/vm: fix tests build with old libc Subsystem: mm/userfaultfd Yun Zhou <yun.zhou@windriver.com>: proc: fix documentation and description of pagemap Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs/debug: set CONFIG_DEBUG_INFO=y properly Documentation/admin-guide/mm/pagemap.rst | 2 fs/proc/task_mmu.c | 9 +- fs/userfaultfd.c | 6 - include/linux/mm.h | 7 + include/linux/mm_inline.h | 105 ++++++++++++++++++--------- include/linux/mm_types.h | 5 + kernel/configs/debug.config | 2 kernel/fork.c | 4 - kernel/sys.c | 19 +++- mm/madvise.c | 98 +++++++++---------------- mm/memfd.c | 40 +++++++--- mm/mempolicy.c | 2 mm/mlock.c | 2 mm/mmap.c | 12 +-- mm/mprotect.c | 2 tools/testing/selftests/vm/hugepage-mremap.c | 26 ++++-- tools/testing/selftests/vm/run_vmtests.sh | 3 tools/testing/selftests/vm/userfaultfd.c | 1 18 files changed, 201 insertions(+), 144 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-02-26 3:10 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-02-26 3:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches 12 patches, based on c47658311d60be064b839f329c0e4d34f5f0735b. Subsystems affected by this patch series: MAINTAINERS mm/hugetlb mm/kasan mm/hugetlbfs mm/pagemap mm/selftests mm/memcg m/slab mailmap memfd Subsystem: MAINTAINERS Luis Chamberlain <mcgrof@kernel.org>: MAINTAINERS: add sysctl-next git tree Subsystem: mm/hugetlb "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/hugetlb: fix kernel crash with hugetlb mremap Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: test: prevent cache merging in kmem_cache_double_destroy Subsystem: mm/hugetlbfs Liu Yuntao <liuyuntao10@huawei.com>: hugetlbfs: fix a truncation issue in hugepages parameter Subsystem: mm/pagemap Suren Baghdasaryan <surenb@google.com>: mm: fix use-after-free bug when mm->mmap is reused after being freed Subsystem: mm/selftests "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: fix map_fixed_noreplace test failure Subsystem: mm/memcg Roman Gushchin <roman.gushchin@linux.dev>: MAINTAINERS: add Roman as a memcg co-maintainer Vladimir Davydov <vdavydov.dev@gmail.com>: MAINTAINERS: remove Vladimir from memcg maintainers Shakeel Butt <shakeelb@google.com>: MAINTAINERS: add Shakeel as a memcg co-maintainer Subsystem: m/slab Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS, SLAB: add Roman as reviewer, git tree Subsystem: mailmap Roman Gushchin <roman.gushchin@linux.dev>: mailmap: update Roman Gushchin's email Subsystem: memfd Mike Kravetz <mike.kravetz@oracle.com>: selftests/memfd: clean up mapping in mfd_fail_write .mailmap | 3 + MAINTAINERS | 6 ++ lib/test_kasan.c | 5 +- mm/hugetlb.c | 11 ++--- mm/mmap.c | 1 tools/testing/selftests/memfd/memfd_test.c | 1 tools/testing/selftests/vm/map_fixed_noreplace.c | 49 +++++++++++++++++------ 7 files changed, 56 insertions(+), 20 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-02-12 0:27 Andrew Morton 2022-02-12 2:02 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2022-02-12 0:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. Subsystems affected by this patch series: binfmt procfs mm/vmscan mm/memcg mm/kfence Subsystem: binfmt Mike Rapoport <rppt@linux.ibm.com>: fs/binfmt_elf: fix PT_LOAD p_align values for loaders Subsystem: procfs Yang Shi <shy828301@gmail.com>: fs/proc: task_mmu.c: don't read mapcount for migration entry Subsystem: mm/vmscan Mel Gorman <mgorman@suse.de>: mm: vmscan: remove deadlock due to throttling failing to make progress Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg: synchronize objcg lists with a dedicated spinlock Subsystem: mm/kfence Peng Liu <liupeng256@huawei.com>: kfence: make test case compatible with run time set sample interval fs/binfmt_elf.c | 2 +- fs/proc/task_mmu.c | 40 +++++++++++++++++++++++++++++++--------- include/linux/kfence.h | 2 ++ include/linux/memcontrol.h | 5 +++-- mm/kfence/core.c | 3 ++- mm/kfence/kfence_test.c | 8 ++++---- mm/memcontrol.c | 10 +++++----- mm/vmscan.c | 4 +++- 8 files changed, 51 insertions(+), 23 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2022-02-12 0:27 incoming Andrew Morton @ 2022-02-12 2:02 ` Linus Torvalds 2022-02-12 5:24 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2022-02-12 2:02 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits, patches On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. So this *completely* flummoxed 'b4', because you first sent the wrong series, and then sent the right one in the same thread. I fetched the emails manually, but honestly, this was confusing even then, with two "[PATCH x/5]" series where the only way to tell the right one was basically by date of email. They did arrive in the same order in my mailbox, but even that wouldn't have been guaranteed if there had been some mailer delays somewhere.. So next time when you mess up, resend it all as a completely new series and completely new threading - so with a new header email too. Please? And since I'm here, let me just verify that yes, the series you actually want me to apply is this one (as described by the head email): Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values .. Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f.. Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl.. Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a .. Subject: [patch 5/5] kfence: make test case compatible with run.. and not the other one with GUP patches? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2022-02-12 2:02 ` incoming Linus Torvalds @ 2022-02-12 5:24 ` Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-02-12 5:24 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits, patches On Fri, 11 Feb 2022 18:02:53 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43. > > So this *completely* flummoxed 'b4', because you first sent the wrong > series, and then sent the right one in the same thread. > > I fetched the emails manually, but honestly, this was confusing even > then, with two "[PATCH x/5]" series where the only way to tell the > right one was basically by date of email. They did arrive in the same > order in my mailbox, but even that wouldn't have been guaranteed if > there had been some mailer delays somewhere.. Yes, I wondered. Sorry bout that. > So next time when you mess up, resend it all as a completely new > series and completely new threading - so with a new header email too. > Please? Wilco. > And since I'm here, let me just verify that yes, the series you > actually want me to apply is this one (as described by the head > email): > > Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values .. > Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f.. > Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl.. > Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a .. > Subject: [patch 5/5] kfence: make test case compatible with run.. > > and not the other one with GUP patches? Those are the ones. Five fixes, three with cc:stable. ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-02-04 4:48 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-02-04 4:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on 1f2cfdd349b7647f438c1e552dc1b983da86d830. Subsystems affected by this patch series: mm/vmscan mm/debug mm/pagemap ipc mm/kmemleak MAINTAINERS mm/selftests Subsystem: mm/vmscan Chen Wandun <chenwandun@huawei.com>: Revert "mm/page_isolation: unset migratetype directly for non Buddy page" Subsystem: mm/debug Pasha Tatashin <pasha.tatashin@soleen.com>: Patch series "page table check fixes and cleanups", v5: mm/debug_vm_pgtable: remove pte entry from the page table mm/page_table_check: use unsigned long for page counters and cleanup mm/khugepaged: unify collapse pmd clear, flush and free mm/page_table_check: check entries at pmd levels Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: mm/pgtable: define pte_index so that preprocessor could recognize it Subsystem: ipc Minghao Chi <chi.minghao@zte.com.cn>: ipc/sem: do not sleep with a spin lock held Subsystem: mm/kmemleak Lang Yu <lang.yu@amd.com>: mm/kmemleak: avoid scanning potential huge holes Subsystem: MAINTAINERS Mike Rapoport <rppt@linux.ibm.com>: MAINTAINERS: update rppt's email Subsystem: mm/selftests Shuah Khan <skhan@linuxfoundation.org>: kselftest/vm: revert "tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner" MAINTAINERS | 2 - include/linux/page_table_check.h | 19 ++++++++++ include/linux/pgtable.h | 1 ipc/sem.c | 4 +- mm/debug_vm_pgtable.c | 2 + mm/khugepaged.c | 37 +++++++++++--------- mm/kmemleak.c | 13 +++---- mm/page_isolation.c | 2 - mm/page_table_check.c | 55 +++++++++++++++---------------- tools/testing/selftests/vm/userfaultfd.c | 11 ++++-- 10 files changed, 89 insertions(+), 57 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-01-29 21:40 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-01-29 21:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 12 patches, based on f8c7e4ede46fe63ff10000669652648aab09d112. Subsystems affected by this patch series: sysctl binfmt ia64 mm/memory-failure mm/folios selftests mm/kasan mm/psi ocfs2 Subsystem: sysctl Andrew Morton <akpm@linux-foundation.org>: include/linux/sysctl.h: fix register_sysctl_mount_point() return type Subsystem: binfmt Tong Zhang <ztong0001@gmail.com>: binfmt_misc: fix crash when load/unload module Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: make IA64_MCA_RECOVERY bool instead of tristate Subsystem: mm/memory-failure Joao Martins <joao.m.martins@oracle.com>: memory-failure: fetch compound_head after pgmap_pfn_valid() Subsystem: mm/folios Wei Yang <richard.weiyang@gmail.com>: mm: page->mapping folio->mapping should have the same offset Subsystem: selftests Maor Gottlieb <maorg@nvidia.com>: tools/testing/scatterlist: add missing defines Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: fix compatibility with FORTIFY_SOURCE Peter Collingbourne <pcc@google.com>: mm, kasan: use compare-exchange operation to set KASAN page tag Subsystem: mm/psi Suren Baghdasaryan <surenb@google.com>: psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: Patch series "ocfs2: fix a deadlock case": jbd2: export jbd2_journal_[grab|put]_journal_head ocfs2: fix a deadlock when commit trans arch/ia64/Kconfig | 2 fs/binfmt_misc.c | 8 +-- fs/jbd2/journal.c | 2 fs/ocfs2/suballoc.c | 25 ++++------- include/linux/mm.h | 17 +++++-- include/linux/mm_types.h | 1 include/linux/psi.h | 11 ++-- include/linux/sysctl.h | 2 kernel/sched/psi.c | 79 ++++++++++++++++++----------------- lib/test_kasan.c | 5 ++ mm/memory-failure.c | 6 ++ tools/testing/scatterlist/linux/mm.h | 3 - 12 files changed, 91 insertions(+), 70 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-01-29 2:13 Andrew Morton 2022-01-29 4:25 ` incoming Matthew Wilcox 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2022-01-29 2:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. Subsystems affected by this patch series: sysctl binfmt ia64 mm/memory-failure mm/folios selftests mm/kasan mm/psi ocfs2 Subsystem: sysctl Andrew Morton <akpm@linux-foundation.org>: include/linux/sysctl.h: fix register_sysctl_mount_point() return type Subsystem: binfmt Tong Zhang <ztong0001@gmail.com>: binfmt_misc: fix crash when load/unload module Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: make IA64_MCA_RECOVERY bool instead of tristate Subsystem: mm/memory-failure Joao Martins <joao.m.martins@oracle.com>: memory-failure: fetch compound_head after pgmap_pfn_valid() Subsystem: mm/folios Wei Yang <richard.weiyang@gmail.com>: mm: page->mapping folio->mapping should have the same offset Subsystem: selftests Maor Gottlieb <maorg@nvidia.com>: tools/testing/scatterlist: add missing defines Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: fix compatibility with FORTIFY_SOURCE Peter Collingbourne <pcc@google.com>: mm, kasan: use compare-exchange operation to set KASAN page tag Subsystem: mm/psi Suren Baghdasaryan <surenb@google.com>: psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: Patch series "ocfs2: fix a deadlock case": jbd2: export jbd2_journal_[grab|put]_journal_head ocfs2: fix a deadlock when commit trans arch/ia64/Kconfig | 2 fs/binfmt_misc.c | 8 +-- fs/jbd2/journal.c | 2 fs/ocfs2/suballoc.c | 25 ++++------- include/linux/mm.h | 17 +++++-- include/linux/mm_types.h | 1 include/linux/psi.h | 11 ++-- include/linux/sysctl.h | 2 kernel/sched/psi.c | 79 ++++++++++++++++++----------------- lib/test_kasan.c | 5 ++ mm/memory-failure.c | 6 ++ tools/testing/scatterlist/linux/mm.h | 3 - 12 files changed, 91 insertions(+), 70 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2022-01-29 2:13 incoming Andrew Morton @ 2022-01-29 4:25 ` Matthew Wilcox 2022-01-29 6:23 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Matthew Wilcox @ 2022-01-29 4:25 UTC (permalink / raw) To: Andrew Morton; +Cc: Linus Torvalds, mm-commits, linux-mm On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote: > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. ^^ I see 7? ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2022-01-29 4:25 ` incoming Matthew Wilcox @ 2022-01-29 6:23 ` Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-01-29 6:23 UTC (permalink / raw) To: Matthew Wilcox; +Cc: Linus Torvalds, mm-commits, linux-mm On Sat, 29 Jan 2022 04:25:33 +0000 Matthew Wilcox <willy@infradead.org> wrote: > On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote: > > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f. > ^^ > > I see 7? Crap, sorry, ignore all this, shall redo tomorrow. (It wasn't a good day over here. The thing with disk drives is that the bigger they are, the harder they fall). ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-01-22 6:10 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-01-22 6:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the post-linux-next queue. Material which was based on or dependent upon material which was in -next. 69 patches, based on 9b57f458985742bd1c585f4c7f36d04634ce1143. Subsystems affected by this patch series: mm/migration sysctl mm/zsmalloc proc lib Subsystem: mm/migration Alistair Popple <apopple@nvidia.com>: mm/migrate.c: rework migration_entry_wait() to not take a pageref Subsystem: sysctl Xiaoming Ni <nixiaoming@huawei.com>: Patch series "sysctl: first set of kernel/sysctl cleanups", v2: sysctl: add a new register_sysctl_init() interface sysctl: move some boundary constants from sysctl.c to sysctl_vals hung_task: move hung_task sysctl interface to hung_task.c watchdog: move watchdog sysctl interface to watchdog.c Stephen Kitt <steve@sk2.org>: sysctl: make ngroups_max const Xiaoming Ni <nixiaoming@huawei.com>: sysctl: use const for typically used max/min proc sysctls sysctl: use SYSCTL_ZERO to replace some static int zero uses aio: move aio sysctl to aio.c dnotify: move dnotify sysctl to dnotify.c Luis Chamberlain <mcgrof@kernel.org>: Patch series "sysctl: second set of kernel/sysctl cleanups", v2: hpet: simplify subdirectory registration with register_sysctl() i915: simplify subdirectory registration with register_sysctl() macintosh/mac_hid.c: simplify subdirectory registration with register_sysctl() ocfs2: simplify subdirectory registration with register_sysctl() test_sysctl: simplify subdirectory registration with register_sysctl() Xiaoming Ni <nixiaoming@huawei.com>: inotify: simplify subdirectory registration with register_sysctl() Luis Chamberlain <mcgrof@kernel.org>: cdrom: simplify subdirectory registration with register_sysctl() Xiaoming Ni <nixiaoming@huawei.com>: eventpoll: simplify sysctl declaration with register_sysctl() Patch series "sysctl: 3rd set of kernel/sysctl cleanups", v2: firmware_loader: move firmware sysctl to its own files random: move the random sysctl declarations to its own file Luis Chamberlain <mcgrof@kernel.org>: sysctl: add helper to register a sysctl mount point fs: move binfmt_misc sysctl to its own file Xiaoming Ni <nixiaoming@huawei.com>: printk: move printk sysctl to printk/sysctl.c scsi/sg: move sg-big-buff sysctl to scsi/sg.c stackleak: move stack_erasing sysctl to stackleak.c Luis Chamberlain <mcgrof@kernel.org>: sysctl: share unsigned long const values Patch series "sysctl: 4th set of kernel/sysctl cleanups": fs: move inode sysctls to its own file fs: move fs stat sysctls to file_table.c fs: move dcache sysctls to its own file sysctl: move maxolduid as a sysctl specific const fs: move shared sysctls to fs/sysctls.c fs: move locking sysctls where they are used fs: move namei sysctls to its own file fs: move fs/exec.c sysctls into its own file fs: move pipe sysctls to is own file Patch series "sysctl: add and use base directory declarer and registration helper": sysctl: add and use base directory declarer and registration helper fs: move namespace sysctls and declare fs base directory kernel/sysctl.c: rename sysctl_init() to sysctl_init_bases() Xiaoming Ni <nixiaoming@huawei.com>: printk: fix build warning when CONFIG_PRINTK=n fs/coredump: move coredump sysctls into its own file kprobe: move sysctl_kprobes_optimization to kprobes.c Colin Ian King <colin.i.king@gmail.com>: kernel/sysctl.c: remove unused variable ten_thousand Baokun Li <libaokun1@huawei.com>: sysctl: returns -EINVAL when a negative value is passed to proc_doulongvec_minmax Subsystem: mm/zsmalloc Minchan Kim <minchan@kernel.org>: Patch series "zsmalloc: remove bit_spin_lock", v2: zsmalloc: introduce some helper functions zsmalloc: rename zs_stat_type to class_stat_type zsmalloc: decouple class actions from zspage works zsmalloc: introduce obj_allocated zsmalloc: move huge compressed obj from page to zspage zsmalloc: remove zspage isolation for migration locking/rwlocks: introduce write_lock_nested zsmalloc: replace per zpage lock with pool->migrate_lock Mike Galbraith <umgwanakikbuti@gmail.com>: zsmalloc: replace get_cpu_var with local_lock Subsystem: proc Muchun Song <songmuchun@bytedance.com>: fs: proc: store PDE()->data into inode->i_private proc: remove PDE_DATA() completely Subsystem: lib Vlastimil Babka <vbabka@suse.cz>: lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() lib/stackdepot: fix spelling mistake and grammar in pr_err message lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup3 lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup4 Marco Elver <elver@google.com>: lib/stackdepot: always do filter_irq_stacks() in stack_depot_save() Christoph Hellwig <hch@lst.de>: Patch series "remove Xen tmem leftovers": mm: remove cleancache frontswap: remove frontswap_writethrough frontswap: remove frontswap_tmem_exclusive_gets frontswap: remove frontswap_shrink frontswap: remove frontswap_curr_pages frontswap: simplify frontswap_init frontswap: remove the frontswap exports mm: simplify try_to_unuse frontswap: remove frontswap_test frontswap: simplify frontswap_register_ops mm: mark swap_lock and swap_active_head static frontswap: remove support for multiple ops mm: hide the FRONTSWAP Kconfig symbol Documentation/vm/cleancache.rst | 296 ------ Documentation/vm/frontswap.rst | 31 Documentation/vm/index.rst | 1 MAINTAINERS | 7 arch/alpha/kernel/srm_env.c | 4 arch/arm/configs/bcm2835_defconfig | 1 arch/arm/configs/qcom_defconfig | 1 arch/arm/kernel/atags_proc.c | 2 arch/arm/mm/alignment.c | 2 arch/ia64/kernel/salinfo.c | 10 arch/m68k/configs/amiga_defconfig | 1 arch/m68k/configs/apollo_defconfig | 1 arch/m68k/configs/atari_defconfig | 1 arch/m68k/configs/bvme6000_defconfig | 1 arch/m68k/configs/hp300_defconfig | 1 arch/m68k/configs/mac_defconfig | 1 arch/m68k/configs/multi_defconfig | 1 arch/m68k/configs/mvme147_defconfig | 1 arch/m68k/configs/mvme16x_defconfig | 1 arch/m68k/configs/q40_defconfig | 1 arch/m68k/configs/sun3_defconfig | 1 arch/m68k/configs/sun3x_defconfig | 1 arch/powerpc/kernel/proc_powerpc.c | 4 arch/s390/configs/debug_defconfig | 1 arch/s390/configs/defconfig | 1 arch/sh/mm/alignment.c | 4 arch/xtensa/platforms/iss/simdisk.c | 4 block/bdev.c | 5 drivers/acpi/proc.c | 2 drivers/base/firmware_loader/fallback.c | 7 drivers/base/firmware_loader/fallback.h | 11 drivers/base/firmware_loader/fallback_table.c | 25 drivers/cdrom/cdrom.c | 23 drivers/char/hpet.c | 22 drivers/char/random.c | 14 drivers/gpu/drm/drm_dp_mst_topology.c | 1 drivers/gpu/drm/drm_mm.c | 4 drivers/gpu/drm/drm_modeset_lock.c | 9 drivers/gpu/drm/i915/i915_perf.c | 22 drivers/gpu/drm/i915/intel_runtime_pm.c | 3 drivers/hwmon/dell-smm-hwmon.c | 4 drivers/macintosh/mac_hid.c | 24 drivers/net/bonding/bond_procfs.c | 8 drivers/net/wireless/cisco/airo.c | 22 drivers/net/wireless/intersil/hostap/hostap_ap.c | 16 drivers/net/wireless/intersil/hostap/hostap_download.c | 2 drivers/net/wireless/intersil/hostap/hostap_proc.c | 24 drivers/net/wireless/ray_cs.c | 2 drivers/nubus/proc.c | 36 drivers/parisc/led.c | 4 drivers/pci/proc.c | 10 drivers/platform/x86/thinkpad_acpi.c | 4 drivers/platform/x86/toshiba_acpi.c | 16 drivers/pnp/isapnp/proc.c | 2 drivers/pnp/pnpbios/proc.c | 4 drivers/scsi/scsi_proc.c | 4 drivers/scsi/sg.c | 35 drivers/usb/gadget/function/rndis.c | 4 drivers/zorro/proc.c | 2 fs/Makefile | 4 fs/afs/proc.c | 6 fs/aio.c | 31 fs/binfmt_misc.c | 6 fs/btrfs/extent_io.c | 10 fs/btrfs/super.c | 2 fs/coredump.c | 66 + fs/dcache.c | 37 fs/eventpoll.c | 10 fs/exec.c | 145 +-- fs/ext4/mballoc.c | 14 fs/ext4/readpage.c | 6 fs/ext4/super.c | 3 fs/f2fs/data.c | 13 fs/file_table.c | 47 - fs/inode.c | 39 fs/jbd2/journal.c | 2 fs/locks.c | 34 fs/mpage.c | 7 fs/namei.c | 58 + fs/namespace.c | 24 fs/notify/dnotify/dnotify.c | 21 fs/notify/fanotify/fanotify_user.c | 10 fs/notify/inotify/inotify_user.c | 11 fs/ntfs3/ntfs_fs.h | 1 fs/ocfs2/stackglue.c | 25 fs/ocfs2/super.c | 2 fs/pipe.c | 64 + fs/proc/generic.c | 6 fs/proc/inode.c | 1 fs/proc/internal.h | 5 fs/proc/proc_net.c | 8 fs/proc/proc_sysctl.c | 67 + fs/super.c | 3 fs/sysctls.c | 47 - include/linux/aio.h | 4 include/linux/cleancache.h | 124 -- include/linux/coredump.h | 10 include/linux/dcache.h | 10 include/linux/dnotify.h | 1 include/linux/fanotify.h | 2 include/linux/frontswap.h | 35 include/linux/fs.h | 18 include/linux/inotify.h | 3 include/linux/kprobes.h | 6 include/linux/migrate.h | 2 include/linux/mount.h | 3 include/linux/pipe_fs_i.h | 4 include/linux/poll.h | 2 include/linux/printk.h | 4 include/linux/proc_fs.h | 17 include/linux/ref_tracker.h | 2 include/linux/rwlock.h | 6 include/linux/rwlock_api_smp.h | 8 include/linux/rwlock_rt.h | 10 include/linux/sched/sysctl.h | 14 include/linux/seq_file.h | 2 include/linux/shmem_fs.h | 3 include/linux/spinlock_api_up.h | 1 include/linux/stackdepot.h | 25 include/linux/stackleak.h | 5 include/linux/swapfile.h | 3 include/linux/sysctl.h | 67 + include/scsi/sg.h | 4 init/main.c | 9 ipc/util.c | 2 kernel/hung_task.c | 81 + kernel/irq/proc.c | 8 kernel/kprobes.c | 30 kernel/locking/spinlock.c | 10 kernel/locking/spinlock_rt.c | 12 kernel/printk/Makefile | 5 kernel/printk/internal.h | 8 kernel/printk/printk.c | 4 kernel/printk/sysctl.c | 85 + kernel/resource.c | 4 kernel/stackleak.c | 26 kernel/sysctl.c | 790 +---------------- kernel/watchdog.c | 101 ++ lib/Kconfig | 4 lib/Kconfig.kasan | 2 lib/stackdepot.c | 46 lib/test_sysctl.c | 22 mm/Kconfig | 40 mm/Makefile | 1 mm/cleancache.c | 315 ------ mm/filemap.c | 102 +- mm/frontswap.c | 259 ----- mm/kasan/common.c | 1 mm/migrate.c | 38 mm/page_owner.c | 2 mm/shmem.c | 33 mm/swapfile.c | 90 - mm/truncate.c | 15 mm/zsmalloc.c | 557 ++++------- mm/zswap.c | 8 net/atm/proc.c | 4 net/bluetooth/af_bluetooth.c | 8 net/can/bcm.c | 2 net/can/proc.c | 2 net/core/neighbour.c | 6 net/core/pktgen.c | 6 net/ipv4/netfilter/ipt_CLUSTERIP.c | 6 net/ipv4/raw.c | 8 net/ipv4/tcp_ipv4.c | 2 net/ipv4/udp.c | 6 net/netfilter/x_tables.c | 10 net/netfilter/xt_hashlimit.c | 18 net/netfilter/xt_recent.c | 4 net/sunrpc/auth_gss/svcauth_gss.c | 4 net/sunrpc/cache.c | 24 net/sunrpc/stats.c | 2 sound/core/info.c | 4 172 files changed, 1877 insertions(+), 2931 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-01-20 2:07 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-01-20 2:07 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 55 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16") Subsystems affected by this patch series: percpu procfs sysctl misc core-kernel get_maintainer lib checkpatch binfmt nilfs2 hfs fat adfs panic delayacct kconfig kcov ubsan Subsystem: percpu Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "mm: percpu: Cleanup percpu first chunk function": mm: percpu: generalize percpu related config mm: percpu: add pcpu_fc_cpu_to_node_fn_t typedef mm: percpu: add generic pcpu_fc_alloc/free funciton mm: percpu: add generic pcpu_populate_pte() function Subsystem: procfs David Hildenbrand <david@redhat.com>: proc/vmcore: don't fake reading zeroes on surprise vmcore_cb unregistration Hans de Goede <hdegoede@redhat.com>: proc: make the proc_create[_data]() stubs static inlines Qi Zheng <zhengqi.arch@bytedance.com>: proc: convert the return type of proc_fd_access_allowed() to be boolean Subsystem: sysctl Geert Uytterhoeven <geert+renesas@glider.be>: sysctl: fix duplicate path separator in printed entries luo penghao <luo.penghao@zte.com.cn>: sysctl: remove redundant ret assignment Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/unaligned: replace kernel.h with the necessary inclusions kernel.h: include a note to discourage people from including it in headers Subsystem: core-kernel Yafang Shao <laoar.shao@gmail.com>: Patch series "task comm cleanups", v2: fs/exec: replace strlcpy with strscpy_pad in __set_task_comm fs/exec: replace strncpy with strscpy_pad in __get_task_comm drivers/infiniband: replace open-coded string copy with get_task_comm fs/binfmt_elf: replace open-coded string copy with get_task_comm samples/bpf/test_overhead_kprobe_kern: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm tools/bpf/bpftool/skeleton: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm tools/testing/selftests/bpf: replace open-coded 16 with TASK_COMM_LEN kthread: dynamically allocate memory to store kthread's full name Davidlohr Bueso <dave@stgolabs.net>: kernel/sys.c: only take tasklist_lock for get/setpriority(PRIO_PGRP) Subsystem: get_maintainer Randy Dunlap <rdunlap@infradead.org>: get_maintainer: don't remind about no git repo when --nogit is used Subsystem: lib Alexey Dobriyan <adobriyan@gmail.com>: kstrtox: uninline everything Andy Shevchenko <andriy.shevchenko@linux.intel.com>: list: introduce list_is_head() helper and re-use it in list.h Zhen Lei <thunder.leizhen@huawei.com>: lib/list_debug.c: print more list debugging context in __list_del_entry_valid() Isabella Basso <isabbasso@riseup.net>: Patch series "test_hash.c: refactor into KUnit", v3: hash.h: remove unused define directive test_hash.c: split test_int_hash into arch-specific functions test_hash.c: split test_hash_init lib/Kconfig.debug: properly split hash test kernel entries test_hash.c: refactor into kunit Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kunit: replace kernel.h with the necessary inclusions uuid: discourage people from using UAPI header in new code uuid: remove licence boilerplate text from the header Andrey Konovalov <andreyknvl@google.com>: lib/test_meminit: destroy cache in kmem_cache_alloc_bulk() test Subsystem: checkpatch Jerome Forissier <jerome@forissier.org>: checkpatch: relax regexp for COMMIT_LOG_LONG_LINE Joe Perches <joe@perches.com>: checkpatch: improve Kconfig help test Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add frequently used ops structs Subsystem: binfmt "H.J. Lu" <hjl.tools@gmail.com>: fs/binfmt_elf: use PT_LOAD p_align values for static PIE Subsystem: nilfs2 Colin Ian King <colin.i.king@gmail.com>: nilfs2: remove redundant pointer sbufs Subsystem: hfs Kees Cook <keescook@chromium.org>: hfsplus: use struct_group_attr() for memcpy() region Subsystem: fat "NeilBrown" <neilb@suse.de>: FAT: use io_schedule_timeout() instead of congestion_wait() Subsystem: adfs Minghao Chi <chi.minghao@zte.com.cn>: fs/adfs: remove unneeded variable make code cleaner Subsystem: panic Marco Elver <elver@google.com>: panic: use error_report_end tracepoint on warnings Sebastian Andrzej Siewior <bigeasy@linutronix.de>: panic: remove oops_id Subsystem: delayacct Yang Yang <yang.yang29@zte.com.cn>: delayacct: support swapin delay accounting for swapping without blkio delayacct: fix incomplete disable operation when switch enable to disable delayacct: cleanup flags in struct task_delay_info and functions use it wangyong <wang.yong12@zte.com.cn>: Documentation/accounting/delay-accounting.rst: add thrashing page cache and direct compact delayacct: track delays from memory compact Subsystem: kconfig Qian Cai <quic_qiancai@quicinc.com>: configs: introduce debug.config for CI-like setup Nathan Chancellor <nathan@kernel.org>: Patch series "Fix CONFIG_TEST_KMOD with 256kB page size": arch/Kconfig: split PAGE_SIZE_LESS_THAN_256KB from PAGE_SIZE_LESS_THAN_64KB btrfs: use generic Kconfig option for 256kB page size limit lib/Kconfig.debug: make TEST_KMOD depend on PAGE_SIZE_LESS_THAN_256KB Subsystem: kcov Marco Elver <elver@google.com>: kcov: fix generic Kconfig dependencies if ARCH_WANTS_NO_INSTR Subsystem: ubsan Kees Cook <keescook@chromium.org>: ubsan: remove CONFIG_UBSAN_OBJECT_SIZE Colin Ian King <colin.i.king@gmail.com>: lib: remove redundant assignment to variable ret Documentation/accounting/delay-accounting.rst | 63 +- arch/Kconfig | 4 arch/arm64/Kconfig | 20 arch/ia64/Kconfig | 9 arch/mips/Kconfig | 10 arch/mips/mm/init.c | 28 - arch/powerpc/Kconfig | 17 arch/powerpc/kernel/setup_64.c | 113 ---- arch/riscv/Kconfig | 10 arch/sparc/Kconfig | 12 arch/sparc/kernel/led.c | 8 arch/sparc/kernel/smp_64.c | 119 ----- arch/x86/Kconfig | 19 arch/x86/kernel/setup_percpu.c | 82 --- drivers/base/arch_numa.c | 78 --- drivers/infiniband/hw/qib/qib.h | 2 drivers/infiniband/hw/qib/qib_file_ops.c | 2 drivers/infiniband/sw/rxe/rxe_qp.c | 3 drivers/net/wireless/broadcom/brcm80211/brcmfmac/xtlv.c | 2 fs/adfs/inode.c | 4 fs/binfmt_elf.c | 6 fs/btrfs/Kconfig | 3 fs/exec.c | 5 fs/fat/file.c | 5 fs/hfsplus/hfsplus_raw.h | 12 fs/hfsplus/xattr.c | 4 fs/nilfs2/page.c | 4 fs/proc/array.c | 3 fs/proc/base.c | 4 fs/proc/proc_sysctl.c | 9 fs/proc/vmcore.c | 10 include/kunit/assert.h | 2 include/linux/delayacct.h | 107 ++-- include/linux/elfcore-compat.h | 5 include/linux/elfcore.h | 5 include/linux/hash.h | 5 include/linux/kernel.h | 9 include/linux/kthread.h | 1 include/linux/list.h | 36 - include/linux/percpu.h | 21 include/linux/proc_fs.h | 12 include/linux/sched.h | 9 include/linux/unaligned/packed_struct.h | 2 include/trace/events/error_report.h | 8 include/uapi/linux/taskstats.h | 6 include/uapi/linux/uuid.h | 10 kernel/configs/debug.config | 105 ++++ kernel/delayacct.c | 49 +- kernel/kthread.c | 32 + kernel/panic.c | 21 kernel/sys.c | 16 lib/Kconfig.debug | 45 + lib/Kconfig.ubsan | 13 lib/Makefile | 5 lib/asn1_encoder.c | 2 lib/kstrtox.c | 12 lib/list_debug.c | 8 lib/lz4/lz4defs.h | 2 lib/test_hash.c | 375 +++++++--------- lib/test_meminit.c | 1 lib/test_ubsan.c | 22 mm/Kconfig | 12 mm/memory.c | 4 mm/page_alloc.c | 3 mm/page_io.c | 3 mm/percpu.c | 168 +++++-- samples/bpf/offwaketime_kern.c | 4 samples/bpf/test_overhead_kprobe_kern.c | 11 samples/bpf/test_overhead_tp_kern.c | 5 scripts/Makefile.ubsan | 1 scripts/checkpatch.pl | 54 +- scripts/const_structs.checkpatch | 23 scripts/get_maintainer.pl | 2 tools/accounting/getdelays.c | 8 tools/bpf/bpftool/skeleton/pid_iter.bpf.c | 4 tools/include/linux/hash.h | 5 tools/testing/selftests/bpf/progs/test_stacktrace_map.c | 6 tools/testing/selftests/bpf/progs/test_tracepoint.c | 6 78 files changed, 943 insertions(+), 992 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2022-01-14 22:02 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2022-01-14 22:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 146 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16") Subsystems affected by this patch series: kthread ia64 scripts ntfs squashfs ocfs2 vfs mm/slab-generic mm/slab mm/kmemleak mm/dax mm/kasan mm/debug mm/pagecache mm/gup mm/shmem mm/frontswap mm/memremap mm/memcg mm/selftests mm/pagemap mm/dma mm/vmalloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/ksm mm/page-poison mm/percpu mm/rmap mm/zswap mm/zram mm/cleanups mm/hmm mm/damon Subsystem: kthread Cai Huoqing <caihuoqing@baidu.com>: kthread: add the helper function kthread_run_on_cpu() RDMA/siw: make use of the helper function kthread_run_on_cpu() ring-buffer: make use of the helper function kthread_run_on_cpu() rcutorture: make use of the helper function kthread_run_on_cpu() trace/osnoise: make use of the helper function kthread_run_on_cpu() trace/hwlat: make use of the helper function kthread_run_on_cpu() Subsystem: ia64 Yang Guang <yang.guang5@zte.com.cn>: ia64: module: use swap() to make code cleaner arch/ia64/kernel/setup.c: use swap() to make code cleaner Jason Wang <wangborong@cdjrlc.com>: ia64: fix typo in a comment Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ia64: topology: use default_groups in kobj_type Subsystem: scripts Drew Fustini <dfustini@baylibre.com>: scripts/spelling.txt: add "oveflow" Subsystem: ntfs Yang Li <yang.lee@linux.alibaba.com>: fs/ntfs/attrib.c: fix one kernel-doc comment Subsystem: squashfs Zheng Liang <zhengliang6@huawei.com>: squashfs: provide backing_dev_info in order to disable read-ahead Subsystem: ocfs2 Zhang Mingyu <zhang.mingyu@zte.com.cn>: ocfs2: use BUG_ON instead of if condition followed by BUG. Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: clearly handle ocfs2_grab_pages_for_write() return value Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: use default_groups in kobj_type Colin Ian King <colin.i.king@gmail.com>: ocfs2: remove redundant assignment to pointer root_bh Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: cluster: use default_groups in kobj_type Colin Ian King <colin.i.king@gmail.com>: ocfs2: remove redundant assignment to variable free_space Subsystem: vfs Amit Daniel Kachhap <amit.kachhap@arm.com>: fs/ioctl: remove unnecessary __user annotation Subsystem: mm/slab-generic Marco Elver <elver@google.com>: mm/slab_common: use WARN() if cache still has objects on destroy Subsystem: mm/slab Muchun Song <songmuchun@bytedance.com>: mm: slab: make slab iterator functions static Subsystem: mm/kmemleak Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kmemleak: fix kmemleak false positive report with HW tag-based kasan enable Calvin Zhang <calvinzhang.cool@gmail.com>: mm: kmemleak: alloc gray object for reserved region with direct map Kefeng Wang <wangkefeng.wang@huawei.com>: mm: defer kmemleak object creation of module_alloc() Subsystem: mm/dax Joao Martins <joao.m.martins@oracle.com>: Patch series "mm, device-dax: Introduce compound pages in devmap", v7: mm/page_alloc: split prep_compound_page into head and tail subparts mm/page_alloc: refactor memmap_init_zone_device() page init mm/memremap: add ZONE_DEVICE support for compound pages device-dax: use ALIGN() for determining pgoff device-dax: use struct_size() device-dax: ensure dev_dax->pgmap is valid for dynamic devices device-dax: factor out page mapping initialization device-dax: set mapping prior to vmf_insert_pfn{,_pmd,pud}() device-dax: remove pfn from __dev_dax_{pte,pmd,pud}_fault() device-dax: compound devmap support Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: test: add globals left-out-of-bounds test kasan: add ability to detect double-kmem_cache_destroy() kasan: test: add test case for double-kmem_cache_destroy() Andrey Konovalov <andreyknvl@google.com>: kasan: fix quarantine conflicting with init_on_free Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm,fs: split dump_mapping() out from dump_page() Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug_vm_pgtable: update comments regarding migration swap entries Subsystem: mm/pagecache chiminghao <chi.minghao@zte.com.cn>: mm/truncate.c: remove unneeded variable Subsystem: mm/gup Christophe Leroy <christophe.leroy@csgroup.eu>: gup: avoid multiple user access locking/unlocking in fault_in_{read/write}able Li Xinhai <lixinhai.lxh@gmail.com>: mm/gup.c: stricter check on THP migration entry during follow_pmd_mask Subsystem: mm/shmem Yang Shi <shy828301@gmail.com>: mm: shmem: don't truncate page if memory failure happens Gang Li <ligang.bdlg@bytedance.com>: shmem: fix a race between shmem_unused_huge_shrink and shmem_evict_inode Subsystem: mm/frontswap Christophe JAILLET <christophe.jaillet@wanadoo.fr>: mm/frontswap.c: use non-atomic '__set_bit()' when possible Subsystem: mm/memremap Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: make cgroup_memory_nokmem static Donghai Qiao <dqiao@redhat.com>: mm/page_counter: remove an incorrect call to propagate_protected_usage() Dan Schatzberg <schatzberg.dan@gmail.com>: mm/memcg: add oom_group_kill memory event Shakeel Butt <shakeelb@google.com>: memcg: better bounds on the memcg stats updates Wang Weiyang <wangweiyang2@huawei.com>: mm/memcg: use struct_size() helper in kzalloc() Shakeel Butt <shakeelb@google.com>: memcg: add per-memcg vmalloc stat Subsystem: mm/selftests chiminghao <chi.minghao@zte.com.cn>: tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner Subsystem: mm/pagemap Qi Zheng <zhengqi.arch@bytedance.com>: mm: remove redundant check about FAULT_FLAG_ALLOW_RETRY bit Colin Cross <ccross@google.com>: Patch series "mm: rearrange madvise code to allow for reuse", v11: mm: rearrange madvise code to allow for reuse mm: add a field to store names for private anonymous memory Suren Baghdasaryan <surenb@google.com>: mm: add anonymous vma name refcounting Arnd Bergmann <arnd@arndb.de>: mm: move anon_vma declarations to linux/mm_inline.h mm: move tlb_flush_pending inline helpers to mm_inline.h Suren Baghdasaryan <surenb@google.com>: mm: protect free_pgtables with mmap_lock write lock in exit_mmap mm: document locking restrictions for vm_operations_struct::close mm/oom_kill: allow process_mrelease to run under mmap_lock protection Shuah Khan <skhan@linuxfoundation.org>: docs/vm: add vmalloced-kernel-stacks document Pasha Tatashin <pasha.tatashin@soleen.com>: Patch series "page table check", v3: mm: change page type prior to adding page table entry mm: ptep_clear() page table helper mm: page table check x86: mm: add x86_64 support for page table check "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: remove last argument of reuse_swap_page() mm: remove the total_mapcount argument from page_trans_huge_map_swapcount() mm: remove the total_mapcount argument from page_trans_huge_mapcount() Subsystem: mm/dma Christian König <christian.koenig@amd.com>: mm/dmapool.c: revert "make dma pool to use kmalloc_node" Subsystem: mm/vmalloc Michal Hocko <mhocko@suse.com>: Patch series "extend vmalloc support for constrained allocations", v2: mm/vmalloc: alloc GFP_NO{FS,IO} for vmalloc mm/vmalloc: add support for __GFP_NOFAIL mm/vmalloc: be more explicit about supported gfp flags. mm: allow !GFP_KERNEL allocations for kvmalloc mm: make slab and vmalloc allocators __GFP_NOLOCKDEP aware "NeilBrown" <neilb@suse.de>: mm: introduce memalloc_retry_wait() Suren Baghdasaryan <surenb@google.com>: mm/pagealloc: sysctl: change watermark_scale_factor max limit to 30% Changcheng Deng <deng.changcheng@zte.com.cn>: mm: fix boolreturn.cocci warning Xiongwei Song <sxwjean@gmail.com>: mm: page_alloc: fix building error on -Werror=array-compare Michal Hocko <mhocko@suse.com>: mm: drop node from alloc_pages_vma Miles Chen <miles.chen@mediatek.com>: include/linux/gfp.h: further document GFP_DMA32 Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc.c: modify the comment section for alloc_contig_pages() Baoquan He <bhe@redhat.com>: Patch series "Handle warning of allocation failure on DMA zone w/o managed pages", v4: mm_zone: add function to check if managed dma zone exists dma/pool: create dma atomic pool only if dma zone has managed pages mm/page_alloc.c: do not warn allocation failure on zone DMA if no managed pages Subsystem: mm/memory-failure Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb: add hugetlb.*.numa_stat file Yosry Ahmed <yosryahmed@google.com>: mm, hugepages: make memory size variable in hugepage-mremap selftest Yang Yang <yang.yang29@zte.com.cn>: mm/vmstat: add events for THP max_ptes_* exceeds Waiman Long <longman@redhat.com>: selftests/vm: make charge_reserved_hugetlb.sh work with existing cgroup setting Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: selftests/uffd: allow EINTR/EAGAIN Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd/selftests: clean up hugetlb allocation code Subsystem: mm/vmscan Gang Li <ligang.bdlg@bytedance.com>: vmscan: make drop_slab_node static Chen Wandun <chenwandun@huawei.com>: mm/page_isolation: unset migratetype directly for non Buddy page Subsystem: mm/mempolicy "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm: add new syscall set_mempolicy_home_node", v6: mm/mempolicy: use policy_node helper with MPOL_PREFERRED_MANY mm/mempolicy: add set_mempolicy_home_node syscall mm/mempolicy: wire up syscall set_mempolicy_home_node Randy Dunlap <rdunlap@infradead.org>: mm/mempolicy: fix all kernel-doc warnings Subsystem: mm/oom-kill Jann Horn <jannh@google.com>: mm, oom: OOM sysrq should always kill a process Subsystem: mm/hugetlbfs Sean Christopherson <seanjc@google.com>: hugetlbfs: fix off-by-one error in hugetlb_vmdelete_list() Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: Patch series "Improve the migration stats": mm: migrate: fix the return value of migrate_pages() mm: migrate: correct the hugetlb migration stats mm: compaction: fix the migration stats in trace_mm_compaction_migratepages() mm: migrate: support multiple target nodes demotion mm: migrate: add more comments for selecting target node randomly Huang Ying <ying.huang@intel.com>: mm/migrate: move node demotion code to near its user Colin Ian King <colin.i.king@gmail.com>: mm/migrate: remove redundant variables used in a for-loop Subsystem: mm/thp Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: drop unused trace events hugepage_[invalidate|splitting] Subsystem: mm/ksm Nanyong Sun <sunnanyong@huawei.com>: mm: ksm: fix use-after-free kasan report in ksm_might_need_to_copy Subsystem: mm/page-poison Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "mm/hwpoison: fix unpoison_memory()", v4: mm/hwpoison: mf_mutex for soft offline and unpoison mm/hwpoison: remove MF_MSG_BUDDY_2ND and MF_MSG_POISONED_HUGE mm/hwpoison: fix unpoison_memory() Subsystem: mm/percpu Qi Zheng <zhengqi.arch@bytedance.com>: mm: memcg/percpu: account extra objcg space to memory cgroups Subsystem: mm/rmap Huang Ying <ying.huang@intel.com>: mm/rmap: fix potential batched TLB flush race Subsystem: mm/zswap Zhaoyu Liu <zackary.liu.pro@gmail.com>: zpool: remove the list of pools_head Subsystem: mm/zram Luis Chamberlain <mcgrof@kernel.org>: zram: use ATTRIBUTE_GROUPS Subsystem: mm/cleanups Quanfa Fu <fuqf0919@gmail.com>: mm: fix some comment errors Ting Liu <liuting.0x7c00@bytedance.com>: mm: make some vars and functions static or __init Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: mm/hmm.c: allow VM_MIXEDMAP to work with hmm_range_fault Subsystem: mm/damon Xin Hao <xhao@linux.alibaba.com>: Patch series "mm/damon: Do some small changes", v4: mm/damon: unified access_check function naming rules mm/damon: add 'age' of region tracepoint support mm/damon/core: use abs() instead of diff_of() mm/damon: remove some unneeded function definitions in damon.h Yihao Han <hanyihao@vivo.com>: mm/damon/vaddr: remove swap_ranges() and replace it with swap() Xin Hao <xhao@linux.alibaba.com>: mm/damon/schemes: add the validity judgment of thresholds mm/damon: move damon_rand() definition into damon.h mm/damon: modify damon_rand() macro to static inline function SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Misc cleanups": mm/damon: convert macro functions to static inline functions Docs/admin-guide/mm/damon/usage: update for scheme quotas and watermarks Docs/admin-guide/mm/damon/usage: remove redundant information Docs/admin-guide/mm/damon/usage: mention tracepoint at the beginning Docs/admin-guide/mm/damon/usage: update for kdamond_pid and (mk|rm)_contexts mm/damon: remove a mistakenly added comment for a future feature Patch series "mm/damon/schemes: Extend stats for better online analysis and tuning": mm/damon/schemes: account scheme actions that successfully applied mm/damon/schemes: account how many times quota limit has exceeded mm/damon/reclaim: provide reclamation statistics Docs/admin-guide/mm/damon/reclaim: document statistics parameters mm/damon/dbgfs: support all DAMOS stats Docs/admin-guide/mm/damon/usage: update for schemes statistics Baolin Wang <baolin.wang@linux.alibaba.com>: mm/damon: add access checking for hugetlb pages Guoqing Jiang <guoqing.jiang@linux.dev>: mm/damon: move the implementation of damon_insert_region to damon.h SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Hide unnecessary information disclosures": mm/damon/dbgfs: remove an unnecessary variable mm/damon/vaddr: use pr_debug() for damon_va_three_regions() failure logging mm/damon/vaddr: hide kernel pointer from damon_va_three_regions() failure log mm/damon: hide kernel pointer from tracepoint event Documentation/admin-guide/cgroup-v1/hugetlb.rst | 4 Documentation/admin-guide/cgroup-v2.rst | 11 Documentation/admin-guide/mm/damon/reclaim.rst | 25 Documentation/admin-guide/mm/damon/usage.rst | 235 +++++-- Documentation/admin-guide/mm/numa_memory_policy.rst | 16 Documentation/admin-guide/sysctl/vm.rst | 2 Documentation/filesystems/proc.rst | 6 Documentation/vm/arch_pgtable_helpers.rst | 20 Documentation/vm/index.rst | 2 Documentation/vm/page_migration.rst | 12 Documentation/vm/page_table_check.rst | 56 + Documentation/vm/vmalloced-kernel-stacks.rst | 153 ++++ MAINTAINERS | 9 arch/Kconfig | 3 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/alpha/mm/fault.c | 16 arch/arc/mm/fault.c | 3 arch/arm/mm/fault.c | 2 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kernel/module.c | 4 arch/arm64/mm/fault.c | 6 arch/hexagon/mm/vm_fault.c | 8 arch/ia64/kernel/module.c | 6 arch/ia64/kernel/setup.c | 5 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/ia64/kernel/topology.c | 3 arch/ia64/kernel/uncached.c | 2 arch/ia64/mm/fault.c | 16 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/m68k/mm/fault.c | 18 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/microblaze/mm/fault.c | 18 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/mips/mm/fault.c | 19 arch/nds32/mm/fault.c | 16 arch/nios2/mm/fault.c | 18 arch/openrisc/mm/fault.c | 18 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/parisc/mm/fault.c | 18 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/mm/fault.c | 6 arch/riscv/mm/fault.c | 2 arch/s390/kernel/module.c | 5 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/s390/mm/fault.c | 28 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sh/mm/fault.c | 18 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/sparc/mm/fault_32.c | 16 arch/sparc/mm/fault_64.c | 16 arch/um/kernel/trap.c | 8 arch/x86/Kconfig | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/include/asm/pgtable.h | 31 - arch/x86/kernel/module.c | 7 arch/x86/mm/fault.c | 3 arch/xtensa/kernel/syscalls/syscall.tbl | 1 arch/xtensa/mm/fault.c | 17 drivers/block/zram/zram_drv.c | 11 drivers/dax/bus.c | 32 + drivers/dax/bus.h | 1 drivers/dax/device.c | 140 ++-- drivers/infiniband/sw/siw/siw_main.c | 7 drivers/of/fdt.c | 6 fs/ext4/extents.c | 8 fs/ext4/inline.c | 5 fs/ext4/page-io.c | 9 fs/f2fs/data.c | 4 fs/f2fs/gc.c | 5 fs/f2fs/inode.c | 4 fs/f2fs/node.c | 4 fs/f2fs/recovery.c | 6 fs/f2fs/segment.c | 9 fs/f2fs/super.c | 5 fs/hugetlbfs/inode.c | 7 fs/inode.c | 49 + fs/ioctl.c | 2 fs/ntfs/attrib.c | 2 fs/ocfs2/alloc.c | 2 fs/ocfs2/aops.c | 26 fs/ocfs2/cluster/masklog.c | 11 fs/ocfs2/dir.c | 2 fs/ocfs2/filecheck.c | 3 fs/ocfs2/journal.c | 6 fs/proc/task_mmu.c | 13 fs/squashfs/super.c | 33 + fs/userfaultfd.c | 8 fs/xfs/kmem.c | 3 fs/xfs/xfs_buf.c | 2 include/linux/ceph/libceph.h | 1 include/linux/damon.h | 93 +-- include/linux/fs.h | 1 include/linux/gfp.h | 12 include/linux/hugetlb.h | 4 include/linux/hugetlb_cgroup.h | 7 include/linux/kasan.h | 4 include/linux/kthread.h | 25 include/linux/memcontrol.h | 22 include/linux/mempolicy.h | 1 include/linux/memremap.h | 11 include/linux/mm.h | 76 -- include/linux/mm_inline.h | 136 ++++ include/linux/mm_types.h | 252 +++----- include/linux/mmzone.h | 9 include/linux/page-flags.h | 6 include/linux/page_idle.h | 1 include/linux/page_table_check.h | 147 ++++ include/linux/pgtable.h | 8 include/linux/sched/mm.h | 26 include/linux/swap.h | 8 include/linux/syscalls.h | 3 include/linux/vm_event_item.h | 3 include/linux/vmalloc.h | 7 include/ras/ras_event.h | 2 include/trace/events/compaction.h | 24 include/trace/events/damon.h | 15 include/trace/events/thp.h | 35 - include/uapi/asm-generic/unistd.h | 5 include/uapi/linux/prctl.h | 3 kernel/dma/pool.c | 4 kernel/fork.c | 3 kernel/kthread.c | 1 kernel/rcu/rcutorture.c | 7 kernel/sys.c | 63 ++ kernel/sys_ni.c | 1 kernel/sysctl.c | 3 kernel/trace/ring_buffer.c | 7 kernel/trace/trace_hwlat.c | 6 kernel/trace/trace_osnoise.c | 3 lib/test_hmm.c | 24 lib/test_kasan.c | 30 mm/Kconfig | 14 mm/Kconfig.debug | 24 mm/Makefile | 1 mm/compaction.c | 7 mm/damon/core.c | 45 - mm/damon/dbgfs.c | 20 mm/damon/paddr.c | 24 mm/damon/prmtv-common.h | 4 mm/damon/reclaim.c | 46 + mm/damon/vaddr.c | 186 ++++-- mm/debug.c | 52 - mm/debug_vm_pgtable.c | 6 mm/dmapool.c | 2 mm/frontswap.c | 4 mm/gup.c | 31 - mm/hmm.c | 5 mm/huge_memory.c | 32 - mm/hugetlb.c | 6 mm/hugetlb_cgroup.c | 133 +++- mm/internal.h | 7 mm/kasan/quarantine.c | 11 mm/kasan/shadow.c | 9 mm/khugepaged.c | 23 mm/kmemleak.c | 21 mm/ksm.c | 5 mm/madvise.c | 510 ++++++++++------ mm/mapping_dirty_helpers.c | 1 mm/memcontrol.c | 44 - mm/memory-failure.c | 189 +++--- mm/memory.c | 12 mm/mempolicy.c | 95 ++- mm/memremap.c | 18 mm/migrate.c | 527 ++++++++++------- mm/mlock.c | 2 mm/mmap.c | 55 + mm/mmu_gather.c | 1 mm/mprotect.c | 2 mm/oom_kill.c | 30 mm/page_alloc.c | 198 ++++-- mm/page_counter.c | 1 mm/page_ext.c | 8 mm/page_isolation.c | 2 mm/page_owner.c | 4 mm/page_table_check.c | 270 ++++++++ mm/percpu-internal.h | 18 mm/percpu.c | 10 mm/pgtable-generic.c | 1 mm/rmap.c | 43 + mm/shmem.c | 91 ++ mm/slab.h | 5 mm/slab_common.c | 34 - mm/swap.c | 2 mm/swapfile.c | 46 - mm/truncate.c | 5 mm/userfaultfd.c | 5 mm/util.c | 15 mm/vmalloc.c | 75 +- mm/vmscan.c | 2 mm/vmstat.c | 3 mm/zpool.c | 12 net/ceph/buffer.c | 4 net/ceph/ceph_common.c | 27 net/ceph/crypto.c | 2 net/ceph/messenger.c | 2 net/ceph/messenger_v2.c | 2 net/ceph/osdmap.c | 12 net/sunrpc/svc_xprt.c | 3 scripts/spelling.txt | 1 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 34 - tools/testing/selftests/vm/hmm-tests.c | 42 + tools/testing/selftests/vm/hugepage-mremap.c | 46 - tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 21 tools/testing/selftests/vm/run_vmtests.sh | 2 tools/testing/selftests/vm/userfaultfd.c | 33 - tools/testing/selftests/vm/write_hugetlb_memory.sh | 2 211 files changed, 3980 insertions(+), 1759 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-12-31 4:12 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-12-31 4:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 2 patches, based on 4f3d93c6eaff6b84e43b63e0d7a119c5920e1020. Subsystems affected by this patch series: mm/userfaultfd mm/damon Subsystem: mm/userfaultfd Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd/selftests: fix hugetlb area allocations Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/dbgfs: fix 'struct pid' leaks in 'dbgfs_target_ids_write()' mm/damon/dbgfs.c | 9 +++++++-- tools/testing/selftests/vm/userfaultfd.c | 16 ++++++++++------ 2 files changed, 17 insertions(+), 8 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-12-25 5:11 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-12-25 5:11 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 9 patches, based on bc491fb12513e79702c6f936c838f792b5389129. Subsystems affected by this patch series: mm/kfence mm/mempolicy core-kernel MAINTAINERS mm/memory-failure mm/pagemap mm/pagealloc mm/damon mm/memory-failure Subsystem: mm/kfence Baokun Li <libaokun1@huawei.com>: kfence: fix memory leak when cat kfence objects Subsystem: mm/mempolicy Andrey Ryabinin <arbn@yandex-team.com>: mm: mempolicy: fix THP allocations escaping mempolicy restrictions Subsystem: core-kernel Philipp Rudo <prudo@redhat.com>: kernel/crash_core: suppress unknown crashkernel parameter warning Subsystem: MAINTAINERS Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: mark more list instances as moderated Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: fix condition in free hugetlb page path Subsystem: mm/pagemap Hugh Dickins <hughd@google.com>: mm: delete unsafe BUG from page_cache_add_speculative() Subsystem: mm/pagealloc Thibaut Sautereau <thibaut.sautereau@ssi.gouv.fr>: mm/page_alloc: fix __alloc_size attribute for alloc_pages_exact_nid Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/dbgfs: protect targets destructions with kdamond_lock Subsystem: mm/memory-failure Liu Shixin <liushixin2@huawei.com>: mm/hwpoison: clear MF_COUNT_INCREASED before retrying get_any_page() MAINTAINERS | 4 ++-- include/linux/gfp.h | 2 +- include/linux/pagemap.h | 1 - kernel/crash_core.c | 11 +++++++++++ mm/damon/dbgfs.c | 2 ++ mm/kfence/core.c | 1 + mm/memory-failure.c | 14 +++++--------- mm/mempolicy.c | 3 +-- 8 files changed, 23 insertions(+), 15 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-12-10 22:45 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-12-10 22:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 21 patches, based on c741e49150dbb0c0aebe234389f4aa8b47958fa8. Subsystems affected by this patch series: mm/mlock MAINTAINERS mailmap mm/pagecache mm/damon mm/slub mm/memcg mm/hugetlb mm/pagecache Subsystem: mm/mlock Drew DeVault <sir@cmpwn.com>: Increase default MLOCK_LIMIT to 8 MiB Subsystem: MAINTAINERS Dave Young <dyoung@redhat.com>: MAINTAINERS: update kdump maintainers Subsystem: mailmap Guo Ren <guoren@linux.alibaba.com>: mailmap: update email address for Guo Ren Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: filemap: remove PageHWPoison check from next_uptodate_page() Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "mm/damon: Fix fake /proc/loadavg reports", v3: timers: implement usleep_idle_range() mm/damon/core: fix fake load reports due to uninterruptible sleeps Patch series "mm/damon: Trivial fixups and improvements": mm/damon/core: use better timer mechanisms selection threshold mm/damon/dbgfs: remove an unnecessary error message mm/damon/core: remove unnecessary error messages mm/damon/vaddr: remove an unnecessary warning message mm/damon/vaddr-test: split a test function having >1024 bytes frame size mm/damon/vaddr-test: remove unnecessary variables selftests/damon: skip test if DAMON is running selftests/damon: test DAMON enabling with empty target_ids case selftests/damon: test wrong DAMOS condition ranges input selftests/damon: test debugfs file reads/writes with huge count selftests/damon: split test cases Subsystem: mm/slub Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/slub: fix endianness bug for alloc/free_traces attributes Subsystem: mm/memcg Waiman Long <longman@redhat.com>: mm/memcg: relocate mod_objcg_mlstate(), get_obj_stock() and put_obj_stock() Subsystem: mm/hugetlb Zhenguo Yao <yaozhenguo1@gmail.com>: hugetlbfs: fix issue of preallocation of gigantic pages can't work Subsystem: mm/pagecache Manjong Lee <mj0123.lee@samsung.com>: mm: bdi: initialize bdi_min_ratio when bdi is unregistered .mailmap | 2 MAINTAINERS | 2 include/linux/delay.h | 14 include/uapi/linux/resource.h | 13 kernel/time/timer.c | 16 - mm/backing-dev.c | 7 mm/damon/core.c | 20 - mm/damon/dbgfs.c | 4 mm/damon/vaddr-test.h | 85 ++--- mm/damon/vaddr.c | 1 mm/filemap.c | 2 mm/hugetlb.c | 2 mm/memcontrol.c | 106 +++---- mm/slub.c | 15 - tools/testing/selftests/damon/.gitignore | 2 tools/testing/selftests/damon/Makefile | 7 tools/testing/selftests/damon/_debugfs_common.sh | 52 +++ tools/testing/selftests/damon/debugfs_attrs.sh | 149 ++-------- tools/testing/selftests/damon/debugfs_empty_targets.sh | 13 tools/testing/selftests/damon/debugfs_huge_count_read_write.sh | 22 + tools/testing/selftests/damon/debugfs_schemes.sh | 19 + tools/testing/selftests/damon/debugfs_target_ids.sh | 19 + tools/testing/selftests/damon/huge_count_read_write.c | 39 ++ 23 files changed, 363 insertions(+), 248 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-11-20 0:42 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-11-20 0:42 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 15 patches, based on a90af8f15bdc9449ee2d24e1d73fa3f7e8633f81. Subsystems affected by this patch series: mm/swap ipc mm/slab-generic hexagon mm/kmemleak mm/hugetlb mm/kasan mm/damon mm/highmem proc Subsystem: mm/swap Matthew Wilcox <willy@infradead.org>: mm/swap.c:put_pages_list(): reinitialise the page list Subsystem: ipc Alexander Mikhalitsyn <alexander.mikhalitsyn@virtuozzo.com>: Patch series "shm: shm_rmid_forced feature fixes": ipc: WARN if trying to remove ipc object which is absent shm: extend forced shm destroy to support objects from several IPC nses Subsystem: mm/slab-generic Yunfeng Ye <yeyunfeng@huawei.com>: mm: emit the "free" trace report before freeing memory in kmem_cache_free() Subsystem: hexagon Nathan Chancellor <nathan@kernel.org>: Patch series "Fixes for ARCH=hexagon allmodconfig", v2: hexagon: export raw I/O routines for modules hexagon: clean up timer-regs.h hexagon: ignore vmlinux.lds Subsystem: mm/kmemleak Rustam Kovhaev <rkovhaev@gmail.com>: mm: kmemleak: slob: respect SLAB_NOLEAKTRACE flag Subsystem: mm/hugetlb Bui Quang Minh <minhquangbui99@gmail.com>: hugetlb: fix hugetlb cgroup refcounting during mremap Mina Almasry <almasrymina@google.com>: hugetlb, userfaultfd: fix reservation restore on userfaultfd error Subsystem: mm/kasan Kees Cook <keescook@chromium.org>: kasan: test: silence intentional read overflow warnings Subsystem: mm/damon SeongJae Park <sj@kernel.org>: Patch series "DAMON fixes": mm/damon/dbgfs: use '__GFP_NOWARN' for user-specified size buffer allocation mm/damon/dbgfs: fix missed use of damon_dbgfs_lock Subsystem: mm/highmem Ard Biesheuvel <ardb@kernel.org>: kmap_local: don't assume kmap PTEs are linear arrays in memory Subsystem: proc David Hildenbrand <david@redhat.com>: proc/vmcore: fix clearing user buffer by properly using clear_user() arch/arm/Kconfig | 1 arch/hexagon/include/asm/timer-regs.h | 26 ---- arch/hexagon/include/asm/timex.h | 3 arch/hexagon/kernel/.gitignore | 1 arch/hexagon/kernel/time.c | 12 +- arch/hexagon/lib/io.c | 4 fs/proc/vmcore.c | 20 ++- include/linux/hugetlb_cgroup.h | 12 ++ include/linux/ipc_namespace.h | 15 ++ include/linux/sched/task.h | 2 ipc/shm.c | 189 +++++++++++++++++++++++++--------- ipc/util.c | 6 - lib/test_kasan.c | 2 mm/Kconfig | 3 mm/damon/dbgfs.c | 20 ++- mm/highmem.c | 32 +++-- mm/hugetlb.c | 11 + mm/slab.c | 3 mm/slab.h | 2 mm/slob.c | 3 mm/slub.c | 2 mm/swap.c | 1 22 files changed, 254 insertions(+), 116 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-11-11 4:32 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-11-11 4:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits The post-linux-next material. 7 patches, based on debe436e77c72fcee804fb867f275e6d31aa999c. Subsystems affected by this patch series: mm/debug mm/slab-generic mm/migration mm/memcg mm/kasan Subsystem: mm/debug Yixuan Cao <caoyixuan2019@email.szu.edu.cn>: mm/page_owner.c: modify the type of argument "order" in some functions Subsystem: mm/slab-generic Ingo Molnar <mingo@kernel.org>: mm: allow only SLUB on PREEMPT_RT Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: mm: migrate: simplify the file-backed pages validation when migrating its mapping Alistair Popple <apopple@nvidia.com>: mm/migrate.c: remove MIGRATE_PFN_LOCKED Subsystem: mm/memcg Christoph Hellwig <hch@lst.de>: Patch series "unexport memcg locking helpers": mm: unexport folio_memcg_{,un}lock mm: unexport {,un}lock_page_memcg Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kasan: add kasan mode messages when kasan init Documentation/vm/hmm.rst | 2 arch/arm64/mm/kasan_init.c | 2 arch/powerpc/kvm/book3s_hv_uvmem.c | 4 drivers/gpu/drm/amd/amdkfd/kfd_migrate.c | 2 drivers/gpu/drm/nouveau/nouveau_dmem.c | 4 include/linux/migrate.h | 1 include/linux/page_owner.h | 12 +- init/Kconfig | 2 lib/test_hmm.c | 5 - mm/kasan/hw_tags.c | 14 ++ mm/kasan/sw_tags.c | 2 mm/memcontrol.c | 4 mm/migrate.c | 151 +++++-------------------------- mm/page_owner.c | 6 - 14 files changed, 61 insertions(+), 150 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-11-09 2:30 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-11-09 2:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 87 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813, plus previously sent material. Subsystems affected by this patch series: mm/pagecache mm/hugetlb procfs misc MAINTAINERS lib checkpatch binfmt kallsyms ramfs init codafs nilfs2 hfs crash_dump signals seq_file fork sysvfs kcov gdb resource selftests ipc Subsystem: mm/pagecache Johannes Weiner <hannes@cmpxchg.org>: vfs: keep inodes with page cache off the inode shrinker LRU Subsystem: mm/hugetlb zhangyiru <zhangyiru3@huawei.com>: mm,hugetlb: remove mlock ulimit for SHM_HUGETLB Subsystem: procfs Florian Weimer <fweimer@redhat.com>: procfs: do not list TID 0 in /proc/<pid>/task David Hildenbrand <david@redhat.com>: x86/xen: update xen_oldmem_pfn_is_ram() documentation x86/xen: simplify xen_oldmem_pfn_is_ram() x86/xen: print a warning when HVMOP_get_mem_type fails proc/vmcore: let pfn_is_ram() return a bool proc/vmcore: convert oldmem_pfn_is_ram callback to more generic vmcore callbacks virtio-mem: factor out hotplug specifics from virtio_mem_init() into virtio_mem_init_hotplug() virtio-mem: factor out hotplug specifics from virtio_mem_probe() into virtio_mem_init_hotplug() virtio-mem: factor out hotplug specifics from virtio_mem_remove() into virtio_mem_deinit_hotplug() virtio-mem: kdump mode to sanitize /proc/vmcore access Stephen Brennan <stephen.s.brennan@oracle.com>: proc: allow pid_revalidate() during LOOKUP_RCU Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "kernel.h further split", v5: kernel.h: drop unneeded <linux/kernel.h> inclusion from other headers kernel.h: split out container_of() and typeof_member() macros include/kunit/test.h: replace kernel.h with the necessary inclusions include/linux/list.h: replace kernel.h with the necessary inclusions include/linux/llist.h: replace kernel.h with the necessary inclusions include/linux/plist.h: replace kernel.h with the necessary inclusions include/media/media-entity.h: replace kernel.h with the necessary inclusions include/linux/delay.h: replace kernel.h with the necessary inclusions include/linux/sbitmap.h: replace kernel.h with the necessary inclusions include/linux/radix-tree.h: replace kernel.h with the necessary inclusions include/linux/generic-radix-tree.h: replace kernel.h with the necessary inclusions Stephen Rothwell <sfr@canb.auug.org.au>: kernel.h: split out instruction pointer accessors Rasmus Villemoes <linux@rasmusvillemoes.dk>: linux/container_of.h: switch to static_assert Colin Ian King <colin.i.king@googlemail.com>: mailmap: update email address for Colin King Subsystem: MAINTAINERS Kees Cook <keescook@chromium.org>: MAINTAINERS: add "exec & binfmt" section with myself and Eric Lukas Bulwahn <lukas.bulwahn@gmail.com>: Patch series "Rectify file references for dt-bindings in MAINTAINERS", v5: MAINTAINERS: rectify entry for ARM/TOSHIBA VISCONTI ARCHITECTURE MAINTAINERS: rectify entry for HIKEY960 ONBOARD USB GPIO HUB DRIVER MAINTAINERS: rectify entry for INTEL KEEM BAY DRM DRIVER MAINTAINERS: rectify entry for ALLWINNER HARDWARE SPINLOCK SUPPORT Subsystem: lib Imran Khan <imran.f.khan@oracle.com>: Patch series "lib, stackdepot: check stackdepot handle before accessing slabs", v2: lib, stackdepot: check stackdepot handle before accessing slabs lib, stackdepot: add helper to print stack entries lib, stackdepot: add helper to print stack entries into buffer Lucas De Marchi <lucas.demarchi@intel.com>: include/linux/string_helpers.h: add linux/string.h for strlen() Alexey Dobriyan <adobriyan@gmail.com>: lib: uninline simple_strntoull() as well Thomas Gleixner <tglx@linutronix.de>: mm/scatterlist: replace the !preemptible warning in sg_miter_stop() Subsystem: checkpatch Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add a few sound ops structs Joe Perches <joe@perches.com>: checkpatch: improve EXPORT_SYMBOL test for EXPORT_SYMBOL_NS uses Peter Ujfalusi <peter.ujfalusi@linux.intel.com>: checkpatch: get default codespell dictionary path from package location Subsystem: binfmt Kees Cook <keescook@chromium.org>: binfmt_elf: reintroduce using MAP_FIXED_NOREPLACE Alexey Dobriyan <adobriyan@gmail.com>: ELF: simplify STACK_ALLOC macro Subsystem: kallsyms Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "sections: Unify kernel sections range check and use", v4: kallsyms: remove arch specific text and data check kallsyms: fix address-checks for kernel related range sections: move and rename core_kernel_data() to is_kernel_core_data() sections: move is_kernel_inittext() into sections.h x86: mm: rename __is_kernel_text() to is_x86_32_kernel_text() sections: provide internal __is_kernel() and __is_kernel_text() helper mm: kasan: use is_kernel() helper extable: use is_kernel_text() helper powerpc/mm: use core_kernel_text() helper microblaze: use is_kernel_text() helper alpha: use is_kernel_text() helper Subsystem: ramfs yangerkun <yangerkun@huawei.com>: ramfs: fix mount source show for ramfs Subsystem: init Andrew Halaney <ahalaney@redhat.com>: init: make unknown command line param message clearer Subsystem: codafs Jan Harkes <jaharkes@cs.cmu.edu>: Patch series "Coda updates for -next": coda: avoid NULL pointer dereference from a bad inode coda: check for async upcall request using local state Alex Shi <alex.shi@linux.alibaba.com>: coda: remove err which no one care Jan Harkes <jaharkes@cs.cmu.edu>: coda: avoid flagging NULL inodes coda: avoid hidden code duplication in rename coda: avoid doing bad things on inode type changes during revalidation Xiyu Yang <xiyuyang19@fudan.edu.cn>: coda: convert from atomic_t to refcount_t on coda_vm_ops->refcnt Jing Yangyang <jing.yangyang@zte.com.cn>: coda: use vmemdup_user to replace the open code Jan Harkes <jaharkes@cs.cmu.edu>: coda: bump module version to 7.2 Subsystem: nilfs2 Qing Wang <wangqing@vivo.com>: Patch series "nilfs2 updates": nilfs2: replace snprintf in show functions with sysfs_emit Ryusuke Konishi <konishi.ryusuke@gmail.com>: nilfs2: remove filenames from file comments Subsystem: hfs Arnd Bergmann <arnd@arndb.de>: hfs/hfsplus: use WARN_ON for sanity check Subsystem: crash_dump Changcheng Deng <deng.changcheng@zte.com.cn>: crash_dump: fix boolreturn.cocci warning Ye Guojin <ye.guojin@zte.com.cn>: crash_dump: remove duplicate include in crash_dump.h Subsystem: signals Ye Guojin <ye.guojin@zte.com.cn>: signal: remove duplicate include in signal.h Subsystem: seq_file Andy Shevchenko <andriy.shevchenko@linux.intel.com>: seq_file: move seq_escape() to a header Muchun Song <songmuchun@bytedance.com>: seq_file: fix passing wrong private data Subsystem: fork Ran Xiaokai <ran.xiaokai@zte.com.cn>: kernel/fork.c: unshare(): use swap() to make code cleaner Subsystem: sysvfs Pavel Skripkin <paskripkin@gmail.com>: sysv: use BUILD_BUG_ON instead of runtime check Subsystem: kcov Sebastian Andrzej Siewior <bigeasy@linutronix.de>: Patch series "kcov: PREEMPT_RT fixup + misc", v2: Documentation/kcov: include types.h in the example Documentation/kcov: define `ip' in the example kcov: allocate per-CPU memory on the relevant node kcov: avoid enable+disable interrupts if !in_task() kcov: replace local_irq_save() with a local_lock_t Subsystem: gdb Douglas Anderson <dianders@chromium.org>: scripts/gdb: handle split debug for vmlinux Subsystem: resource David Hildenbrand <david@redhat.com>: Patch series "virtio-mem: disallow mapping virtio-mem memory via /dev/mem", v5: kernel/resource: clean up and optimize iomem_is_exclusive() kernel/resource: disallow access to exclusive system RAM regions virtio-mem: disallow mapping virtio-mem memory via /dev/mem Subsystem: selftests SeongJae Park <sjpark@amazon.de>: selftests/kselftest/runner/run_one(): allow running non-executable files Subsystem: ipc Michal Clapinski <mclapinski@google.com>: ipc: check checkpoint_restore_ns_capable() to modify C/R proc files Manfred Spraul <manfred@colorfullife.com>: ipc/ipc_sysctl.c: remove fallback for !CONFIG_PROC_SYSCTL .mailmap | 2 Documentation/dev-tools/kcov.rst | 5 MAINTAINERS | 21 + arch/alpha/kernel/traps.c | 4 arch/microblaze/mm/pgtable.c | 3 arch/powerpc/mm/pgtable_32.c | 7 arch/riscv/lib/delay.c | 4 arch/s390/include/asm/facility.h | 4 arch/x86/kernel/aperture_64.c | 13 arch/x86/kernel/unwind_orc.c | 2 arch/x86/mm/init_32.c | 14 arch/x86/xen/mmu_hvm.c | 39 -- drivers/gpu/drm/drm_dp_mst_topology.c | 5 drivers/gpu/drm/drm_mm.c | 5 drivers/gpu/drm/i915/i915_vma.c | 5 drivers/gpu/drm/i915/intel_runtime_pm.c | 20 - drivers/media/dvb-frontends/cxd2880/cxd2880_common.h | 1 drivers/virtio/Kconfig | 1 drivers/virtio/virtio_mem.c | 321 +++++++++++++------ fs/binfmt_elf.c | 33 + fs/coda/cnode.c | 13 fs/coda/coda_linux.c | 39 +- fs/coda/coda_linux.h | 6 fs/coda/dir.c | 20 - fs/coda/file.c | 12 fs/coda/psdev.c | 14 fs/coda/upcall.c | 3 fs/hfs/inode.c | 6 fs/hfsplus/inode.c | 12 fs/hugetlbfs/inode.c | 23 - fs/inode.c | 46 +- fs/internal.h | 1 fs/nilfs2/alloc.c | 2 fs/nilfs2/alloc.h | 2 fs/nilfs2/bmap.c | 2 fs/nilfs2/bmap.h | 2 fs/nilfs2/btnode.c | 2 fs/nilfs2/btnode.h | 2 fs/nilfs2/btree.c | 2 fs/nilfs2/btree.h | 2 fs/nilfs2/cpfile.c | 2 fs/nilfs2/cpfile.h | 2 fs/nilfs2/dat.c | 2 fs/nilfs2/dat.h | 2 fs/nilfs2/dir.c | 2 fs/nilfs2/direct.c | 2 fs/nilfs2/direct.h | 2 fs/nilfs2/file.c | 2 fs/nilfs2/gcinode.c | 2 fs/nilfs2/ifile.c | 2 fs/nilfs2/ifile.h | 2 fs/nilfs2/inode.c | 2 fs/nilfs2/ioctl.c | 2 fs/nilfs2/mdt.c | 2 fs/nilfs2/mdt.h | 2 fs/nilfs2/namei.c | 2 fs/nilfs2/nilfs.h | 2 fs/nilfs2/page.c | 2 fs/nilfs2/page.h | 2 fs/nilfs2/recovery.c | 2 fs/nilfs2/segbuf.c | 2 fs/nilfs2/segbuf.h | 2 fs/nilfs2/segment.c | 2 fs/nilfs2/segment.h | 2 fs/nilfs2/sufile.c | 2 fs/nilfs2/sufile.h | 2 fs/nilfs2/super.c | 2 fs/nilfs2/sysfs.c | 78 ++-- fs/nilfs2/sysfs.h | 2 fs/nilfs2/the_nilfs.c | 2 fs/nilfs2/the_nilfs.h | 2 fs/proc/base.c | 21 - fs/proc/vmcore.c | 109 ++++-- fs/ramfs/inode.c | 11 fs/seq_file.c | 16 fs/sysv/super.c | 6 include/asm-generic/sections.h | 75 +++- include/kunit/test.h | 13 include/linux/bottom_half.h | 3 include/linux/container_of.h | 52 ++- include/linux/crash_dump.h | 30 + include/linux/delay.h | 2 include/linux/fs.h | 1 include/linux/fwnode.h | 1 include/linux/generic-radix-tree.h | 3 include/linux/hugetlb.h | 6 include/linux/instruction_pointer.h | 8 include/linux/kallsyms.h | 21 - include/linux/kernel.h | 39 -- include/linux/list.h | 4 include/linux/llist.h | 4 include/linux/pagemap.h | 50 ++ include/linux/plist.h | 5 include/linux/radix-tree.h | 4 include/linux/rwsem.h | 1 include/linux/sbitmap.h | 11 include/linux/seq_file.h | 19 + include/linux/signal.h | 1 include/linux/smp.h | 1 include/linux/spinlock.h | 1 include/linux/stackdepot.h | 5 include/linux/string_helpers.h | 1 include/media/media-entity.h | 3 init/main.c | 4 ipc/ipc_sysctl.c | 42 +- ipc/shm.c | 8 kernel/extable.c | 33 - kernel/fork.c | 9 kernel/kcov.c | 40 +- kernel/locking/lockdep.c | 3 kernel/resource.c | 54 ++- kernel/trace/ftrace.c | 2 lib/scatterlist.c | 11 lib/stackdepot.c | 46 ++ lib/vsprintf.c | 3 mm/Kconfig | 7 mm/filemap.c | 8 mm/kasan/report.c | 17 - mm/memfd.c | 4 mm/mmap.c | 3 mm/page_owner.c | 18 - mm/truncate.c | 19 + mm/vmscan.c | 7 mm/workingset.c | 10 net/sysctl_net.c | 2 scripts/checkpatch.pl | 33 + scripts/const_structs.checkpatch | 4 scripts/gdb/linux/symbols.py | 3 tools/testing/selftests/kselftest/runner.sh | 28 + tools/testing/selftests/proc/.gitignore | 1 tools/testing/selftests/proc/Makefile | 2 tools/testing/selftests/proc/proc-tid0.c | 81 ++++ 132 files changed, 1206 insertions(+), 681 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-11-05 20:34 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-11-05 20:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 262 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813 Subsystems affected by this patch series: scripts ocfs2 vfs mm/slab-generic mm/slab mm/slub mm/kconfig mm/dax mm/kasan mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mprotect mm/mremap mm/iomap mm/tracing mm/vmalloc mm/pagealloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/tools mm/memblock mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/readahead mm/nommu mm/ksm mm/vmstat mm/madvise mm/memory-hotplug mm/rmap mm/zsmalloc mm/highmem mm/zram mm/cleanups mm/kfence mm/damon Subsystem: scripts Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Sven Eckelmann <sven@narfation.org>: scripts/spelling.txt: fix "mistake" version of "synchronization" weidonghui <weidonghui@allwinnertech.com>: scripts/decodecode: fix faulting instruction no print when opps.file is DOS format Subsystem: ocfs2 Chenyuan Mi <cymi20@fudan.edu.cn>: ocfs2: fix handle refcount leak in two exception handling paths Valentin Vidic <vvidic@valentin-vidic.from.hr>: ocfs2: cleanup journal init and shutdown Colin Ian King <colin.king@canonical.com>: ocfs2/dlm: remove redundant assignment of variable ret Jan Kara <jack@suse.cz>: Patch series "ocfs2: Truncate data corruption fix": ocfs2: fix data corruption on truncate ocfs2: do not zero pages beyond i_size Subsystem: vfs Arnd Bergmann <arnd@arndb.de>: fs/posix_acl.c: avoid -Wempty-body warning Jia He <justin.he@arm.com>: d_path: fix Kernel doc validator complaining Subsystem: mm/slab-generic "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move kvmalloc-related functions to slab.h Subsystem: mm/slab Shi Lei <shi_lei@massclouds.com>: mm/slab.c: remove useless lines in enable_cpucache() Subsystem: mm/slub Kefeng Wang <wangkefeng.wang@huawei.com>: slub: add back check for free nonslab objects Vlastimil Babka <vbabka@suse.cz>: mm, slub: change percpu partial accounting from objects to pages mm/slub: increase default cpu partial list sizes Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm, slub: use prefetchw instead of prefetch Subsystem: mm/kconfig Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: disable NUMA_BALANCING_DEFAULT_ENABLED and TRANSPARENT_HUGEPAGE on PREEMPT_RT Subsystem: mm/dax Christoph Hellwig <hch@lst.de>: mm: don't include <linux/dax.h> in <linux/mempolicy.h> Subsystem: mm/kasan Marco Elver <elver@google.com>: Patch series "stackdepot, kasan, workqueue: Avoid expanding stackdepot slabs when holding raw_spin_lock", v2: lib/stackdepot: include gfp.h lib/stackdepot: remove unused function argument lib/stackdepot: introduce __stack_depot_save() kasan: common: provide can_alloc in kasan_save_stack() kasan: generic: introduce kasan_record_aux_stack_noalloc() workqueue, kasan: avoid alloc_pages() when recording stack "Matthew Wilcox (Oracle)" <willy@infradead.org>: kasan: fix tag for large allocations when using CONFIG_SLAB Peter Collingbourne <pcc@google.com>: kasan: test: add memcpy test that avoids out-of-bounds write Subsystem: mm/debug Peter Xu <peterx@redhat.com>: Patch series "mm/smaps: Fixes and optimizations on shmem swap handling": mm/smaps: fix shmem pte hole swap calculation mm/smaps: use vma->vm_pgoff directly when counting partial swap mm/smaps: simplify shmem handling of pte holes Guo Ren <guoren@linux.alibaba.com>: mm: debug_vm_pgtable: don't use __P000 directly Kees Cook <keescook@chromium.org>: kasan: test: bypass __alloc_size checks Patch series "Add __alloc_size()", v3: rapidio: avoid bogus __alloc_size warning Compiler Attributes: add __alloc_size() for better bounds checking slab: clean up function prototypes slab: add __alloc_size attributes for better bounds checking mm/kvmalloc: add __alloc_size attributes for better bounds checking mm/vmalloc: add __alloc_size attributes for better bounds checking mm/page_alloc: add __alloc_size attributes for better bounds checking percpu: add __alloc_size attributes for better bounds checking Yinan Zhang <zhangyinan2019@email.szu.edu.cn>: mm/page_ext.c: fix a comment Subsystem: mm/pagecache David Howells <dhowells@redhat.com>: mm: stop filemap_read() from grabbing a superfluous page Christoph Hellwig <hch@lst.de>: Patch series "simplify bdi unregistation": mm: export bdi_unregister mtd: call bdi_unregister explicitly fs: explicitly unregister per-superblock BDIs mm: don't automatically unregister bdis mm: simplify bdi refcounting Jens Axboe <axboe@kernel.dk>: mm: don't read i_size of inode unless we need it "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove bogus VM_BUG_ON Jens Axboe <axboe@kernel.dk>: mm: move more expensive part of XA setup out of mapping check Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: mm/gup: further simplify __gup_device_huge() Subsystem: mm/swap Xu Wang <vulab@iscas.ac.cn>: mm/swapfile: remove needless request_queue NULL pointer check Rafael Aquini <aquini@redhat.com>: mm/swapfile: fix an integer overflow in swap_show() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: optimise put_pages_list() Subsystem: mm/memcg Peter Xu <peterx@redhat.com>: mm/memcg: drop swp_entry_t* in mc_handle_file_pte() Shakeel Butt <shakeelb@google.com>: memcg: flush stats only if updated memcg: unify memcg stat flushing Waiman Long <longman@redhat.com>: mm/memcg: remove obsolete memcg_free_kmem() Len Baker <len.baker@gmx.com>: mm/list_lru.c: prefer struct_size over open coded arithmetic Shakeel Butt <shakeelb@google.com>: memcg, kmem: further deprecate kmem.limit_in_bytes Muchun Song <songmuchun@bytedance.com>: mm: list_lru: remove holding lru lock mm: list_lru: fix the return value of list_lru_count_one() mm: memcontrol: remove kmemcg_id reparenting mm: memcontrol: remove the kmem states mm: list_lru: only add memcg-aware lrus to the global lru list Vasily Averin <vvs@virtuozzo.com>: Patch series "memcg: prohibit unconditional exceeding the limit of dying tasks", v3: mm, oom: pagefault_out_of_memory: don't force global OOM for dying tasks Michal Hocko <mhocko@suse.com>: mm, oom: do not trigger out_of_memory from the #PF Vasily Averin <vvs@virtuozzo.com>: memcg: prohibit unconditional exceeding the limit of dying tasks Subsystem: mm/pagemap Peng Liu <liupeng256@huawei.com>: mm/mmap.c: fix a data race of mm->total_vm Rolf Eike Beer <eb@emlix.com>: mm: use __pfn_to_section() instead of open coding it Amit Daniel Kachhap <amit.kachhap@arm.com>: mm/memory.c: avoid unnecessary kernel/user pointer conversion Nadav Amit <namit@vmware.com>: mm/memory.c: use correct VMA flags when freeing page-tables Peter Xu <peterx@redhat.com>: Patch series "mm: A few cleanup patches around zap, shmem and uffd", v4: mm/shmem: unconditionally set pte dirty in mfill_atomic_install_pte mm: clear vmf->pte after pte_unmap_same() returns mm: drop first_index/last_index in zap_details mm: add zap_skip_check_mapping() helper Qi Zheng <zhengqi.arch@bytedance.com>: Patch series "Do some code cleanups related to mm", v3: mm: introduce pmd_install() helper mm: remove redundant smp_wmb() Tiberiu A Georgescu <tiberiu.georgescu@nutanix.com>: Documentation: update pagemap with shmem exceptions Nicholas Piggin <npiggin@gmail.com>: Patch series "shoot lazy tlbs", v4: lazy tlb: introduce lazy mm refcount helper functions lazy tlb: allow lazy tlb mm refcounting to be configurable lazy tlb: shoot lazies, a non-refcounting lazy tlb option powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN Lukas Bulwahn <lukas.bulwahn@gmail.com>: memory: remove unused CONFIG_MEM_BLOCK_SIZE Subsystem: mm/mprotect Liu Song <liu.song11@zte.com.cn>: mm/mprotect.c: avoid repeated assignment in do_mprotect_pkey() Subsystem: mm/mremap Dmitry Safonov <dima@arista.com>: mm/mremap: don't account pages in vma_to_resize() Subsystem: mm/iomap Lucas De Marchi <lucas.demarchi@intel.com>: include/linux/io-mapping.h: remove fallback for writecombine Subsystem: mm/tracing Gang Li <ligang.bdlg@bytedance.com>: mm: mmap_lock: remove redundant newline in TP_printk mm: mmap_lock: use DECLARE_EVENT_CLASS and DEFINE_EVENT_FN Subsystem: mm/vmalloc Vasily Averin <vvs@virtuozzo.com>: mm/vmalloc: repair warn_alloc()s in __vmalloc_area_node() Peter Zijlstra <peterz@infradead.org>: mm/vmalloc: don't allow VM_NO_GUARD on vmap() Eric Dumazet <edumazet@google.com>: mm/vmalloc: make show_numa_info() aware of hugepage mappings mm/vmalloc: make sure to dump unpurged areas in /proc/vmallocinfo "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: do not adjust the search size for alignment overhead mm/vmalloc: check various alignments when debugging Vasily Averin <vvs@virtuozzo.com>: vmalloc: back off when the current task is OOM-killed Kefeng Wang <wangkefeng.wang@huawei.com>: vmalloc: choose a better start address in vm_area_register_early() arm64: support page mapping percpu first chunk allocator kasan: arm64: fix pcpu_page_first_chunk crash with KASAN_VMALLOC Michal Hocko <mhocko@suse.com>: mm/vmalloc: be more explicit about supported gfp flags Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: introduce alloc_pages_bulk_array_mempolicy to accelerate memory allocation Changcheng Deng <deng.changcheng@zte.com.cn>: lib/test_vmalloc.c: use swap() to make code cleaner Subsystem: mm/pagealloc Eric Dumazet <edumazet@google.com>: mm/large system hash: avoid possible NULL deref in alloc_large_system_hash Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for page_alloc", v2: mm/page_alloc.c: remove meaningless VM_BUG_ON() in pindex_to_order() mm/page_alloc.c: simplify the code by using macro K() mm/page_alloc.c: fix obsolete comment in free_pcppages_bulk() mm/page_alloc.c: use helper function zone_spans_pfn() mm/page_alloc.c: avoid allocating highmem pages via alloc_pages_exact[_nid] Bharata B Rao <bharata@amd.com>: Patch series "Fix NUMA nodes fallback list ordering": mm/page_alloc: print node fallback order Krupa Ramakrishnan <krupa.ramakrishnan@amd.com>: mm/page_alloc: use accumulated load when building node fallback list Geert Uytterhoeven <geert+renesas@glider.be>: Patch series "Fix NUMA without SMP": mm: move node_reclaim_distance to fix NUMA without SMP mm: move fold_vm_numa_events() to fix NUMA without SMP Eric Dumazet <edumazet@google.com>: mm/page_alloc.c: do not acquire zone lock in is_free_buddy_page() Feng Tang <feng.tang@intel.com>: mm/page_alloc: detect allocation forbidden by cpuset and bail out early Liangcai Fan <liangcaifan19@gmail.com>: mm/page_alloc.c: show watermark_boost of zone in zoneinfo Christophe Leroy <christophe.leroy@csgroup.eu>: mm: create a new system state and fix core_kernel_text() mm: make generic arch_is_kernel_initmem_freed() do what it says powerpc: use generic version of arch_is_kernel_initmem_freed() s390: use generic version of arch_is_kernel_initmem_freed() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: page_alloc: use migrate_disable() in drain_local_pages_wq() Wang ShaoBo <bobo.shaobowang@huawei.com>: mm/page_alloc: use clamp() to simplify code Subsystem: mm/memory-failure Marco Elver <elver@google.com>: mm: fix data race in PagePoisoned() Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/memory_failure: constify static mm_walk_ops Yang Shi <shy828301@gmail.com>: Patch series "Solve silent data loss caused by poisoned page cache (shmem/tmpfs)", v5: mm: filemap: coding style cleanup for filemap_map_pmd() mm: hwpoison: refactor refcount check handling mm: shmem: don't truncate page if memory failure happens mm: hwpoison: handle non-anonymous THP correctly Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: mm/hugetlb: drop __unmap_hugepage_range definition from hugetlb.h Mike Kravetz <mike.kravetz@oracle.com>: Patch series "hugetlb: add demote/split page functionality", v4: hugetlb: add demote hugetlb page sysfs interfaces mm/cma: add cma_pages_valid to determine if pages are in CMA hugetlb: be sure to free demoted CMA pages to CMA hugetlb: add demote bool to gigantic page routines hugetlb: add hugetlb demote page support Liangcai Fan <liangcaifan19@gmail.com>: mm: khugepaged: recalculate min_free_kbytes after stopping khugepaged Mina Almasry <almasrymina@google.com>: mm, hugepages: add mremap() support for hugepage backed vma mm, hugepages: add hugetlb vma mremap() test Baolin Wang <baolin.wang@linux.alibaba.com>: hugetlb: support node specified when using cma for gigantic hugepages Ran Jianping <ran.jianping@zte.com.cn>: mm: remove duplicate include in hugepage-mremap.c Baolin Wang <baolin.wang@linux.alibaba.com>: Patch series "Some cleanups and improvements for hugetlb": hugetlb_cgroup: remove unused hugetlb_cgroup_from_counter macro hugetlb: replace the obsolete hugetlb_instantiation_mutex in the comments hugetlb: remove redundant validation in has_same_uncharge_info() hugetlb: remove redundant VM_BUG_ON() in add_reservation_in_range() Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: remove unnecessary set_page_count in prep_compound_gigantic_page Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: Patch series "Small userfaultfd selftest fixups", v2: userfaultfd/selftests: don't rely on GNU extensions for random numbers userfaultfd/selftests: fix feature support detection userfaultfd/selftests: fix calculation of expected ioctls Subsystem: mm/vmscan Miaohe Lin <linmiaohe@huawei.com>: mm/page_isolation: fix potential missing call to unset_migratetype_isolate() mm/page_isolation: guard against possible putback unisolated page Kai Song <songkai01@inspur.com>: mm/vmscan.c: fix -Wunused-but-set-variable warning Mel Gorman <mgorman@techsingularity.net>: Patch series "Remove dependency on congestion_wait in mm/", v5. Patch series: mm/vmscan: throttle reclaim until some writeback completes if congested mm/vmscan: throttle reclaim and compaction when too may pages are isolated mm/vmscan: throttle reclaim when no progress is being made mm/writeback: throttle based on page writeback instead of congestion mm/page_alloc: remove the throttling logic from the page allocator mm/vmscan: centralise timeout values for reclaim_throttle mm/vmscan: increase the timeout if page reclaim is not making progress mm/vmscan: delay waking of tasks throttled on NOPROGRESS Yuanzheng Song <songyuanzheng@huawei.com>: mm/vmpressure: fix data-race with memcg->socket_pressure Subsystem: mm/tools Zhenliang Wei <weizhenliang@huawei.com>: tools/vm/page_owner_sort.c: count and sort by mem Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "tools/vm/page-types.c: a few improvements": tools/vm/page-types.c: make walk_file() aware of address range option tools/vm/page-types.c: move show_file() to summary output tools/vm/page-types.c: print file offset in hexadecimal Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "memblock: cleanup memblock_free interface", v2: arch_numa: simplify numa_distance allocation xen/x86: free_p2m_page: use memblock_free_ptr() to free a virtual pointer memblock: drop memblock_free_early_nid() and memblock_free_early() memblock: stop aliasing __memblock_free_late with memblock_free_late memblock: rename memblock_free to memblock_phys_free memblock: use memblock_free for freeing virtual pointers Subsystem: mm/oom-kill Sultan Alsawaf <sultan@kerneltoast.com>: mm: mark the OOM reaper thread as freezable Subsystem: mm/hugetlbfs Zhenguo Yao <yaozhenguo1@gmail.com>: hugetlbfs: extend the definition of hugepages parameter to support node allocation Subsystem: mm/migration John Hubbard <jhubbard@nvidia.com>: mm/migrate: de-duplicate migrate_reason strings Yang Shi <shy828301@gmail.com>: mm: migrate: make demotion knob depend on migration Subsystem: mm/thp "George G. Davis" <davis.george@siemens.com>: selftests/vm/transhuge-stress: fix ram size thinko Rongwei Wang <rongwei.wang@linux.alibaba.com>: Patch series "fix two bugs for file THP": mm, thp: lock filemap when truncating page cache mm, thp: fix incorrect unmap behavior for private pages Subsystem: mm/readahead Lin Feng <linf@wangsu.com>: mm/readahead.c: fix incorrect comments for get_init_ra_size Subsystem: mm/nommu Kefeng Wang <wangkefeng.wang@huawei.com>: mm: nommu: kill arch_get_unmapped_area() Subsystem: mm/ksm "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: selftest/vm: fix ksm selftest to run with different NUMA topologies Pedro Demarchi Gomes <pedrodemargomes@gmail.com>: selftests: vm: add KSM huge pages merging time test Subsystem: mm/vmstat Liu Shixin <liushixin2@huawei.com>: mm/vmstat: annotate data race for zone->free_area[order].nr_free Lin Feng <linf@wangsu.com>: mm: vmstat.c: make extfrag_index show more pretty Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: selftests/vm: make MADV_POPULATE_(READ|WRITE) use in-tree headers Subsystem: mm/memory-hotplug Tang Yizhou <tangyizhou@huawei.com>: mm/memory_hotplug: add static qualifier for online_policy_to_str() David Hildenbrand <david@redhat.com>: Patch series "memory-hotplug.rst: document the "auto-movable" online policy": memory-hotplug.rst: fix two instances of "movablecore" that should be "movable_node" memory-hotplug.rst: fix wrong /sys/module/memory_hotplug/parameters/ path memory-hotplug.rst: document the "auto-movable" online policy Patch series "mm/memory_hotplug: Kconfig and 32 bit cleanups": mm/memory_hotplug: remove CONFIG_X86_64_ACPI_NUMA dependency from CONFIG_MEMORY_HOTPLUG mm/memory_hotplug: remove CONFIG_MEMORY_HOTPLUG_SPARSE mm/memory_hotplug: restrict CONFIG_MEMORY_HOTPLUG to 64 bit mm/memory_hotplug: remove HIGHMEM leftovers mm/memory_hotplug: remove stale function declarations x86: remove memory hotplug support on X86_32 Patch series "mm/memory_hotplug: full support for add_memory_driver_managed() with CONFIG_ARCH_KEEP_MEMBLOCK", v2: mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource() memblock: improve MEMBLOCK_HOTPLUG documentation memblock: allow to specify flags with memblock_add_node() memblock: add MEMBLOCK_DRIVER_MANAGED to mimic IORESOURCE_SYSRAM_DRIVER_MANAGED mm/memory_hotplug: indicate MEMBLOCK_DRIVER_MANAGED with IORESOURCE_SYSRAM_DRIVER_MANAGED Subsystem: mm/rmap Alistair Popple <apopple@nvidia.com>: mm/rmap.c: avoid double faults migrating device private pages Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: close race window between zs_pool_dec_isolated() and zs_unregister_migration() Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: mm/highmem: remove deprecated kmap_atomic Subsystem: mm/zram Jaewon Kim <jaewon31.kim@samsung.com>: zram_drv: allow reclaim on bio_alloc Dan Carpenter <dan.carpenter@oracle.com>: zram: off by one in read_block_state() Brian Geffon <bgeffon@google.com>: zram: introduce an aged idle interface Subsystem: mm/cleanups Stephen Kitt <steve@sk2.org>: mm: remove HARDENED_USERCOPY_FALLBACK Mianhan Liu <liumh1@shanghaitech.edu.cn>: include/linux/mm.h: move nr_free_buffer_pages from swap.h to mm.h Subsystem: mm/kfence Marco Elver <elver@google.com>: stacktrace: move filter_irq_stacks() to kernel/stacktrace.c kfence: count unexpectedly skipped allocations kfence: move saving stack trace of allocations into __kfence_alloc() kfence: limit currently covered allocations when pool nearly full kfence: add note to documentation about skipping covered allocations kfence: test: use kunit_skip() to skip tests kfence: shorten critical sections of alloc/free kfence: always use static branches to guard kfence_alloc() kfence: default to dynamic branch instead of static keys mode Subsystem: mm/damon Geert Uytterhoeven <geert@linux-m68k.org>: mm/damon: grammar s/works/work/ SeongJae Park <sjpark@amazon.de>: Documentation/vm: move user guides to admin-guide/mm/ SeongJae Park <sj@kernel.org>: MAINTAINERS: update SeongJae's email address SeongJae Park <sjpark@amazon.de>: docs/vm/damon: remove broken reference include/linux/damon.h: fix kernel-doc comments for 'damon_callback' SeongJae Park <sj@kernel.org>: mm/damon/core: print kdamond start log in debug mode only Changbin Du <changbin.du@gmail.com>: mm/damon: remove unnecessary do_exit() from kdamond mm/damon: needn't hold kdamond_lock to print pid of kdamond Colin Ian King <colin.king@canonical.com>: mm/damon/core: nullify pointer ctx->kdamond with a NULL SeongJae Park <sj@kernel.org>: Patch series "Implement Data Access Monitoring-based Memory Operation Schemes": mm/damon/core: account age of target regions mm/damon/core: implement DAMON-based Operation Schemes (DAMOS) mm/damon/vaddr: support DAMON-based Operation Schemes mm/damon/dbgfs: support DAMON-based Operation Schemes mm/damon/schemes: implement statistics feature selftests/damon: add 'schemes' debugfs tests Docs/admin-guide/mm/damon: document DAMON-based Operation Schemes Patch series "DAMON: Support Physical Memory Address Space Monitoring:: mm/damon/dbgfs: allow users to set initial monitoring target regions mm/damon/dbgfs-test: add a unit test case for 'init_regions' Docs/admin-guide/mm/damon: document 'init_regions' feature mm/damon/vaddr: separate commonly usable functions mm/damon: implement primitives for physical address space monitoring mm/damon/dbgfs: support physical memory monitoring Docs/DAMON: document physical memory monitoring support Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/damon/vaddr: constify static mm_walk_ops Rongwei Wang <rongwei.wang@linux.alibaba.com>: mm/damon/dbgfs: remove unnecessary variables SeongJae Park <sj@kernel.org>: mm/damon/paddr: support the pageout scheme mm/damon/schemes: implement size quota for schemes application speed control mm/damon/schemes: skip already charged targets and regions mm/damon/schemes: implement time quota mm/damon/dbgfs: support quotas of schemes mm/damon/selftests: support schemes quotas mm/damon/schemes: prioritize regions within the quotas mm/damon/vaddr,paddr: support pageout prioritization mm/damon/dbgfs: support prioritization weights tools/selftests/damon: update for regions prioritization of schemes mm/damon/schemes: activate schemes based on a watermarks mechanism mm/damon/dbgfs: support watermarks selftests/damon: support watermarks mm/damon: introduce DAMON-based Reclamation (DAMON_RECLAIM) Documentation/admin-guide/mm/damon: add a document for DAMON_RECLAIM Xin Hao <xhao@linux.alibaba.com>: Patch series "mm/damon: Fix some small bugs", v4: mm/damon: remove unnecessary variable initialization mm/damon/dbgfs: add adaptive_targets list check before enable monitor_on SeongJae Park <sj@kernel.org>: Patch series "Fix trivial nits in Documentation/admin-guide/mm": Docs/admin-guide/mm/damon/start: fix wrong example commands Docs/admin-guide/mm/damon/start: fix a wrong link Docs/admin-guide/mm/damon/start: simplify the content Docs/admin-guide/mm/pagemap: wordsmith page flags descriptions Changbin Du <changbin.du@gmail.com>: mm/damon: simplify stop mechanism Colin Ian King <colin.i.king@googlemail.com>: mm/damon: fix a few spelling mistakes in comments and a pr_debug message Changbin Du <changbin.du@gmail.com>: mm/damon: remove return value from before_terminate callback a/Documentation/admin-guide/blockdev/zram.rst | 8 a/Documentation/admin-guide/cgroup-v1/memory.rst | 11 a/Documentation/admin-guide/kernel-parameters.txt | 14 a/Documentation/admin-guide/mm/damon/index.rst | 1 a/Documentation/admin-guide/mm/damon/reclaim.rst | 235 +++ a/Documentation/admin-guide/mm/damon/start.rst | 140 + a/Documentation/admin-guide/mm/damon/usage.rst | 117 + a/Documentation/admin-guide/mm/hugetlbpage.rst | 42 a/Documentation/admin-guide/mm/memory-hotplug.rst | 147 +- a/Documentation/admin-guide/mm/pagemap.rst | 75 - a/Documentation/core-api/memory-hotplug.rst | 3 a/Documentation/dev-tools/kfence.rst | 23 a/Documentation/translations/zh_CN/core-api/memory-hotplug.rst | 4 a/Documentation/vm/damon/design.rst | 29 a/Documentation/vm/damon/faq.rst | 5 a/Documentation/vm/damon/index.rst | 1 a/Documentation/vm/page_owner.rst | 23 a/MAINTAINERS | 2 a/Makefile | 15 a/arch/Kconfig | 28 a/arch/alpha/kernel/core_irongate.c | 6 a/arch/arc/mm/init.c | 6 a/arch/arm/mach-hisi/platmcpm.c | 2 a/arch/arm/mach-rpc/ecard.c | 2 a/arch/arm/mm/init.c | 2 a/arch/arm64/Kconfig | 4 a/arch/arm64/mm/kasan_init.c | 16 a/arch/arm64/mm/mmu.c | 4 a/arch/ia64/mm/contig.c | 2 a/arch/ia64/mm/init.c | 2 a/arch/m68k/mm/mcfmmu.c | 3 a/arch/m68k/mm/motorola.c | 6 a/arch/mips/loongson64/init.c | 4 a/arch/mips/mm/init.c | 6 a/arch/mips/sgi-ip27/ip27-memory.c | 3 a/arch/mips/sgi-ip30/ip30-setup.c | 6 a/arch/powerpc/Kconfig | 1 a/arch/powerpc/configs/skiroot_defconfig | 1 a/arch/powerpc/include/asm/machdep.h | 2 a/arch/powerpc/include/asm/sections.h | 13 a/arch/powerpc/kernel/dt_cpu_ftrs.c | 8 a/arch/powerpc/kernel/paca.c | 8 a/arch/powerpc/kernel/setup-common.c | 4 a/arch/powerpc/kernel/setup_64.c | 6 a/arch/powerpc/kernel/smp.c | 2 a/arch/powerpc/mm/book3s64/radix_tlb.c | 4 a/arch/powerpc/mm/hugetlbpage.c | 9 a/arch/powerpc/platforms/powernv/pci-ioda.c | 4 a/arch/powerpc/platforms/powernv/setup.c | 4 a/arch/powerpc/platforms/pseries/setup.c | 2 a/arch/powerpc/platforms/pseries/svm.c | 9 a/arch/riscv/kernel/setup.c | 10 a/arch/s390/include/asm/sections.h | 12 a/arch/s390/kernel/setup.c | 11 a/arch/s390/kernel/smp.c | 6 a/arch/s390/kernel/uv.c | 2 a/arch/s390/mm/init.c | 3 a/arch/s390/mm/kasan_init.c | 2 a/arch/sh/boards/mach-ap325rxa/setup.c | 2 a/arch/sh/boards/mach-ecovec24/setup.c | 4 a/arch/sh/boards/mach-kfr2r09/setup.c | 2 a/arch/sh/boards/mach-migor/setup.c | 2 a/arch/sh/boards/mach-se/7724/setup.c | 4 a/arch/sparc/kernel/smp_64.c | 4 a/arch/um/kernel/mem.c | 4 a/arch/x86/Kconfig | 6 a/arch/x86/kernel/setup.c | 4 a/arch/x86/kernel/setup_percpu.c | 2 a/arch/x86/mm/init.c | 2 a/arch/x86/mm/init_32.c | 31 a/arch/x86/mm/kasan_init_64.c | 4 a/arch/x86/mm/numa.c | 2 a/arch/x86/mm/numa_emulation.c | 2 a/arch/x86/xen/mmu_pv.c | 8 a/arch/x86/xen/p2m.c | 4 a/arch/x86/xen/setup.c | 6 a/drivers/base/Makefile | 2 a/drivers/base/arch_numa.c | 96 + a/drivers/base/node.c | 9 a/drivers/block/zram/zram_drv.c | 66 a/drivers/firmware/efi/memmap.c | 2 a/drivers/hwmon/occ/p9_sbe.c | 1 a/drivers/macintosh/smu.c | 2 a/drivers/mmc/core/mmc_test.c | 1 a/drivers/mtd/mtdcore.c | 1 a/drivers/of/kexec.c | 4 a/drivers/of/of_reserved_mem.c | 5 a/drivers/rapidio/devices/rio_mport_cdev.c | 9 a/drivers/s390/char/sclp_early.c | 4 a/drivers/usb/early/xhci-dbc.c | 10 a/drivers/virtio/Kconfig | 2 a/drivers/xen/swiotlb-xen.c | 4 a/fs/d_path.c | 8 a/fs/exec.c | 4 a/fs/ocfs2/alloc.c | 21 a/fs/ocfs2/dlm/dlmrecovery.c | 1 a/fs/ocfs2/file.c | 8 a/fs/ocfs2/inode.c | 4 a/fs/ocfs2/journal.c | 28 a/fs/ocfs2/journal.h | 3 a/fs/ocfs2/super.c | 40 a/fs/open.c | 16 a/fs/posix_acl.c | 3 a/fs/proc/task_mmu.c | 28 a/fs/super.c | 3 a/include/asm-generic/sections.h | 14 a/include/linux/backing-dev-defs.h | 3 a/include/linux/backing-dev.h | 1 a/include/linux/cma.h | 1 a/include/linux/compiler-gcc.h | 8 a/include/linux/compiler_attributes.h | 10 a/include/linux/compiler_types.h | 12 a/include/linux/cpuset.h | 17 a/include/linux/damon.h | 258 +++ a/include/linux/fs.h | 1 a/include/linux/gfp.h | 8 a/include/linux/highmem.h | 28 a/include/linux/hugetlb.h | 36 a/include/linux/io-mapping.h | 6 a/include/linux/kasan.h | 8 a/include/linux/kernel.h | 1 a/include/linux/kfence.h | 21 a/include/linux/memblock.h | 48 a/include/linux/memcontrol.h | 9 a/include/linux/memory.h | 26 a/include/linux/memory_hotplug.h | 3 a/include/linux/mempolicy.h | 5 a/include/linux/migrate.h | 23 a/include/linux/migrate_mode.h | 13 a/include/linux/mm.h | 57 a/include/linux/mm_types.h | 2 a/include/linux/mmzone.h | 41 a/include/linux/node.h | 4 a/include/linux/page-flags.h | 2 a/include/linux/percpu.h | 6 a/include/linux/sched/mm.h | 25 a/include/linux/slab.h | 181 +- a/include/linux/slub_def.h | 13 a/include/linux/stackdepot.h | 8 a/include/linux/stacktrace.h | 1 a/include/linux/swap.h | 1 a/include/linux/vmalloc.h | 24 a/include/trace/events/mmap_lock.h | 50 a/include/trace/events/vmscan.h | 42 a/include/trace/events/writeback.h | 7 a/init/Kconfig | 2 a/init/initramfs.c | 4 a/init/main.c | 6 a/kernel/cgroup/cpuset.c | 23 a/kernel/cpu.c | 2 a/kernel/dma/swiotlb.c | 6 a/kernel/exit.c | 2 a/kernel/extable.c | 2 a/kernel/fork.c | 51 a/kernel/kexec_file.c | 5 a/kernel/kthread.c | 21 a/kernel/locking/lockdep.c | 15 a/kernel/printk/printk.c | 4 a/kernel/sched/core.c | 37 a/kernel/sched/sched.h | 4 a/kernel/sched/topology.c | 1 a/kernel/stacktrace.c | 30 a/kernel/tsacct.c | 2 a/kernel/workqueue.c | 2 a/lib/Kconfig.debug | 2 a/lib/Kconfig.kfence | 26 a/lib/bootconfig.c | 2 a/lib/cpumask.c | 6 a/lib/stackdepot.c | 76 - a/lib/test_kasan.c | 26 a/lib/test_kasan_module.c | 2 a/lib/test_vmalloc.c | 6 a/mm/Kconfig | 10 a/mm/backing-dev.c | 65 a/mm/cma.c | 26 a/mm/compaction.c | 12 a/mm/damon/Kconfig | 24 a/mm/damon/Makefile | 4 a/mm/damon/core.c | 500 ++++++- a/mm/damon/dbgfs-test.h | 56 a/mm/damon/dbgfs.c | 486 +++++- a/mm/damon/paddr.c | 275 +++ a/mm/damon/prmtv-common.c | 133 + a/mm/damon/prmtv-common.h | 20 a/mm/damon/reclaim.c | 356 ++++ a/mm/damon/vaddr-test.h | 2 a/mm/damon/vaddr.c | 167 +- a/mm/debug.c | 20 a/mm/debug_vm_pgtable.c | 7 a/mm/filemap.c | 78 - a/mm/gup.c | 5 a/mm/highmem.c | 6 a/mm/hugetlb.c | 713 +++++++++- a/mm/hugetlb_cgroup.c | 3 a/mm/internal.h | 26 a/mm/kasan/common.c | 8 a/mm/kasan/generic.c | 16 a/mm/kasan/kasan.h | 2 a/mm/kasan/shadow.c | 5 a/mm/kfence/core.c | 214 ++- a/mm/kfence/kfence.h | 2 a/mm/kfence/kfence_test.c | 14 a/mm/khugepaged.c | 10 a/mm/list_lru.c | 58 a/mm/memblock.c | 35 a/mm/memcontrol.c | 217 +-- a/mm/memory-failure.c | 117 + a/mm/memory.c | 166 +- a/mm/memory_hotplug.c | 57 a/mm/mempolicy.c | 143 +- a/mm/migrate.c | 61 a/mm/mmap.c | 2 a/mm/mprotect.c | 5 a/mm/mremap.c | 86 - a/mm/nommu.c | 6 a/mm/oom_kill.c | 27 a/mm/page-writeback.c | 13 a/mm/page_alloc.c | 119 - a/mm/page_ext.c | 2 a/mm/page_isolation.c | 29 a/mm/percpu.c | 24 a/mm/readahead.c | 2 a/mm/rmap.c | 8 a/mm/shmem.c | 44 a/mm/slab.c | 16 a/mm/slab_common.c | 8 a/mm/slub.c | 117 - a/mm/sparse-vmemmap.c | 2 a/mm/sparse.c | 6 a/mm/swap.c | 23 a/mm/swapfile.c | 6 a/mm/userfaultfd.c | 8 a/mm/vmalloc.c | 107 + a/mm/vmpressure.c | 2 a/mm/vmscan.c | 194 ++ a/mm/vmstat.c | 76 - a/mm/zsmalloc.c | 7 a/net/ipv4/tcp.c | 1 a/net/ipv4/udp.c | 1 a/net/netfilter/ipvs/ip_vs_ctl.c | 1 a/net/openvswitch/meter.c | 1 a/net/sctp/protocol.c | 1 a/scripts/checkpatch.pl | 3 a/scripts/decodecode | 2 a/scripts/spelling.txt | 18 a/security/Kconfig | 14 a/tools/testing/selftests/damon/debugfs_attrs.sh | 25 a/tools/testing/selftests/memory-hotplug/config | 1 a/tools/testing/selftests/vm/.gitignore | 1 a/tools/testing/selftests/vm/Makefile | 1 a/tools/testing/selftests/vm/hugepage-mremap.c | 161 ++ a/tools/testing/selftests/vm/ksm_tests.c | 154 ++ a/tools/testing/selftests/vm/madv_populate.c | 15 a/tools/testing/selftests/vm/run_vmtests.sh | 11 a/tools/testing/selftests/vm/transhuge-stress.c | 2 a/tools/testing/selftests/vm/userfaultfd.c | 157 +- a/tools/vm/page-types.c | 38 a/tools/vm/page_owner_sort.c | 94 + b/Documentation/admin-guide/mm/index.rst | 2 b/Documentation/vm/index.rst | 26 260 files changed, 6448 insertions(+), 2327 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-10-28 21:35 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-10-28 21:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 11 patches, based on 411a44c24a561e449b592ff631b7ae321f1eb559. Subsystems affected by this patch series: mm/memcg mm/memory-failure mm/oom-kill ocfs2 mm/secretmem mm/vmalloc mm/hugetlb mm/damon mm/tools Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: memcg: page_alloc: skip bulk allocator for __GFP_ACCOUNT Subsystem: mm/memory-failure Yang Shi <shy828301@gmail.com>: mm: hwpoison: remove the unnecessary THP check mm: filemap: check if THP has hwpoisoned subpage for PMD page fault Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm/oom_kill.c: prevent a race between process_mrelease and exit_mmap Subsystem: ocfs2 Gautham Ananthakrishna <gautham.ananthakrishna@oracle.com>: ocfs2: fix race between searching chunks and release journal_head from buffer_head Subsystem: mm/secretmem Kees Cook <keescook@chromium.org>: mm/secretmem: avoid letting secretmem_users drop to zero Subsystem: mm/vmalloc Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: fix numa spreading for large hash tables Subsystem: mm/hugetlb Rongwei Wang <rongwei.wang@linux.alibaba.com>: mm, thp: bail out early in collapse_file for writeback page Yang Shi <shy828301@gmail.com>: mm: khugepaged: skip huge page collapse for special files Subsystem: mm/damon SeongJae Park <sj@kernel.org>: mm/damon/core-test: fix wrong expectations for 'damon_split_regions_of()' Subsystem: mm/tools David Yang <davidcomponentone@gmail.com>: tools/testing/selftests/vm/split_huge_page_test.c: fix application of sizeof to pointer fs/ocfs2/suballoc.c | 22 ++++++++++------- include/linux/page-flags.h | 23 ++++++++++++++++++ mm/damon/core-test.h | 4 +-- mm/huge_memory.c | 2 + mm/khugepaged.c | 26 +++++++++++++------- mm/memory-failure.c | 28 +++++++++++----------- mm/memory.c | 9 +++++++ mm/oom_kill.c | 23 +++++++++--------- mm/page_alloc.c | 8 +++++- mm/secretmem.c | 2 - mm/vmalloc.c | 15 +++++++---- tools/testing/selftests/vm/split_huge_page_test.c | 2 - 12 files changed, 110 insertions(+), 54 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-10-18 22:14 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-10-18 22:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 19 patches, based on 519d81956ee277b4419c723adfb154603c2565ba. Subsystems affected by this patch series: mm/userfaultfd mm/migration ocfs2 mm/memblock mm/mempolicy mm/slub binfmt vfs mm/secretmem mm/thp misc Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: mm/userfaultfd: selftests: fix memory corruption with thp enabled Nadav Amit <namit@vmware.com>: userfaultfd: fix a race between writeprotect and exit_mmap() Subsystem: mm/migration Dave Hansen <dave.hansen@linux.intel.com>: Patch series "mm/migrate: 5.15 fixes for automatic demotion", v2: mm/migrate: optimize hotplug-time demotion order updates mm/migrate: add CPU hotplug to demotion #ifdef Huang Ying <ying.huang@intel.com>: mm/migrate: fix CPUHP state to update node demotion order Subsystem: ocfs2 Jan Kara <jack@suse.cz>: ocfs2: fix data corruption after conversion from inline format Valentin Vidic <vvidic@valentin-vidic.from.hr>: ocfs2: mount fails with buffer overflow in strlen Subsystem: mm/memblock Peng Fan <peng.fan@nxp.com>: memblock: check memory total_size Subsystem: mm/mempolicy Eric Dumazet <edumazet@google.com>: mm/mempolicy: do not allow illegal MPOL_F_NUMA_BALANCING | MPOL_LOCAL in mbind() Subsystem: mm/slub Miaohe Lin <linmiaohe@huawei.com>: Patch series "Fixups for slub": mm, slub: fix two bugs in slab_debug_trace_open() mm, slub: fix mismatch between reconstructed freelist depth and cnt mm, slub: fix potential memoryleak in kmem_cache_open() mm, slub: fix potential use-after-free in slab_debugfs_fops mm, slub: fix incorrect memcg slab count for bulk free Subsystem: binfmt Lukas Bulwahn <lukas.bulwahn@gmail.com>: elfcore: correct reference to CONFIG_UML Subsystem: vfs "Matthew Wilcox (Oracle)" <willy@infradead.org>: vfs: check fd has read access in kernel_read_file_from_fd() Subsystem: mm/secretmem Sean Christopherson <seanjc@google.com>: mm/secretmem: fix NULL page->mapping dereference in page_is_secretmem() Subsystem: mm/thp Marek Szyprowski <m.szyprowski@samsung.com>: mm/thp: decrease nr_thps in file's mapping on THP split Subsystem: misc Andrej Shadura <andrew.shadura@collabora.co.uk>: mailmap: add Andrej Shadura .mailmap | 2 + fs/kernel_read_file.c | 2 - fs/ocfs2/alloc.c | 46 ++++++----------------- fs/ocfs2/super.c | 14 +++++-- fs/userfaultfd.c | 12 ++++-- include/linux/cpuhotplug.h | 4 ++ include/linux/elfcore.h | 2 - include/linux/memory.h | 5 ++ include/linux/secretmem.h | 2 - mm/huge_memory.c | 6 ++- mm/memblock.c | 2 - mm/mempolicy.c | 16 ++------ mm/migrate.c | 62 ++++++++++++++++++------------- mm/page_ext.c | 4 -- mm/slab.c | 4 +- mm/slub.c | 31 ++++++++++++--- tools/testing/selftests/vm/userfaultfd.c | 23 ++++++++++- 17 files changed, 138 insertions(+), 99 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-09-24 22:42 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-09-24 22:42 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 16 patches, based on 7d42e98182586f57f376406d033f05fe135edb75. Subsystems affected by this patch series: mm/memory-failure mm/kasan mm/damon xtensa mm/shmem ocfs2 scripts mm/tools lib mm/pagecache mm/debug sh mm/kasan mm/memory-failure mm/pagemap Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: add is_free_buddy_page() in HWPoisonHandlable() Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: fix Kconfig check of CC_HAS_WORKING_NOSANITIZE_ADDRESS Subsystem: mm/damon Adam Borowski <kilobyte@angband.pl>: mm/damon: don't use strnlen() with known-bogus source length Subsystem: xtensa Guenter Roeck <linux@roeck-us.net>: xtensa: increase size of gcc stack frame check Subsystem: mm/shmem Liu Yuntao <liuyuntao10@huawei.com>: mm/shmem.c: fix judgment error in shmem_is_huge() Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: drop acl cache for directories too Subsystem: scripts Miles Chen <miles.chen@mediatek.com>: scripts/sorttable: riscv: fix undeclared identifier 'EM_RISCV' error Subsystem: mm/tools Changbin Du <changbin.du@gmail.com>: tools/vm/page-types: remove dependency on opt_file for idle page tracking Subsystem: lib Paul Menzel <pmenzel@molgen.mpg.de>: lib/zlib_inflate/inffast: check config in C to avoid unused function warning Subsystem: mm/pagecache Minchan Kim <minchan@kernel.org>: mm: fs: invalidate bh_lrus for only cold path Subsystem: mm/debug Weizhao Ouyang <o451686892@gmail.com>: mm/debug: sync up MR_CONTIG_RANGE and MR_LONGTERM_PIN mm/debug: sync up latest migrate_reason to migrate_reason_names Subsystem: sh Geert Uytterhoeven <geert+renesas@glider.be>: sh: pgtable-3level: fix cast to pointer from integer of different size Subsystem: mm/kasan Nathan Chancellor <nathan@kernel.org>: kasan: always respect CONFIG_KASAN_STACK Subsystem: mm/memory-failure Qi Zheng <zhengqi.arch@bytedance.com>: mm/memory_failure: fix the missing pte_unmap() call Subsystem: mm/pagemap Chen Jun <chenjun102@huawei.com>: mm: fix uninitialized use in overcommit_policy_handler arch/sh/include/asm/pgtable-3level.h | 2 +- fs/buffer.c | 8 ++++++-- fs/ocfs2/dlmglue.c | 3 ++- include/linux/buffer_head.h | 4 ++-- include/linux/migrate.h | 6 +++++- lib/Kconfig.debug | 2 +- lib/Kconfig.kasan | 2 ++ lib/zlib_inflate/inffast.c | 13 ++++++------- mm/damon/dbgfs-test.h | 16 ++++++++-------- mm/debug.c | 4 +++- mm/memory-failure.c | 12 ++++++------ mm/shmem.c | 4 ++-- mm/swap.c | 19 ++++++++++++++++--- mm/util.c | 4 ++-- scripts/Makefile.kasan | 3 ++- scripts/sorttable.c | 4 ++++ tools/vm/page-types.c | 2 +- 17 files changed, 69 insertions(+), 39 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-09-10 3:09 Andrew Morton 2021-09-10 17:11 ` incoming Kees Cook 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-09-10 3:09 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits More post linux-next material. 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. Subsystems affected by this patch series: mm/slab-generic rapidio mm/debug Subsystem: mm/slab-generic "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move kvmalloc-related functions to slab.h Subsystem: rapidio Kees Cook <keescook@chromium.org>: rapidio: avoid bogus __alloc_size warning Subsystem: mm/debug Kees Cook <keescook@chromium.org>: Patch series "Add __alloc_size() for better bounds checking", v2: Compiler Attributes: add __alloc_size() for better bounds checking checkpatch: add __alloc_size() to known $Attribute slab: clean up function declarations slab: add __alloc_size attributes for better bounds checking mm/page_alloc: add __alloc_size attributes for better bounds checking percpu: add __alloc_size attributes for better bounds checking mm/vmalloc: add __alloc_size attributes for better bounds checking Makefile | 15 +++ drivers/of/kexec.c | 1 drivers/rapidio/devices/rio_mport_cdev.c | 9 +- include/linux/compiler_attributes.h | 6 + include/linux/gfp.h | 2 include/linux/mm.h | 34 -------- include/linux/percpu.h | 3 include/linux/slab.h | 122 ++++++++++++++++++++++--------- include/linux/vmalloc.h | 11 ++ scripts/checkpatch.pl | 3 10 files changed, 132 insertions(+), 74 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-09-10 3:09 incoming Andrew Morton @ 2021-09-10 17:11 ` Kees Cook 2021-09-10 20:13 ` incoming Kees Cook 0 siblings, 1 reply; 389+ messages in thread From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw) To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote: > > More post linux-next material. > > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. > > Subsystems affected by this patch series: > > mm/slab-generic > rapidio > mm/debug > > Subsystem: mm/slab-generic > > "Matthew Wilcox (Oracle)" <willy@infradead.org>: > mm: move kvmalloc-related functions to slab.h > > Subsystem: rapidio > > Kees Cook <keescook@chromium.org>: > rapidio: avoid bogus __alloc_size warning > > Subsystem: mm/debug > > Kees Cook <keescook@chromium.org>: > Patch series "Add __alloc_size() for better bounds checking", v2: > Compiler Attributes: add __alloc_size() for better bounds checking > checkpatch: add __alloc_size() to known $Attribute > slab: clean up function declarations > slab: add __alloc_size attributes for better bounds checking > mm/page_alloc: add __alloc_size attributes for better bounds checking > percpu: add __alloc_size attributes for better bounds checking > mm/vmalloc: add __alloc_size attributes for better bounds checking Hi, FYI, in overnight build testing I found yet another corner case in GCC's handling of the __alloc_size attribute. It's the gift that keeps on giving. The fix is here: https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/ > > Makefile | 15 +++ > drivers/of/kexec.c | 1 > drivers/rapidio/devices/rio_mport_cdev.c | 9 +- > include/linux/compiler_attributes.h | 6 + > include/linux/gfp.h | 2 > include/linux/mm.h | 34 -------- > include/linux/percpu.h | 3 > include/linux/slab.h | 122 ++++++++++++++++++++++--------- > include/linux/vmalloc.h | 11 ++ > scripts/checkpatch.pl | 3 > 10 files changed, 132 insertions(+), 74 deletions(-) > -- Kees Cook ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-09-10 17:11 ` incoming Kees Cook @ 2021-09-10 20:13 ` Kees Cook 0 siblings, 0 replies; 389+ messages in thread From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw) To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote: > On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote: > > > > More post linux-next material. > > > > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6. > > > > Subsystems affected by this patch series: > > > > mm/slab-generic > > rapidio > > mm/debug > > > > Subsystem: mm/slab-generic > > > > "Matthew Wilcox (Oracle)" <willy@infradead.org>: > > mm: move kvmalloc-related functions to slab.h > > > > Subsystem: rapidio > > > > Kees Cook <keescook@chromium.org>: > > rapidio: avoid bogus __alloc_size warning > > > > Subsystem: mm/debug > > > > Kees Cook <keescook@chromium.org>: > > Patch series "Add __alloc_size() for better bounds checking", v2: > > Compiler Attributes: add __alloc_size() for better bounds checking > > checkpatch: add __alloc_size() to known $Attribute > > slab: clean up function declarations > > slab: add __alloc_size attributes for better bounds checking > > mm/page_alloc: add __alloc_size attributes for better bounds checking > > percpu: add __alloc_size attributes for better bounds checking > > mm/vmalloc: add __alloc_size attributes for better bounds checking > > Hi, > > FYI, in overnight build testing I found yet another corner case in > GCC's handling of the __alloc_size attribute. It's the gift that keeps > on giving. The fix is here: > > https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/ I'm so glad it's Friday. Here's the v2 fix... *sigh* https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/ -Kees > > > > > Makefile | 15 +++ > > drivers/of/kexec.c | 1 > > drivers/rapidio/devices/rio_mport_cdev.c | 9 +- > > include/linux/compiler_attributes.h | 6 + > > include/linux/gfp.h | 2 > > include/linux/mm.h | 34 -------- > > include/linux/percpu.h | 3 > > include/linux/slab.h | 122 ++++++++++++++++++++++--------- > > include/linux/vmalloc.h | 11 ++ > > scripts/checkpatch.pl | 3 > > 10 files changed, 132 insertions(+), 74 deletions(-) > > > > -- > Kees Cook -- Kees Cook ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-09-09 1:08 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-09-09 1:08 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A bunch of hotfixes, mostly cc:stable. 8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c. Subsystems affected by this patch series: mm/hmm mm/hugetlb mm/vmscan mm/pagealloc mm/pagemap mm/kmemleak mm/mempolicy mm/memblock Subsystem: mm/hmm Li Zhijian <lizhijian@cn.fujitsu.com>: mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled Subsystem: mm/hugetlb Liu Zixian <liuzixian4@huawei.com>: mm/hugetlb: initialize hugetlb_usage in mm_init Subsystem: mm/vmscan Rik van Riel <riel@surriel.com>: mm,vmscan: fix divide by zero in get_scan_count Subsystem: mm/pagealloc Miaohe Lin <linmiaohe@huawei.com>: mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype Subsystem: mm/pagemap Liam Howlett <liam.howlett@oracle.com>: mmap_lock: change trace and locking order Subsystem: mm/kmemleak Naohiro Aota <naohiro.aota@wdc.com>: mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp Subsystem: mm/mempolicy yanghui <yanghui.def@bytedance.com>: mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: nds32/setup: remove unused memblock_region variable in setup_memory() arch/nds32/kernel/setup.c | 1 - include/linux/hugetlb.h | 9 +++++++++ include/linux/mmap_lock.h | 8 ++++---- kernel/fork.c | 1 + mm/hmm.c | 5 ++++- mm/kmemleak.c | 3 ++- mm/mempolicy.c | 17 +++++++++++++---- mm/page_alloc.c | 4 +++- mm/vmscan.c | 2 +- 9 files changed, 37 insertions(+), 13 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-09-08 22:17 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the post-linux-next material, so it is based upon latest upstream to catch the now-merged dependencies. 10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c. Subsystems affected by this patch series: mm/vmstat mm/migration compat Subsystem: mm/vmstat Ingo Molnar <mingo@elte.hu>: mm/vmstat: protect per cpu variables with preempt disable on RT Subsystem: mm/migration Baolin Wang <baolin.wang@linux.alibaba.com>: mm: migrate: introduce a local variable to get the number of pages mm: migrate: fix the incorrect function name in comments mm: migrate: change to use bool type for 'page_was_mapped' Subsystem: compat Arnd Bergmann <arnd@arndb.de>: Patch series "compat: remove compat_alloc_user_space", v5: kexec: move locking into do_kexec_load kexec: avoid compat_alloc_user_space mm: simplify compat_sys_move_pages mm: simplify compat numa syscalls compat: remove some compat entry points arch: remove compat_alloc_user_space arch/arm64/include/asm/compat.h | 5 arch/arm64/include/asm/uaccess.h | 11 - arch/arm64/include/asm/unistd32.h | 10 - arch/arm64/lib/Makefile | 2 arch/arm64/lib/copy_in_user.S | 77 ---------- arch/mips/cavium-octeon/octeon-memcpy.S | 2 arch/mips/include/asm/compat.h | 8 - arch/mips/include/asm/uaccess.h | 26 --- arch/mips/kernel/syscalls/syscall_n32.tbl | 10 - arch/mips/kernel/syscalls/syscall_o32.tbl | 10 - arch/mips/lib/memcpy.S | 11 - arch/parisc/include/asm/compat.h | 6 arch/parisc/include/asm/uaccess.h | 2 arch/parisc/kernel/syscalls/syscall.tbl | 8 - arch/parisc/lib/memcpy.c | 9 - arch/powerpc/include/asm/compat.h | 16 -- arch/powerpc/kernel/syscalls/syscall.tbl | 10 - arch/s390/include/asm/compat.h | 10 - arch/s390/include/asm/uaccess.h | 3 arch/s390/kernel/syscalls/syscall.tbl | 10 - arch/s390/lib/uaccess.c | 63 -------- arch/sparc/include/asm/compat.h | 19 -- arch/sparc/kernel/process_64.c | 2 arch/sparc/kernel/signal32.c | 12 - arch/sparc/kernel/signal_64.c | 8 - arch/sparc/kernel/syscalls/syscall.tbl | 10 - arch/x86/entry/syscalls/syscall_32.tbl | 4 arch/x86/entry/syscalls/syscall_64.tbl | 2 arch/x86/include/asm/compat.h | 13 - arch/x86/include/asm/uaccess_64.h | 7 include/linux/compat.h | 39 +---- include/linux/uaccess.h | 10 - include/uapi/asm-generic/unistd.h | 10 - kernel/compat.c | 21 -- kernel/kexec.c | 105 +++++--------- kernel/sys_ni.c | 5 mm/mempolicy.c | 213 +++++++----------------------- mm/migrate.c | 69 +++++---- mm/vmstat.c | 48 ++++++ 39 files changed, 243 insertions(+), 663 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-09-08 2:52 Andrew Morton 2021-09-08 8:57 ` incoming Vlastimil Babka 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-09-08 2:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f. Subsystems affected by this patch series: mm/slub mm/memory-hotplug mm/rmap mm/ioremap mm/highmem mm/cleanups mm/secretmem mm/kfence mm/damon alpha percpu procfs misc core-kernel MAINTAINERS lib bitops checkpatch epoll init nilfs2 coredump fork pids criu kconfig selftests ipc mm/vmscan scripts Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6: mm, slub: don't call flush_all() from slab_debug_trace_open() mm, slub: allocate private object map for debugfs listings mm, slub: allocate private object map for validate_slab_cache() mm, slub: don't disable irq for debug_check_no_locks_freed() mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() mm, slub: extract get_partial() from new_slab_objects() mm, slub: dissolve new_slab_objects() into ___slab_alloc() mm, slub: return slab page from get_partial() and set c->page afterwards mm, slub: restructure new page checks in ___slab_alloc() mm, slub: simplify kmem_cache_cpu and tid setup mm, slub: move disabling/enabling irqs to ___slab_alloc() mm, slub: do initial checks in ___slab_alloc() with irqs enabled mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() mm, slub: restore irqs around calling new_slab() mm, slub: validate slab from partial list or page allocator before making it cpu slab mm, slub: check new pages with restored irqs mm, slub: stop disabling irqs around get_partial() mm, slub: move reset of c->page and freelist out of deactivate_slab() mm, slub: make locking in deactivate_slab() irq-safe mm, slub: call deactivate_slab() without disabling irqs mm, slub: move irq control into unfreeze_partials() mm, slub: discard slabs in unfreeze_partials() without irqs disabled mm, slub: detach whole partial list at once in unfreeze_partials() mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing mm, slub: only disable irq with spin_lock in __unfreeze_partials() mm, slub: don't disable irqs in slub_cpu_dead() mm, slab: split out the cpu offline variant of flush_slab() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context mm: slub: make object_map_lock a raw_spinlock_t Vlastimil Babka <vbabka@suse.cz>: mm, slub: make slab_lock() disable irqs with PREEMPT_RT mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg mm, slub: use migrate_disable() on PREEMPT_RT mm, slub: convert kmem_cpu_slab protection to local_lock Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3: memory-hotplug.rst: remove locking details from admin-guide memory-hotplug.rst: complete admin-guide overhaul Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE": mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE mm: memory_hotplug: cleanup after removal of pfn_valid_within() David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory": mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range() mm/memory_hotplug: remove nid parameter from arch_remove_memory() mm/memory_hotplug: remove nid parameter from remove_memory() and friends ACPI: memhotplug: memory resources cannot be enabled yet Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3: mm: track present early pages per zone mm/memory_hotplug: introduce "auto-movable" online policy drivers/base/memory: introduce "memory groups" to logically group memory blocks mm/memory_hotplug: track present pages in memory groups ACPI: memhotplug: use a single static memory group for a single memory device dax/kmem: use a single static memory group for a single probed unit virtio-mem: use a single dynamic memory group for a single virtio-mem device mm/memory_hotplug: memory group aware "auto-movable" online policy mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixups for memory hotplug": mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code Subsystem: mm/rmap Muchun Song <songmuchun@bytedance.com>: mm: remove redundant compound_head() calling Subsystem: mm/ioremap Christoph Hellwig <hch@lst.de>: riscv: only select GENERIC_IOREMAP if MMU support is enabled Patch series "small ioremap cleanups": mm: move ioremap_page_range to vmalloc.c mm: don't allow executable ioremap mappings Weizhao Ouyang <o451686892@gmail.com>: mm/early_ioremap.c: remove redundant early_ioremap_shutdown() Subsystem: mm/highmem Sebastian Andrzej Siewior <bigeasy@linutronix.de>: highmem: don't disable preemption on RT in kmap_atomic() Subsystem: mm/cleanups Changbin Du <changbin.du@gmail.com>: mm: in_irq() cleanup Muchun Song <songmuchun@bytedance.com>: mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1) Subsystem: mm/secretmem Jordy Zomer <jordy@jordyzomer.github.io>: mm/secretmem: use refcount_t instead of atomic_t Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: show cpu and timestamp in alloc/free info kfence: test: fail fast if disabled at boot Subsystem: mm/damon SeongJae Park <sjpark@amazon.de>: Patch series "Introduce Data Access MONitor (DAMON)", v34: mm: introduce Data Access MONitor (DAMON) mm/damon/core: implement region-based sampling mm/damon: adaptively adjust regions mm/idle_page_tracking: make PG_idle reusable mm/damon: implement primitives for the virtual memory address spaces mm/damon: add a tracepoint mm/damon: implement a debugfs-based user space interface mm/damon/dbgfs: export kdamond pid to the user space mm/damon/dbgfs: support multiple contexts Documentation: add documents for DAMON mm/damon: add kunit tests mm/damon: add user space selftests MAINTAINERS: update for DAMON Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: agp: make empty macros use do-while-0 style alpha: pci-sysfs: fix all kernel-doc warnings Subsystem: percpu Greg Kroah-Hartman <gregkh@linuxfoundation.org>: percpu: remove export of pcpu_base_addr Subsystem: procfs Feng Zhou <zhoufeng.zf@bytedance.com>: fs/proc/kcore.c: add mmap interface Christoph Hellwig <hch@lst.de>: proc: stop using seq_get_buf in proc_task_name Ohhoon Kwon <ohoono.kwon@samsung.com>: connector: send event on write to /proc/[pid]/comm Subsystem: misc Colin Ian King <colin.king@canonical.com>: arch: Kconfig: fix spelling mistake "seperate" -> "separate" Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/once.h: fix trivia typo Not -> Note Daniel Lezcano <daniel.lezcano@linaro.org>: Patch series "Add Hz macros", v3: units: change from 'L' to 'UL' units: add the HZ macros thermal/drivers/devfreq_cooling: use HZ macros devfreq: use HZ macros iio/drivers/as73211: use HZ macros hwmon/drivers/mr75203: use HZ macros iio/drivers/hid-sensor: use HZ macros i2c/drivers/ov02q10: use HZ macros mtd/drivers/nand: use HZ macros phy/drivers/stm32: use HZ macros Subsystem: core-kernel Yang Yang <yang.yang29@zte.com.cn>: kernel/acct.c: use dedicated helper to access rlimit values Pavel Skripkin <paskripkin@gmail.com>: profiling: fix shift-out-of-bounds bugs Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS: update ClangBuiltLinux mailing list Documentation/llvm: update mailing list Documentation/llvm: update IRC location Subsystem: lib Geert Uytterhoeven <geert@linux-m68k.org>: Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements": math: make RATIONAL tristate math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it Matteo Croce <mcroce@microsoft.com>: Patch series "lib/string: optimized mem* functions", v2: lib/string: optimized memcpy lib/string: optimized memmove lib/string: optimized memset Daniel Latypov <dlatypov@google.com>: lib/test: convert test_sort.c to use KUnit Randy Dunlap <rdunlap@infradead.org>: lib/dump_stack: correct kernel-doc notation lib/iov_iter.c: fix kernel-doc warnings Subsystem: bitops Yury Norov <yury.norov@gmail.com>: Patch series "Resend bitmap patches": bitops: protect find_first_{,zero}_bit properly bitops: move find_bit_*_le functions from le.h to find.h include: move find.h from asm_generic to linux arch: remove GENERIC_FIND_FIRST_BIT entirely lib: add find_first_and_bit() cpumask: use find_first_and_bit() all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate tools: sync tools/bitmap with mother linux cpumask: replace cpumask_next_* with cpumask_first_* where appropriate include/linux: move for_each_bit() macros from bitops.h to find.h find: micro-optimize for_each_{set,clear}_bit() bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate Andy Shevchenko <andriy.shevchenko@linux.intel.com>: tools: rename bitmap_alloc() to bitmap_zalloc() Yury Norov <yury.norov@gmail.com>: mm/percpu: micro-optimize pcpu_is_populated() bitmap: unify find_bit operations lib: bitmap: add performance test for bitmap_print_to_pagebuf vsprintf: rework bitmap_list_string Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: support wide strings Mimi Zohar <zohar@linux.ibm.com>: checkpatch: make email address check case insensitive Joe Perches <joe@perches.com>: checkpatch: improve GIT_COMMIT_ID test Subsystem: epoll Nicholas Piggin <npiggin@gmail.com>: fs/epoll: use a per-cpu counter for user's watches count Subsystem: init Rasmus Villemoes <linux@rasmusvillemoes.dk>: init: move usermodehelper_enable() to populate_rootfs() Kefeng Wang <wangkefeng.wang@huawei.com>: trap: cleanup trap_init() Subsystem: nilfs2 Nanyong Sun <sunnanyong@huawei.com>: Patch series "nilfs2: fix incorrect usage of kobject": nilfs2: fix memory leak in nilfs_sysfs_create_device_group nilfs2: fix NULL pointer in nilfs_##name##_attr_release nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group Zhen Lei <thunder.leizhen@huawei.com>: nilfs2: use refcount_dec_and_lock() to fix potential UAF Subsystem: coredump David Oberhollenzer <david.oberhollenzer@sigma-star.at>: fs/coredump.c: log if a core dump is aborted due to changed file permissions QiuXi <qiuxi1@huawei.com>: coredump: fix memleak in dump_vma_snapshot() Subsystem: fork Christoph Hellwig <hch@lst.de>: kernel/fork.c: unexport get_{mm,task}_exe_file Subsystem: pids Takahiro Itazuri <itazur@amazon.com>: pid: cleanup the stale comment mentioning pidmap_init(). Subsystem: criu Cyrill Gorcunov <gorcunov@gmail.com>: prctl: allow to setup brk for et_dyn executables Subsystem: kconfig Zenghui Yu <yuzenghui@huawei.com>: configs: remove the obsolete CONFIG_INPUT_POLLDEV Lukas Bulwahn <lukas.bulwahn@gmail.com>: Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH Subsystem: selftests Greg Thelen <gthelen@google.com>: selftests/memfd: remove unused variable Subsystem: ipc Rafael Aquini <aquini@redhat.com>: ipc: replace costly bailout check in sysvipc_find_ipc() Subsystem: mm/vmscan Randy Dunlap <rdunlap@infradead.org>: mm/workingset: correct kernel-doc notations Subsystem: scripts Randy Dunlap <rdunlap@infradead.org>: scripts: check_extable: fix typo in user error message a/Documentation/admin-guide/mm/damon/index.rst | 15 a/Documentation/admin-guide/mm/damon/start.rst | 114 + a/Documentation/admin-guide/mm/damon/usage.rst | 112 + a/Documentation/admin-guide/mm/index.rst | 1 a/Documentation/admin-guide/mm/memory-hotplug.rst | 842 ++++++----- a/Documentation/dev-tools/kfence.rst | 98 - a/Documentation/kbuild/llvm.rst | 5 a/Documentation/vm/damon/api.rst | 20 a/Documentation/vm/damon/design.rst | 166 ++ a/Documentation/vm/damon/faq.rst | 51 a/Documentation/vm/damon/index.rst | 30 a/Documentation/vm/index.rst | 1 a/MAINTAINERS | 17 a/arch/Kconfig | 2 a/arch/alpha/include/asm/agp.h | 4 a/arch/alpha/include/asm/bitops.h | 2 a/arch/alpha/kernel/pci-sysfs.c | 12 a/arch/arc/Kconfig | 1 a/arch/arc/include/asm/bitops.h | 1 a/arch/arc/kernel/traps.c | 5 a/arch/arm/configs/dove_defconfig | 1 a/arch/arm/configs/pxa_defconfig | 1 a/arch/arm/include/asm/bitops.h | 1 a/arch/arm/kernel/traps.c | 5 a/arch/arm64/Kconfig | 1 a/arch/arm64/include/asm/bitops.h | 1 a/arch/arm64/mm/mmu.c | 3 a/arch/csky/include/asm/bitops.h | 1 a/arch/h8300/include/asm/bitops.h | 1 a/arch/h8300/kernel/traps.c | 4 a/arch/hexagon/include/asm/bitops.h | 1 a/arch/hexagon/kernel/traps.c | 4 a/arch/ia64/include/asm/bitops.h | 2 a/arch/ia64/mm/init.c | 3 a/arch/m68k/include/asm/bitops.h | 2 a/arch/mips/Kconfig | 1 a/arch/mips/configs/lemote2f_defconfig | 1 a/arch/mips/configs/pic32mzda_defconfig | 1 a/arch/mips/configs/rt305x_defconfig | 1 a/arch/mips/configs/xway_defconfig | 1 a/arch/mips/include/asm/bitops.h | 1 a/arch/nds32/kernel/traps.c | 5 a/arch/nios2/kernel/traps.c | 5 a/arch/openrisc/include/asm/bitops.h | 1 a/arch/openrisc/kernel/traps.c | 5 a/arch/parisc/configs/generic-32bit_defconfig | 1 a/arch/parisc/include/asm/bitops.h | 2 a/arch/parisc/kernel/traps.c | 4 a/arch/powerpc/include/asm/bitops.h | 2 a/arch/powerpc/include/asm/cputhreads.h | 2 a/arch/powerpc/kernel/traps.c | 5 a/arch/powerpc/mm/mem.c | 3 a/arch/powerpc/platforms/pasemi/dma_lib.c | 4 a/arch/powerpc/platforms/pseries/hotplug-memory.c | 9 a/arch/riscv/Kconfig | 2 a/arch/riscv/include/asm/bitops.h | 1 a/arch/riscv/kernel/traps.c | 5 a/arch/s390/Kconfig | 1 a/arch/s390/include/asm/bitops.h | 1 a/arch/s390/kvm/kvm-s390.c | 2 a/arch/s390/mm/init.c | 3 a/arch/sh/include/asm/bitops.h | 1 a/arch/sh/mm/init.c | 3 a/arch/sparc/include/asm/bitops_32.h | 1 a/arch/sparc/include/asm/bitops_64.h | 2 a/arch/um/kernel/trap.c | 4 a/arch/x86/Kconfig | 1 a/arch/x86/configs/i386_defconfig | 1 a/arch/x86/configs/x86_64_defconfig | 1 a/arch/x86/include/asm/bitops.h | 2 a/arch/x86/kernel/apic/vector.c | 4 a/arch/x86/mm/init_32.c | 3 a/arch/x86/mm/init_64.c | 3 a/arch/x86/um/Kconfig | 1 a/arch/xtensa/include/asm/bitops.h | 1 a/block/blk-mq.c | 2 a/drivers/acpi/acpi_memhotplug.c | 46 a/drivers/base/memory.c | 231 ++- a/drivers/base/node.c | 2 a/drivers/block/rnbd/rnbd-clt.c | 2 a/drivers/dax/kmem.c | 43 a/drivers/devfreq/devfreq.c | 2 a/drivers/dma/ti/edma.c | 2 a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c | 4 a/drivers/hwmon/ltc2992.c | 3 a/drivers/hwmon/mr75203.c | 2 a/drivers/iio/adc/ad7124.c | 2 a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c | 3 a/drivers/iio/light/as73211.c | 3 a/drivers/infiniband/hw/irdma/hw.c | 16 a/drivers/media/cec/core/cec-core.c | 2 a/drivers/media/i2c/ov02a10.c | 2 a/drivers/media/mc/mc-devnode.c | 2 a/drivers/mmc/host/renesas_sdhi_core.c | 2 a/drivers/mtd/nand/raw/intel-nand-controller.c | 2 a/drivers/net/virtio_net.c | 2 a/drivers/pci/controller/dwc/pci-dra7xx.c | 2 a/drivers/phy/st/phy-stm32-usbphyc.c | 2 a/drivers/scsi/lpfc/lpfc_sli.c | 10 a/drivers/soc/fsl/qbman/bman_portal.c | 2 a/drivers/soc/fsl/qbman/qman_portal.c | 2 a/drivers/soc/ti/k3-ringacc.c | 4 a/drivers/thermal/devfreq_cooling.c | 2 a/drivers/tty/n_tty.c | 2 a/drivers/virt/acrn/ioreq.c | 3 a/drivers/virtio/virtio_mem.c | 26 a/fs/coredump.c | 15 a/fs/eventpoll.c | 18 a/fs/f2fs/segment.c | 8 a/fs/nilfs2/sysfs.c | 26 a/fs/nilfs2/the_nilfs.c | 9 a/fs/ocfs2/cluster/heartbeat.c | 2 a/fs/ocfs2/dlm/dlmdomain.c | 4 a/fs/ocfs2/dlm/dlmmaster.c | 18 a/fs/ocfs2/dlm/dlmrecovery.c | 2 a/fs/ocfs2/dlm/dlmthread.c | 2 a/fs/proc/array.c | 18 a/fs/proc/base.c | 5 a/fs/proc/kcore.c | 73 a/include/asm-generic/bitops.h | 1 a/include/asm-generic/bitops/find.h | 198 -- a/include/asm-generic/bitops/le.h | 64 a/include/asm-generic/early_ioremap.h | 6 a/include/linux/bitmap.h | 34 a/include/linux/bitops.h | 34 a/include/linux/cpumask.h | 46 a/include/linux/damon.h | 290 +++ a/include/linux/find.h | 134 + a/include/linux/highmem-internal.h | 27 a/include/linux/memory.h | 55 a/include/linux/memory_hotplug.h | 40 a/include/linux/mmzone.h | 19 a/include/linux/once.h | 2 a/include/linux/page-flags.h | 17 a/include/linux/page_ext.h | 2 a/include/linux/page_idle.h | 6 a/include/linux/pagemap.h | 7 a/include/linux/sched/user.h | 3 a/include/linux/slub_def.h | 6 a/include/linux/threads.h | 2 a/include/linux/units.h | 10 a/include/linux/vmalloc.h | 3 a/include/trace/events/damon.h | 43 a/include/trace/events/mmflags.h | 2 a/include/trace/events/page_ref.h | 4 a/init/initramfs.c | 2 a/init/main.c | 3 a/init/noinitramfs.c | 2 a/ipc/util.c | 16 a/kernel/acct.c | 2 a/kernel/fork.c | 2 a/kernel/profile.c | 21 a/kernel/sys.c | 7 a/kernel/time/clocksource.c | 4 a/kernel/user.c | 25 a/lib/Kconfig | 3 a/lib/Kconfig.debug | 9 a/lib/dump_stack.c | 3 a/lib/find_bit.c | 21 a/lib/find_bit_benchmark.c | 21 a/lib/genalloc.c | 2 a/lib/iov_iter.c | 8 a/lib/math/Kconfig | 2 a/lib/math/rational.c | 3 a/lib/string.c | 130 + a/lib/test_bitmap.c | 37 a/lib/test_printf.c | 2 a/lib/test_sort.c | 40 a/lib/vsprintf.c | 26 a/mm/Kconfig | 15 a/mm/Makefile | 4 a/mm/compaction.c | 20 a/mm/damon/Kconfig | 68 a/mm/damon/Makefile | 5 a/mm/damon/core-test.h | 253 +++ a/mm/damon/core.c | 748 ++++++++++ a/mm/damon/dbgfs-test.h | 126 + a/mm/damon/dbgfs.c | 631 ++++++++ a/mm/damon/vaddr-test.h | 329 ++++ a/mm/damon/vaddr.c | 672 +++++++++ a/mm/early_ioremap.c | 5 a/mm/highmem.c | 2 a/mm/ioremap.c | 25 a/mm/kfence/core.c | 3 a/mm/kfence/kfence.h | 2 a/mm/kfence/kfence_test.c | 3 a/mm/kfence/report.c | 19 a/mm/kmemleak.c | 2 a/mm/memory_hotplug.c | 396 ++++- a/mm/memremap.c | 5 a/mm/page_alloc.c | 27 a/mm/page_ext.c | 12 a/mm/page_idle.c | 10 a/mm/page_isolation.c | 7 a/mm/page_owner.c | 14 a/mm/percpu.c | 36 a/mm/rmap.c | 6 a/mm/secretmem.c | 9 a/mm/slab_common.c | 2 a/mm/slub.c | 1023 +++++++++----- a/mm/vmalloc.c | 24 a/mm/workingset.c | 2 a/net/ncsi/ncsi-manage.c | 4 a/scripts/check_extable.sh | 2 a/scripts/checkpatch.pl | 93 - a/tools/include/linux/bitmap.h | 4 a/tools/perf/bench/find-bit-bench.c | 2 a/tools/perf/builtin-c2c.c | 6 a/tools/perf/builtin-record.c | 2 a/tools/perf/tests/bitmap.c | 2 a/tools/perf/tests/mem2node.c | 2 a/tools/perf/util/affinity.c | 4 a/tools/perf/util/header.c | 4 a/tools/perf/util/metricgroup.c | 2 a/tools/perf/util/mmap.c | 4 a/tools/testing/selftests/damon/Makefile | 7 a/tools/testing/selftests/damon/_chk_dependency.sh | 28 a/tools/testing/selftests/damon/debugfs_attrs.sh | 75 + a/tools/testing/selftests/kvm/dirty_log_perf_test.c | 2 a/tools/testing/selftests/kvm/dirty_log_test.c | 4 a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c | 2 a/tools/testing/selftests/memfd/memfd_test.c | 2 b/MAINTAINERS | 2 b/tools/include/asm-generic/bitops.h | 1 b/tools/include/linux/bitmap.h | 7 b/tools/include/linux/find.h | 81 + b/tools/lib/find_bit.c | 20 227 files changed, 6695 insertions(+), 1875 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-09-08 2:52 incoming Andrew Morton @ 2021-09-08 8:57 ` Vlastimil Babka 0 siblings, 0 replies; 389+ messages in thread From: Vlastimil Babka @ 2021-09-08 8:57 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman On 9/8/21 04:52, Andrew Morton wrote: > Subsystem: mm/slub > > Vlastimil Babka <vbabka@suse.cz>: > Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6: > mm, slub: don't call flush_all() from slab_debug_trace_open() > mm, slub: allocate private object map for debugfs listings > mm, slub: allocate private object map for validate_slab_cache() > mm, slub: don't disable irq for debug_check_no_locks_freed() > mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() > mm, slub: extract get_partial() from new_slab_objects() > mm, slub: dissolve new_slab_objects() into ___slab_alloc() > mm, slub: return slab page from get_partial() and set c->page afterwards > mm, slub: restructure new page checks in ___slab_alloc() > mm, slub: simplify kmem_cache_cpu and tid setup > mm, slub: move disabling/enabling irqs to ___slab_alloc() > mm, slub: do initial checks in ___slab_alloc() with irqs enabled > mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() > mm, slub: restore irqs around calling new_slab() > mm, slub: validate slab from partial list or page allocator before making it cpu slab > mm, slub: check new pages with restored irqs > mm, slub: stop disabling irqs around get_partial() > mm, slub: move reset of c->page and freelist out of deactivate_slab() > mm, slub: make locking in deactivate_slab() irq-safe > mm, slub: call deactivate_slab() without disabling irqs > mm, slub: move irq control into unfreeze_partials() > mm, slub: discard slabs in unfreeze_partials() without irqs disabled > mm, slub: detach whole partial list at once in unfreeze_partials() > mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing > mm, slub: only disable irq with spin_lock in __unfreeze_partials() > mm, slub: don't disable irqs in slub_cpu_dead() > mm, slab: split out the cpu offline variant of flush_slab() > > Sebastian Andrzej Siewior <bigeasy@linutronix.de>: > mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context > mm: slub: make object_map_lock a raw_spinlock_t > > Vlastimil Babka <vbabka@suse.cz>: > mm, slub: make slab_lock() disable irqs with PREEMPT_RT > mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg > mm, slub: use migrate_disable() on PREEMPT_RT > mm, slub: convert kmem_cpu_slab protection to local_lock For my own piece of mind, I've checked that this part (patches 1 to 33) are identical to the v6 posting [1] and git version [2] that Mel and Mike tested (replies to [1]). [1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/ [2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git tags/mm-slub-5.15-rc1 ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-09-02 21:48 Andrew Morton 2021-09-02 21:49 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b. Subsystems affected by this patch series: ia64 ocfs2 block mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/selftests mm/pagemap mm/mremap mm/bootmem mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/mempolicy mm/memblock mm/oom-kill mm/migration mm/ksm mm/percpu mm/vmstat mm/madvise Subsystem: ia64 Jason Wang <wangborong@cdjrlc.com>: ia64: fix typo in a comment Geert Uytterhoeven <geert+renesas@glider.be>: Patch series "ia64: Miscellaneous fixes and cleanups": ia64: fix #endif comment for reserve_elfcorehdr() ia64: make reserve_elfcorehdr() static ia64: make num_rsvd_regions static Subsystem: ocfs2 Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: remove an unnecessary condition Tuo Li <islituo@gmail.com>: ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info() Gang He <ghe@suse.com>: ocfs2: ocfs2_downconvert_lock failure results in deadlock Subsystem: block kernel test robot <lkp@intel.com>: arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4: mm, slub: don't call flush_all() from slab_debug_trace_open() mm, slub: allocate private object map for debugfs listings mm, slub: allocate private object map for validate_slab_cache() mm, slub: don't disable irq for debug_check_no_locks_freed() mm, slub: remove redundant unfreeze_partials() from put_cpu_partial() mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab() mm, slub: extract get_partial() from new_slab_objects() mm, slub: dissolve new_slab_objects() into ___slab_alloc() mm, slub: return slab page from get_partial() and set c->page afterwards mm, slub: restructure new page checks in ___slab_alloc() mm, slub: simplify kmem_cache_cpu and tid setup mm, slub: move disabling/enabling irqs to ___slab_alloc() mm, slub: do initial checks in ___slab_alloc() with irqs enabled mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc() mm, slub: restore irqs around calling new_slab() mm, slub: validate slab from partial list or page allocator before making it cpu slab mm, slub: check new pages with restored irqs mm, slub: stop disabling irqs around get_partial() mm, slub: move reset of c->page and freelist out of deactivate_slab() mm, slub: make locking in deactivate_slab() irq-safe mm, slub: call deactivate_slab() without disabling irqs mm, slub: move irq control into unfreeze_partials() mm, slub: discard slabs in unfreeze_partials() without irqs disabled mm, slub: detach whole partial list at once in unfreeze_partials() mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing mm, slub: only disable irq with spin_lock in __unfreeze_partials() mm, slub: don't disable irqs in slub_cpu_dead() mm, slab: make flush_slab() possible to call with irqs enabled Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context mm: slub: make object_map_lock a raw_spinlock_t Vlastimil Babka <vbabka@suse.cz>: mm, slub: optionally save/restore irqs in slab_[un]lock()/ mm, slub: make slab_lock() disable irqs with PREEMPT_RT mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg mm, slub: use migrate_disable() on PREEMPT_RT mm, slub: convert kmem_cpu_slab protection to local_lock Subsystem: mm/debug Gavin Shan <gshan@redhat.com>: Patch series "mm/debug_vm_pgtable: Enhancements", v6: mm/debug_vm_pgtable: introduce struct pgtable_debug_args mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests mm/debug_vm_pgtable: remove unused code mm/debug_vm_pgtable: fix corrupted page flag "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: report a more useful address for reclaim acquisition liuhailong <liuhailong@oppo.com>: mm: add kernel_misc_reclaimable in show_free_areas Subsystem: mm/pagecache Jan Kara <jack@suse.cz>: Patch series "writeback: Fix bandwidth estimates", v4: writeback: track number of inodes under writeback writeback: reliably update bandwidth estimation writeback: fix bandwidth estimate for spiky workload writeback: rename domain_update_bandwidth() writeback: use READ_ONCE for unlocked reads of writeback stats Johannes Weiner <hannes@cmpxchg.org>: mm: remove irqsave/restore locking from contexts with irqs enabled fs: drop_caches: fix skipping over shadow cache inodes fs: inode: count invalidated shadow pages in pginodesteal Shakeel Butt <shakeelb@google.com>: writeback: memcg: simplify cgroup_writeback_by_id Jing Yangyang <jing.yangyang@zte.com.cn>: include/linux/buffer_head.h: fix boolreturn.cocci warnings Subsystem: mm/gup Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for gup": mm: gup: remove set but unused local variable major mm: gup: remove unneed local variable orig_refs mm: gup: remove useless BUG_ON in __get_user_pages() mm: gup: fix potential pgmap refcnt leak in __gup_device_huge() mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range() John Hubbard <jhubbard@nvidia.com>: Patch series "A few gup refactorings and documentation updates", v3: mm/gup: documentation corrections for gup/pup mm/gup: small refactoring: simplify try_grab_page() mm/gup: remove try_get_page(), call try_get_compound_head() directly Subsystem: mm/swap Hugh Dickins <hughd@google.com>: fs, mm: fix race in unlinking swapfile John Hubbard <jhubbard@nvidia.com>: mm: delete unused get_kernel_page() Subsystem: mm/shmem Sebastian Andrzej Siewior <bigeasy@linutronix.de>: shmem: use raw_spinlock_t for ->stat_lock Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for shmem": shmem: remove unneeded variable ret shmem: remove unneeded header file shmem: remove unneeded function forward declaration shmem: include header file to declare swap_info Hugh Dickins <hughd@google.com>: Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups": huge tmpfs: fix fallocate(vanilla) advance over huge pages huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE huge tmpfs: remove shrinklist addition from shmem_setattr() huge tmpfs: revert shmem's use of transhuge_vma_enabled() huge tmpfs: move shmem_huge_enabled() upwards huge tmpfs: SGP_NOALLOC to stop collapse_file() on race huge tmpfs: shmem_is_huge(vma, inode, index) huge tmpfs: decide stat.st_blksize by shmem_is_huge() shmem: shmem_writepage() split unlikely i915 THP Subsystem: mm/memcg Suren Baghdasaryan <surenb@google.com>: mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config mm, memcg: inline swap-related functions to improve disabled memcg config Vasily Averin <vvs@virtuozzo.com>: memcg: enable accounting for pids in nested pid namespaces Shakeel Butt <shakeelb@google.com>: memcg: switch lruvec stats to rstat memcg: infrastructure to flush memcg stats Yutian Yang <nglaive@gmail.com>: memcg: charge fs_context and legacy_fs_context Vasily Averin <vvs@virtuozzo.com>: Patch series "memcg accounting from OpenVZ", v7: memcg: enable accounting for mnt_cache entries memcg: enable accounting for pollfd and select bits arrays memcg: enable accounting for file lock caches memcg: enable accounting for fasync_cache memcg: enable accounting for new namesapces and struct nsproxy memcg: enable accounting of ipc resources memcg: enable accounting for signals memcg: enable accounting for posix_timers_cache slab memcg: enable accounting for ldt_struct objects Shakeel Butt <shakeelb@google.com>: memcg: cleanup racy sum avoidance code Vasily Averin <vvs@virtuozzo.com>: memcg: replace in_interrupt() by !in_task() in active_memcg() Baolin Wang <baolin.wang@linux.alibaba.com>: mm: memcontrol: set the correct memcg swappiness restriction Miaohe Lin <linmiaohe@huawei.com>: mm, memcg: remove unused functions mm, memcg: save some atomic ops when flush is already true Michal Hocko <mhocko@suse.com>: memcg: fix up drain_local_stock comment Shakeel Butt <shakeelb@google.com>: memcg: make memcg->event_list_lock irqsafe Subsystem: mm/selftests Po-Hsu Lin <po-hsu.lin@canonical.com>: selftests/vm: use kselftest skip code for skipped tests Colin Ian King <colin.king@canonical.com>: selftests: Fix spelling mistake "cann't" -> "cannot" Subsystem: mm/pagemap Nicholas Piggin <npiggin@gmail.com>: Patch series "shoot lazy tlbs", v4: lazy tlb: introduce lazy mm refcount helper functions lazy tlb: allow lazy tlb mm refcounting to be configurable lazy tlb: shoot lazies, a non-refcounting lazy tlb option powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN Christoph Hellwig <hch@lst.de>: Patch series "_kernel_dcache_page fixes and removal": mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page scatterlist: replace flush_kernel_dcache_page with flush_dcache_page mm: remove flush_kernel_dcache_page Huang Ying <ying.huang@intel.com>: mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code Greg Kroah-Hartman <gregkh@linuxfoundation.org>: mm: change fault_in_pages_* to have an unsigned size parameter Luigi Rizzo <lrizzo@google.com>: mm/pagemap: add mmap_assert_locked() annotations to find_vma*() "Liam R. Howlett" <Liam.Howlett@Oracle.com>: remap_file_pages: Use vma_lookup() instead of find_vma() Subsystem: mm/mremap Chen Wandun <chenwandun@huawei.com>: mm/mremap: fix memory account on do_munmap() failure Subsystem: mm/bootmem Muchun Song <songmuchun@bytedance.com>: mm/bootmem_info.c: mark __init on register_page_bootmem_info_section Subsystem: mm/sparsemem Ohhoon Kwon <ohoono.kwon@samsung.com>: Patch series "mm: sparse: remove __section_nr() function", v4: mm: sparse: pass section_nr to section_mark_present mm: sparse: pass section_nr to find_memory_block mm: sparse: remove __section_nr() function Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/sparse: set SECTION_NID_SHIFT to 6 Matthew Wilcox <willy@infradead.org>: include/linux/mmzone.h: avoid a warning in sparse memory support Miles Chen <miles.chen@mediatek.com>: mm/sparse: clarify pgdat_to_phys Subsystem: mm/vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: use batched page requests in bulk-allocator mm/vmalloc: remove gfpflags_allow_blocking() check lib/test_vmalloc.c: add a new 'nr_pages' parameter Chen Wandun <chenwandun@huawei.com>: mm/vmalloc: fix wrong behavior in vread Subsystem: mm/kasan Woody Lin <woodylin@google.com>: mm/kasan: move kasan.fault to mm/kasan/report.c Andrey Konovalov <andreyknvl@gmail.com>: Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2: kasan: test: rework kmalloc_oob_right kasan: test: avoid writing invalid memory kasan: test: avoid corrupting memory via memset kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS kasan: test: only do kmalloc_uaf_memset for generic mode kasan: test: clean up ksize_uaf kasan: test: avoid corrupting memory in copy_user_test kasan: test: avoid corrupting memory in kasan_rcu_uaf Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: ensure consistency of memory map poisoning": mm/page_alloc: always initialize memory map for the holes microblaze: simplify pte_alloc_one_kernel() mm: introduce memmap_alloc() to unify memory map allocation memblock: stop poisoning raw allocations Nico Pache <npache@redhat.com>: mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc: make alloc_node_mem_map() __init rather than __ref Vasily Averin <vvs@virtuozzo.com>: mm/page_alloc.c: use in_task() "George G. Davis" <davis.george@siemens.com>: mm/page_isolation: tracing: trace all test_pages_isolated failures Subsystem: mm/memory-failure Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups and fixup for hwpoison": mm/hwpoison: remove unneeded variable unmap_success mm/hwpoison: fix potential pte_unmap_unlock pte error mm/hwpoison: change argument struct page **hpagep to *hpage mm/hwpoison: fix some obsolete comments Yang Shi <shy828301@gmail.com>: mm: hwpoison: don't drop slab caches for offlining non-LRU page doc: hwpoison: correct the support for hugepage mm: hwpoison: dump page for unhandlable page Michael Wang <yun.wang@linux.alibaba.com>: mm: fix panic caused by __page_handle_poison() Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: simplify prep_compound_gigantic_page ref count racing code hugetlb: drop ref count earlier after page allocation hugetlb: before freeing hugetlb page set dtor to appropriate value hugetlb: fix hugetlb cgroup refcounting during vma split Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: Patch series "userfaultfd: minor bug fixes": userfaultfd: change mmap_changing to atomic userfaultfd: prevent concurrent API initialization selftests/vm/userfaultfd: wake after copy failure Subsystem: mm/vmscan Dave Hansen <dave.hansen@linux.intel.com>: Patch series "Migrate Pages in lieu of discard", v11: mm/numa: automatically generate node migration order mm/migrate: update node demotion order on hotplug events Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate: enable returning precise migrate_pages() success count Dave Hansen <dave.hansen@linux.intel.com>: mm/migrate: demote pages during reclaim Yang Shi <yang.shi@linux.alibaba.com>: mm/vmscan: add page demotion counter Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: add helper for querying ability to age anonymous pages Keith Busch <kbusch@kernel.org>: mm/vmscan: Consider anonymous pages without swap Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: never demote for memcg reclaim Huang Ying <ying.huang@intel.com>: mm/migrate: add sysfs interface to enable reclaim migration Hui Su <suhui@zeku.com>: mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg() Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for vmscan", v2: mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed mm/vmscan: remove misleading setting to sc->priority mm/vmscan: remove unneeded return value of kswapd_run() mm/vmscan: add 'else' to remove check_pending label Vlastimil Babka <vbabka@suse.cz>: mm, vmscan: guarantee drop_slab_node() termination Subsystem: mm/compaction Charan Teja Reddy <charante@codeaurora.org>: mm: compaction: optimize proactive compaction deferrals mm: compaction: support triggering of proactive compaction by user Subsystem: mm/mempolicy Baolin Wang <baolin.wang@linux.alibaba.com>: mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number Dave Hansen <dave.hansen@linux.intel.com>: Patch series "Introduce multi-preference mempolicy", v7: mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes Feng Tang <feng.tang@intel.com>: mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy Ben Widawsky <ben.widawsky@intel.com>: mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY mm/mempolicy: advertise new MPOL_PREFERRED_MANY Feng Tang <feng.tang@intel.com>: mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies Vasily Averin <vvs@virtuozzo.com>: mm/mempolicy.c: use in_task() in mempolicy_slab_node() Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: memblock: make memblock_find_in_range method private Subsystem: mm/oom-kill Suren Baghdasaryan <surenb@google.com>: mm: introduce process_mrelease system call mm: wire up syscall process_mrelease Subsystem: mm/migration Randy Dunlap <rdunlap@infradead.org>: mm/migrate: correct kernel-doc notation Subsystem: mm/ksm Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>: Patch series "add KSM selftests": selftests: vm: add KSM merge test selftests: vm: add KSM unmerge test selftests: vm: add KSM zero page merging test selftests: vm: add KSM merging across nodes test mm: KSM: fix data type Patch series "add KSM performance tests", v3: selftests: vm: add KSM merging time test selftests: vm: add COW time test for KSM pages Subsystem: mm/percpu Jing Xiangfeng <jingxiangfeng@huawei.com>: mm/percpu,c: remove obsolete comments of pcpu_chunk_populated() Subsystem: mm/vmstat Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for vmstat": mm/vmstat: correct some wrong comments mm/vmstat: simplify the array size calculation mm/vmstat: remove unneeded return value Subsystem: mm/madvise zhangkui <zhangkui@oppo.com>: mm/madvise: add MADV_WILLNEED to process_madvise() Documentation/ABI/testing/sysfs-kernel-mm-numa | 24 Documentation/admin-guide/mm/numa_memory_policy.rst | 15 Documentation/admin-guide/sysctl/vm.rst | 3 Documentation/core-api/cachetlb.rst | 86 - Documentation/dev-tools/kasan.rst | 13 Documentation/translations/zh_CN/core-api/cachetlb.rst | 9 Documentation/vm/hwpoison.rst | 1 arch/Kconfig | 28 arch/alpha/kernel/syscalls/syscall.tbl | 2 arch/arm/include/asm/cacheflush.h | 4 arch/arm/kernel/setup.c | 20 arch/arm/mach-rpc/ecard.c | 2 arch/arm/mm/flush.c | 33 arch/arm/mm/nommu.c | 6 arch/arm/tools/syscall.tbl | 2 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kvm/hyp/reserved_mem.c | 9 arch/arm64/mm/init.c | 38 arch/csky/abiv1/cacheflush.c | 11 arch/csky/abiv1/inc/abi/cacheflush.h | 4 arch/csky/kernel/probes/kprobes.c | 3 arch/ia64/include/asm/meminit.h | 2 arch/ia64/kernel/acpi.c | 2 arch/ia64/kernel/setup.c | 55 arch/ia64/kernel/syscalls/syscall.tbl | 2 arch/m68k/kernel/syscalls/syscall.tbl | 2 arch/microblaze/include/asm/page.h | 3 arch/microblaze/include/asm/pgtable.h | 2 arch/microblaze/kernel/syscalls/syscall.tbl | 2 arch/microblaze/mm/init.c | 12 arch/microblaze/mm/pgtable.c | 17 arch/mips/include/asm/cacheflush.h | 8 arch/mips/kernel/setup.c | 14 arch/mips/kernel/syscalls/syscall_n32.tbl | 2 arch/mips/kernel/syscalls/syscall_n64.tbl | 2 arch/mips/kernel/syscalls/syscall_o32.tbl | 2 arch/nds32/include/asm/cacheflush.h | 3 arch/nds32/mm/cacheflush.c | 9 arch/parisc/include/asm/cacheflush.h | 8 arch/parisc/kernel/cache.c | 3 arch/parisc/kernel/syscalls/syscall.tbl | 2 arch/powerpc/Kconfig | 1 arch/powerpc/kernel/smp.c | 2 arch/powerpc/kernel/syscalls/syscall.tbl | 2 arch/powerpc/mm/book3s64/radix_tlb.c | 4 arch/powerpc/platforms/pseries/hotplug-memory.c | 4 arch/riscv/mm/init.c | 44 arch/s390/kernel/setup.c | 9 arch/s390/kernel/syscalls/syscall.tbl | 2 arch/s390/mm/fault.c | 2 arch/sh/include/asm/cacheflush.h | 8 arch/sh/kernel/syscalls/syscall.tbl | 2 arch/sparc/kernel/syscalls/syscall.tbl | 2 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/kernel/aperture_64.c | 5 arch/x86/kernel/ldt.c | 6 arch/x86/mm/init.c | 23 arch/x86/mm/numa.c | 5 arch/x86/mm/numa_emulation.c | 5 arch/x86/realmode/init.c | 2 arch/xtensa/kernel/syscalls/syscall.tbl | 2 block/blk-map.c | 2 drivers/acpi/tables.c | 5 drivers/base/arch_numa.c | 5 drivers/base/memory.c | 4 drivers/mmc/host/jz4740_mmc.c | 4 drivers/mmc/host/mmc_spi.c | 2 drivers/of/of_reserved_mem.c | 12 fs/drop_caches.c | 3 fs/exec.c | 12 fs/fcntl.c | 3 fs/fs-writeback.c | 28 fs/fs_context.c | 4 fs/inode.c | 2 fs/locks.c | 6 fs/namei.c | 8 fs/namespace.c | 7 fs/ocfs2/dlmglue.c | 14 fs/ocfs2/quota_global.c | 1 fs/ocfs2/quota_local.c | 2 fs/pipe.c | 2 fs/select.c | 4 fs/userfaultfd.c | 116 - include/linux/backing-dev-defs.h | 2 include/linux/backing-dev.h | 19 include/linux/buffer_head.h | 2 include/linux/compaction.h | 2 include/linux/highmem.h | 5 include/linux/hugetlb_cgroup.h | 12 include/linux/memblock.h | 2 include/linux/memcontrol.h | 118 + include/linux/memory.h | 2 include/linux/mempolicy.h | 16 include/linux/migrate.h | 14 include/linux/mm.h | 17 include/linux/mmzone.h | 4 include/linux/page-flags.h | 9 include/linux/pagemap.h | 4 include/linux/sched/mm.h | 35 include/linux/shmem_fs.h | 25 include/linux/slub_def.h | 6 include/linux/swap.h | 28 include/linux/syscalls.h | 1 include/linux/userfaultfd_k.h | 8 include/linux/vm_event_item.h | 2 include/linux/vmpressure.h | 2 include/linux/writeback.h | 4 include/trace/events/migrate.h | 3 include/uapi/asm-generic/unistd.h | 4 include/uapi/linux/mempolicy.h | 1 ipc/msg.c | 2 ipc/namespace.c | 2 ipc/sem.c | 9 ipc/shm.c | 2 kernel/cgroup/namespace.c | 2 kernel/cpu.c | 2 kernel/exit.c | 2 kernel/fork.c | 51 kernel/kthread.c | 21 kernel/nsproxy.c | 2 kernel/pid_namespace.c | 5 kernel/sched/core.c | 37 kernel/sched/sched.h | 4 kernel/signal.c | 2 kernel/sys_ni.c | 1 kernel/sysctl.c | 2 kernel/time/namespace.c | 4 kernel/time/posix-timers.c | 4 kernel/user_namespace.c | 2 lib/scatterlist.c | 5 lib/test_kasan.c | 80 - lib/test_kasan_module.c | 20 lib/test_vmalloc.c | 5 mm/backing-dev.c | 11 mm/bootmem_info.c | 4 mm/compaction.c | 69 - mm/debug_vm_pgtable.c | 982 +++++++++------ mm/filemap.c | 15 mm/gup.c | 109 - mm/huge_memory.c | 32 mm/hugetlb.c | 173 ++ mm/hwpoison-inject.c | 2 mm/internal.h | 9 mm/kasan/hw_tags.c | 43 mm/kasan/kasan.h | 1 mm/kasan/report.c | 29 mm/khugepaged.c | 2 mm/ksm.c | 8 mm/madvise.c | 1 mm/memblock.c | 22 mm/memcontrol.c | 234 +-- mm/memory-failure.c | 53 mm/memory_hotplug.c | 2 mm/mempolicy.c | 207 ++- mm/migrate.c | 319 ++++ mm/mmap.c | 7 mm/mremap.c | 2 mm/oom_kill.c | 70 + mm/page-writeback.c | 133 +- mm/page_alloc.c | 62 mm/page_isolation.c | 13 mm/percpu.c | 3 mm/shmem.c | 309 ++-- mm/slab_common.c | 2 mm/slub.c | 1085 ++++++++++------- mm/sparse.c | 46 mm/swap.c | 22 mm/swapfile.c | 14 mm/truncate.c | 28 mm/userfaultfd.c | 15 mm/vmalloc.c | 79 - mm/vmpressure.c | 10 mm/vmscan.c | 220 ++- mm/vmstat.c | 25 security/tomoyo/domain.c | 13 tools/testing/scatterlist/linux/mm.h | 1 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 3 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 5 tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 5 tools/testing/selftests/vm/ksm_tests.c | 696 ++++++++++ tools/testing/selftests/vm/mlock-random-test.c | 2 tools/testing/selftests/vm/run_vmtests.sh | 98 + tools/testing/selftests/vm/userfaultfd.c | 13 186 files changed, 4488 insertions(+), 2281 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-09-02 21:48 incoming Andrew Morton @ 2021-09-02 21:49 ` Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote: > 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b. Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f". ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-08-25 19:17 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9. Subsystems affected by this patch series: mm/memory-hotplug MAINTAINERS Subsystem: mm/memory-hotplug Miaohe Lin <linmiaohe@huawei.com>: mm/memory_hotplug: fix potential permanent lru cache disable Subsystem: MAINTAINERS Namjae Jeon <namjae.jeon@samsung.com>: MAINTAINERS: exfat: update my email address MAINTAINERS | 2 +- mm/memory_hotplug.c | 1 + 2 files changed, 2 insertions(+), 1 deletion(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-08-20 2:03 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-08-20 2:03 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on 614cb2751d3150850d459bee596c397f344a7936. Subsystems affected by this patch series: mm/shmem mm/pagealloc mm/tracing MAINTAINERS mm/memcg mm/memory-failure mm/vmscan mm/kfence mm/hugetlb Subsystem: mm/shmem Yang Shi <shy828301@gmail.com>: Revert "mm/shmem: fix shmem_swapin() race with swapoff" Revert "mm: swap: check if swap backing device is congested or not" Subsystem: mm/pagealloc Doug Berger <opendmb@gmail.com>: mm/page_alloc: don't corrupt pcppage_migratetype Subsystem: mm/tracing Mike Rapoport <rppt@linux.ibm.com>: mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS: update ClangBuiltLinux IRC chat Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: retry with shake_page() for unhandlable pages Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: mm: vmscan: fix missing psi annotation for node_reclaim() Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: don't pass page cache pages to restore_reserve_on_error MAINTAINERS | 2 +- include/linux/kfence.h | 7 ++++--- include/linux/memcontrol.h | 29 +++++++++++++++-------------- include/trace/events/mmflags.h | 4 +++- mm/hugetlb.c | 19 ++++++++++++++----- mm/memory-failure.c | 12 +++++++++--- mm/page_alloc.c | 25 ++++++++++++------------- mm/shmem.c | 14 +------------- mm/swap_state.c | 7 ------- mm/vmscan.c | 30 ++++++++++++++++++++++-------- 10 files changed, 81 insertions(+), 68 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-08-13 23:53 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008. Subsystems affected by this patch series: mm/kasan mm/slub mm/madvise mm/memcg lib Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: Patch series "kasan, slub: reset tag when printing address", v3: kasan, kmemleak: reset tags when scanning block kasan, slub: reset tag when printing address Subsystem: mm/slub Shakeel Butt <shakeelb@google.com>: slub: fix kmalloc_pagealloc_invalid_free unit test Vlastimil Babka <vbabka@suse.cz>: mm: slub: fix slub_debug disabling for list of slabs Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE) Subsystem: mm/memcg Waiman Long <longman@redhat.com>: mm/memcg: fix incorrect flushing of lruvec data in obj_stock Subsystem: lib Liang Wang <wangliang101@huawei.com>: lib: use PFN_PHYS() in devmem_is_allowed() lib/devmem_is_allowed.c | 2 +- mm/gup.c | 7 +++++-- mm/kmemleak.c | 6 +++--- mm/madvise.c | 4 +++- mm/memcontrol.c | 6 ++++-- mm/slub.c | 25 ++++++++++++++----------- 6 files changed, 30 insertions(+), 20 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-07-29 21:52 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2. Subsystems affected by this patch series: lib ocfs2 mm/memcg mm/migration mm/slub mm/memcg Subsystem: lib Matteo Croce <mcroce@microsoft.com>: lib/test_string.c: move string selftest in the Runtime Testing menu Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: fix zero out valid data ocfs2: issue zeroout to EOF blocks Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code Subsystem: mm/migration "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/migrate: fix NR_ISOLATED corruption on 64-bit Subsystem: mm/slub Shakeel Butt <shakeelb@google.com>: slub: fix unreclaimable slab stat for bulk free Subsystem: mm/memcg Wang Hai <wanghai38@huawei.com>: mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook() fs/ocfs2/file.c | 103 ++++++++++++++++++++++++++++++++---------------------- lib/Kconfig | 3 - lib/Kconfig.debug | 3 + mm/memcontrol.c | 3 + mm/migrate.c | 2 - mm/slab.h | 2 - mm/slub.c | 22 ++++++----- 7 files changed, 81 insertions(+), 57 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-07-23 22:49 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55. Subsystems affected by this patch series: mm/userfaultfd mm/kfence mm/highmem mm/pagealloc mm/memblock mm/pagecache mm/secretmem mm/pagemap mm/hugetlbfs Subsystem: mm/userfaultfd Peter Collingbourne <pcc@google.com>: Patch series "userfaultfd: do not untag user pointers", v5: userfaultfd: do not untag user pointers selftest: use mmap instead of posix_memalign to allocate memory Subsystem: mm/kfence Weizhao Ouyang <o451686892@gmail.com>: kfence: defer kfence_test_init to ensure that kunit debugfs is created Alexander Potapenko <glider@google.com>: kfence: move the size check to the beginning of __kfence_alloc() kfence: skip all GFP_ZONEMASK allocations Subsystem: mm/highmem Christoph Hellwig <hch@lst.de>: mm: call flush_dcache_page() in memcpy_to_page() and memzero_page() mm: use kmap_local_page in memzero_page Subsystem: mm/pagealloc Sergei Trofimovich <slyfox@gentoo.org>: mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions Subsystem: mm/pagecache Roman Gushchin <guro@fb.com>: writeback, cgroup: remove wb from offline list before releasing refcnt writeback, cgroup: do not reparent dax inodes Subsystem: mm/secretmem Mike Rapoport <rppt@linux.ibm.com>: mm/secretmem: wire up ->set_page_dirty Subsystem: mm/pagemap Muchun Song <songmuchun@bytedance.com>: mm: mmap_lock: fix disabling preemption directly Qi Zheng <zhengqi.arch@bytedance.com>: mm: fix the deadlock in finish_fault() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: fix mount mode command line processing Documentation/arm64/tagged-address-abi.rst | 26 ++++++++++++++++++-------- fs/fs-writeback.c | 3 +++ fs/hugetlbfs/inode.c | 2 +- fs/userfaultfd.c | 26 ++++++++++++-------------- include/linux/highmem.h | 6 ++++-- include/linux/memblock.h | 4 ++-- mm/backing-dev.c | 2 +- mm/kfence/core.c | 19 ++++++++++++++++--- mm/kfence/kfence_test.c | 2 +- mm/memblock.c | 3 ++- mm/memory.c | 11 ++++++++++- mm/mmap_lock.c | 4 ++-- mm/page_alloc.c | 29 ++++++++++++++++------------- mm/secretmem.c | 1 + tools/testing/selftests/vm/userfaultfd.c | 6 ++++-- 15 files changed, 93 insertions(+), 51 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-07-15 4:26 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-07-15 4:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e. Subsystems affected by this patch series: mm/kasan mm/pagealloc mm/rmap mm/hmm hfs mm/hugetlb Subsystem: mm/kasan Marco Elver <elver@google.com>: mm: move helper to check slub_debug_enabled Yee Lee <yee.lee@mediatek.com>: kasan: add memzero init for unaligned size at DEBUG Marco Elver <elver@google.com>: kasan: fix build by including kernel.h Subsystem: mm/pagealloc Matteo Croce <mcroce@microsoft.com>: Revert "mm/page_alloc: make should_fail_alloc_page() static" Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: avoid page allocator recursion with pagesets.lock held Yanfei Xu <yanfei.xu@windriver.com>: mm/page_alloc: correct return value when failing at preparing Chuck Lever <chuck.lever@oracle.com>: mm/page_alloc: further fix __alloc_pages_bulk() return value Subsystem: mm/rmap Christoph Hellwig <hch@lst.de>: mm: fix the try_to_unmap prototype for !CONFIG_MMU Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: lib/test_hmm: remove set but unused page variable Subsystem: hfs Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>: Patch series "hfs: fix various errors", v2: hfs: add missing clean-up in hfs_fill_super hfs: fix high memory mapping in hfs_bnode_read hfs: add lock nesting notation to hfs_find_init Subsystem: mm/hugetlb Joao Martins <joao.m.martins@oracle.com>: mm/hugetlb: fix refs calculation from unaligned @vaddr fs/hfs/bfind.c | 14 +++++++++++++- fs/hfs/bnode.c | 25 ++++++++++++++++++++----- fs/hfs/btree.h | 7 +++++++ fs/hfs/super.c | 10 +++++----- include/linux/kasan.h | 1 + include/linux/rmap.h | 4 +++- lib/test_hmm.c | 2 -- mm/hugetlb.c | 5 +++-- mm/kasan/kasan.h | 12 ++++++++++++ mm/page_alloc.c | 30 ++++++++++++++++++++++-------- mm/slab.h | 15 +++++++++++---- mm/slub.c | 14 -------------- 12 files changed, 97 insertions(+), 42 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-07-08 0:59 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-07-08 0:59 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d. Subsystems affected by this patch series: lib mm/slub mm/secretmem mm/cleanups mm/init debug mm/pagemap mm/mremap Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib/test: fix spelling mistakes lib: fix spelling mistakes lib: fix spelling mistakes in header files Subsystem: mm/slub Nathan Chancellor <nathan@kernel.org>: Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN": hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script hexagon: use common DISCARDS macro hexagon: select ARCH_WANT_LD_ORPHAN_WARN Oliver Glitta <glittao@gmail.com>: mm/slub: use stackdepot to save stack trace in objects Subsystem: mm/secretmem Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20: mmap: make mlock_future_check() global riscv/Kconfig: make direct map manipulation options depend on MMU set_memory: allow querying whether set_direct_map_*() is actually enabled mm: introduce memfd_secret system call to create "secret" memory areas PM: hibernate: disable when there are active secretmem users arch, mm: wire up memfd_secret system call where relevant secretmem: test: add basic selftest for memfd_secret(2) Subsystem: mm/cleanups Zhen Lei <thunder.leizhen@huawei.com>: mm: fix spelling mistakes in header files Subsystem: mm/init Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3: mm: add setup_initial_init_mm() helper arc: convert to setup_initial_init_mm() arm: convert to setup_initial_init_mm() arm64: convert to setup_initial_init_mm() csky: convert to setup_initial_init_mm() h8300: convert to setup_initial_init_mm() m68k: convert to setup_initial_init_mm() nds32: convert to setup_initial_init_mm() nios2: convert to setup_initial_init_mm() openrisc: convert to setup_initial_init_mm() powerpc: convert to setup_initial_init_mm() riscv: convert to setup_initial_init_mm() s390: convert to setup_initial_init_mm() sh: convert to setup_initial_init_mm() x86: convert to setup_initial_init_mm() Subsystem: debug Stephen Boyd <swboyd@chromium.org>: Patch series "Add build ID to stacktraces", v6: buildid: only consider GNU notes for build ID parsing buildid: add API to parse build ID out of buffer buildid: stash away kernels build ID on init dump_stack: add vmlinux build ID to stack traces module: add printk formats to add module build ID to stacktraces arm64: stacktrace: use %pSb for backtrace printing x86/dumpstack: use %pSb/%pBb for backtrace printing scripts/decode_stacktrace.sh: support debuginfod scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path buildid: mark some arguments const buildid: fix kernel-doc notation kdump: use vmlinux_build_id to simplify Subsystem: mm/pagemap "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t * mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t * Subsystem: mm/mremap "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mrermap fixes", v2: selftest/mremap_test: update the test to handle pagesize other than 4K selftest/mremap_test: avoid crash with static build mm/mremap: convert huge PUD move to separate helper mm/mremap: don't enable optimized PUD move if page table levels is 2 mm/mremap: use pmd/pud_poplulate to update page table entries mm/mremap: hold the rmap lock in write mode when moving page table entries. Patch series "Speedup mremap on ppc64", v8: mm/mremap: allow arch runtime override powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache powerpc/mm: enable HAVE_MOVE_PMD support Documentation/core-api/printk-formats.rst | 11 arch/alpha/include/asm/pgtable.h | 8 arch/arc/mm/init.c | 5 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/kernel/setup.c | 5 arch/arm64/include/asm/Kbuild | 1 arch/arm64/include/asm/cacheflush.h | 6 arch/arm64/include/asm/kfence.h | 2 arch/arm64/include/asm/pgtable.h | 8 arch/arm64/include/asm/set_memory.h | 17 + arch/arm64/include/uapi/asm/unistd.h | 1 arch/arm64/kernel/machine_kexec.c | 1 arch/arm64/kernel/setup.c | 5 arch/arm64/kernel/stacktrace.c | 2 arch/arm64/mm/mmu.c | 7 arch/arm64/mm/pageattr.c | 13 arch/csky/kernel/setup.c | 5 arch/h8300/kernel/setup.c | 5 arch/hexagon/Kconfig | 1 arch/hexagon/kernel/vmlinux.lds.S | 9 arch/ia64/include/asm/pgtable.h | 4 arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/kernel/setup_mm.c | 5 arch/m68k/kernel/setup_no.c | 5 arch/mips/include/asm/pgtable-64.h | 8 arch/nds32/kernel/setup.c | 5 arch/nios2/kernel/setup.c | 5 arch/openrisc/kernel/setup.c | 5 arch/parisc/include/asm/pgtable.h | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 11 arch/powerpc/include/asm/book3s/64/tlbflush-radix.h | 2 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 6 arch/powerpc/include/asm/nohash/64/pgtable.h | 6 arch/powerpc/include/asm/tlb.h | 6 arch/powerpc/kernel/setup-common.c | 5 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 8 arch/powerpc/mm/book3s64/radix_pgtable.c | 6 arch/powerpc/mm/book3s64/radix_tlb.c | 44 +- arch/powerpc/mm/pgtable_64.c | 4 arch/powerpc/platforms/Kconfig.cputype | 2 arch/riscv/Kconfig | 4 arch/riscv/include/asm/pgtable-64.h | 4 arch/riscv/include/asm/unistd.h | 1 arch/riscv/kernel/setup.c | 5 arch/s390/kernel/setup.c | 5 arch/sh/include/asm/pgtable-3level.h | 4 arch/sh/kernel/setup.c | 5 arch/sparc/include/asm/pgtable_32.h | 6 arch/sparc/include/asm/pgtable_64.h | 10 arch/um/include/asm/pgtable-3level.h | 2 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/include/asm/pgtable.h | 8 arch/x86/kernel/dumpstack.c | 2 arch/x86/kernel/setup.c | 5 arch/x86/mm/init_64.c | 4 arch/x86/mm/pat/set_memory.c | 4 arch/x86/mm/pgtable.c | 2 include/asm-generic/pgtable-nop4d.h | 2 include/asm-generic/pgtable-nopmd.h | 2 include/asm-generic/pgtable-nopud.h | 4 include/linux/bootconfig.h | 4 include/linux/buildid.h | 10 include/linux/compaction.h | 4 include/linux/cpumask.h | 2 include/linux/crash_core.h | 12 include/linux/debugobjects.h | 2 include/linux/hmm.h | 2 include/linux/hugetlb.h | 6 include/linux/kallsyms.h | 21 + include/linux/list_lru.h | 4 include/linux/lru_cache.h | 8 include/linux/mm.h | 3 include/linux/mmu_notifier.h | 8 include/linux/module.h | 9 include/linux/nodemask.h | 6 include/linux/percpu-defs.h | 2 include/linux/percpu-refcount.h | 2 include/linux/pgtable.h | 4 include/linux/scatterlist.h | 2 include/linux/secretmem.h | 54 +++ include/linux/set_memory.h | 12 include/linux/shrinker.h | 2 include/linux/syscalls.h | 1 include/linux/vmalloc.h | 4 include/uapi/asm-generic/unistd.h | 7 include/uapi/linux/magic.h | 1 init/Kconfig | 1 init/main.c | 2 kernel/crash_core.c | 50 --- kernel/kallsyms.c | 104 +++++-- kernel/module.c | 42 ++ kernel/power/hibernate.c | 5 kernel/sys_ni.c | 2 lib/Kconfig.debug | 17 - lib/asn1_encoder.c | 2 lib/buildid.c | 80 ++++- lib/devres.c | 2 lib/dump_stack.c | 13 lib/dynamic_debug.c | 2 lib/fonts/font_pearl_8x8.c | 2 lib/kfifo.c | 2 lib/list_sort.c | 2 lib/nlattr.c | 4 lib/oid_registry.c | 2 lib/pldmfw/pldmfw.c | 2 lib/reed_solomon/test_rslib.c | 2 lib/refcount.c | 2 lib/rhashtable.c | 2 lib/sbitmap.c | 2 lib/scatterlist.c | 4 lib/seq_buf.c | 2 lib/sort.c | 2 lib/stackdepot.c | 2 lib/test_bitops.c | 2 lib/test_bpf.c | 2 lib/test_kasan.c | 2 lib/test_kmod.c | 6 lib/test_scanf.c | 2 lib/vsprintf.c | 10 mm/Kconfig | 4 mm/Makefile | 1 mm/gup.c | 12 mm/init-mm.c | 9 mm/internal.h | 3 mm/mlock.c | 3 mm/mmap.c | 5 mm/mremap.c | 108 ++++++- mm/secretmem.c | 254 +++++++++++++++++ mm/slub.c | 79 +++-- scripts/checksyscalls.sh | 4 scripts/decode_stacktrace.sh | 89 +++++- tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 3 tools/testing/selftests/vm/memfd_secret.c | 296 ++++++++++++++++++++ tools/testing/selftests/vm/mremap_test.c | 116 ++++--- tools/testing/selftests/vm/run_vmtests.sh | 17 + 137 files changed, 1470 insertions(+), 442 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-07-01 1:46 Andrew Morton 2021-07-03 0:28 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-07-01 1:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits This is the rest of the -mm tree, less 66 patches which are dependent on things which are (or were recently) in linux-next. I'll trickle that material over next week. 192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the June 28 sendings. Subsystems affected by this patch series: mm/hugetlb mm/userfaultfd mm/vmscan mm/kconfig mm/proc mm/z3fold mm/zbud mm/ras mm/mempolicy mm/memblock mm/migration mm/thp mm/nommu mm/kconfig mm/madvise mm/memory-hotplug mm/zswap mm/zsmalloc mm/zram mm/cleanups mm/kfence mm/hmm procfs sysctl misc core-kernel lib lz4 checkpatch init kprobes nilfs2 hfs signals exec kcov selftests compress/decompress ipc Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: Patch series "Free some vmemmap pages of HugeTLB page", v23: mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP mm: hugetlb: gather discrete indexes of tail page mm: hugetlb: free the vmemmap pages associated with each HugeTLB page mm: hugetlb: defer freeing of HugeTLB pages mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate Shixin Liu <liushixin2@huawei.com>: mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for huge_memory:, v3: mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK mm/huge_memory.c: use page->deferred_list mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled() mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd mm/huge_memory.c: don't discard hugepage if other processes are mapping it Christophe Leroy <christophe.leroy@csgroup.eu>: Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2: mm/hugetlb: change parameters of arch_make_huge_pte() mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge mm/vmalloc: enable mapping of huge pages at pte level in vmap mm/vmalloc: enable mapping of huge pages at pte level in vmalloc powerpc/8xx: add support for huge pages on VMAP and VMALLOC Nanyong Sun <sunnanyong@huawei.com>: khugepaged: selftests: remove debug_cow Mina Almasry <almasrymina@google.com>: mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY Muchun Song <songmuchun@bytedance.com>: Patch series "Split huge PMD mapping of vmemmap pages", v4: mm: sparsemem: split the huge PMD mapping of vmemmap pages mm: sparsemem: use huge PMD mapping for vmemmap pages mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Fix prep_compound_gigantic_page ref count adjustment": hugetlb: remove prep_compound_huge_page cleanup hugetlb: address ref count racing in prep_compound_gigantic_page Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: disable pcp for page_handle_poison() Subsystem: mm/userfaultfd Peter Xu <peterx@redhat.com>: Patch series "userfaultfd/selftests: A few cleanups", v2: userfaultfd/selftests: use user mode only userfaultfd/selftests: remove the time() check on delayed uffd userfaultfd/selftests: dropping VERIFY check in locking_thread userfaultfd/selftests: only dump counts if mode enabled userfaultfd/selftests: unify error handling Patch series "mm/uffd: Misc fix for uffd-wp and one more test": mm/thp: simplify copying of huge zero page pmd when fork mm/userfaultfd: fix uffd-wp special cases for fork() mm/userfaultfd: fail uffd-wp registration if not supported mm/pagemap: export uffd-wp protection information userfaultfd/selftests: add pagemap uffd-wp test Axel Rasmussen <axelrasmussen@google.com>: Patch series "userfaultfd: add minor fault handling for shmem", v6: userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte userfaultfd/shmem: support minor fault registration for shmem userfaultfd/shmem: support UFFDIO_CONTINUE for shmem userfaultfd/shmem: advertise shmem minor fault support userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte() userfaultfd/selftests: use memfd_create for shmem test type userfaultfd/selftests: create alias mappings in the shmem test userfaultfd/selftests: reinitialize test context in each test userfaultfd/selftests: exercise minor fault handling shmem support Subsystem: mm/vmscan Yu Zhao <yuzhao@google.com>: mm/vmscan.c: fix potential deadlock in reclaim_pages() include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low Miaohe Lin <linmiaohe@huawei.com>: mm: workingset: define macro WORKINGSET_SHIFT Subsystem: mm/kconfig Kefeng Wang <wangkefeng.wang@huawei.com>: mm/kconfig: move HOLES_IN_ZONE into mm Subsystem: mm/proc Mike Rapoport <rppt@linux.ibm.com>: docs: proc.rst: meminfo: briefly describe gaps in memory accounting David Hildenbrand <david@redhat.com>: Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3: fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline() virtio-mem: use page_offline_(start|end) when setting PageOffline() fs/proc/kcore: use page_offline_(freeze|thaw) Subsystem: mm/z3fold Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for z3fold": mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS mm/z3fold: avoid possible underflow in z3fold_alloc() mm/z3fold: remove magic number in z3fold_create_pool() mm/z3fold: remove unused function handle_to_z3fold_header() mm/z3fold: fix potential memory leak in z3fold_destroy_pool() mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page Subsystem: mm/zbud Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanups for zbud", v2: mm/zbud: reuse unbuddied[0] as buddied in zbud_pool mm/zbud: don't export any zbud API Subsystem: mm/ras YueHaibing <yuehaibing@huawei.com>: mm/compaction: use DEVICE_ATTR_WO macro Liu Xiang <liu.xiang@zlingsmart.com>: mm: compaction: remove duplicate !list_empty(&sublist) check Wonhyuk Yang <vvghjk1234@gmail.com>: mm/compaction: fix 'limit' in fast_isolate_freepages Subsystem: mm/mempolicy Feng Tang <feng.tang@intel.com>: Patch series "mm/mempolicy: some fix and semantics cleanup", v4: mm/mempolicy: cleanup nodemask intersection check for oom mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy Yang Shi <shy828301@gmail.com>: mm: mempolicy: don't have to split pmd for huge zero page Ben Widawsky <ben.widawsky@intel.com>: mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4: include/linux/mmzone.h: add documentation for pfn_valid() memblock: update initialization of reserved pages arm64: decouple check whether pfn is in linear map from pfn_valid() arm64: drop pfn_valid_within() and simplify pfn_valid() Anshuman Khandual <anshuman.khandual@arm.com>: arm64/mm: drop HAVE_ARCH_PFN_VALID Subsystem: mm/migration Muchun Song <songmuchun@bytedance.com>: mm: migrate: fix missing update page_private to hugetlb_page_subpool Subsystem: mm/thp Collin Fijalkovich <cfijalkovich@google.com>: mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs Yang Shi <shy828301@gmail.com>: mm: memory: add orig_pmd to struct vm_fault mm: memory: make numa_migrate_prep() non-static mm: thp: refactor NUMA fault handling mm: migrate: account THP NUMA migration counters correctly mm: migrate: don't split THP for misplaced NUMA page mm: migrate: check mapcount for THP instead of refcount mm: thp: skip make PMD PROT_NONE if THP migration is not supported Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2 Yang Shi <shy828301@gmail.com>: mm: rmap: make try_to_unmap() void function Hugh Dickins <hughd@google.com>: mm/thp: remap_page() is only needed on anonymous THP mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/thp: fix strncpy warning Subsystem: mm/nommu Chen Li <chenli@uniontech.com>: nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc Liam Howlett <liam.howlett@oracle.com>: mm/nommu: unexport do_munmap() Subsystem: mm/kconfig Kefeng Wang <wangkefeng.wang@huawei.com>: mm: generalize ZONE_[DMA|DMA32] Subsystem: mm/madvise David Hildenbrand <david@redhat.com>: Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2: mm: make variable names for populate_vma_page_range() consistent mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore selftests/vm: add test for MADV_POPULATE_(READ|WRITE) Subsystem: mm/memory-hotplug Liam Mark <lmark@codeaurora.org>: mm/memory_hotplug: rate limit page migration warnings Oscar Salvador <osalvador@suse.de>: mm,memory_hotplug: drop unneeded locking Subsystem: mm/zswap Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for zswap": mm/zswap.c: remove unused function zswap_debugfs_exit() mm/zswap.c: avoid unnecessary copy-in at map time mm/zswap.c: fix two bugs in zswap_writeback_entry() Subsystem: mm/zsmalloc Zhaoyang Huang <zhaoyang.huang@unisoc.com>: mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for zsmalloc": mm/zsmalloc.c: remove confusing code in obj_free() mm/zsmalloc.c: improve readability for async_free_zspage() Subsystem: mm/zram Yue Hu <huyue2@yulong.com>: zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK Subsystem: mm/cleanups Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm: fix typos and grammar error in comments Anshuman Khandual <anshuman.khandual@arm.com>: mm: define default value for FIRST_USER_ADDRESS Zhen Lei <thunder.leizhen@huawei.com>: mm: fix spelling mistakes Mel Gorman <mgorman@techsingularity.net>: Patch series "Clean W=1 build warnings for mm/": mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages mm/vmalloc: include header for prototype of set_iounmap_nonlazy mm/page_alloc: make should_fail_alloc_page() static mm/mapping_dirty_helpers: remove double Note in kerneldoc mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection mm/memory_hotplug: fix kerneldoc comment for __try_online_node mm/memory_hotplug: fix kerneldoc comment for __remove_memory mm/zbud: add kerneldoc fields for zbud_pool mm/z3fold: add kerneldoc fields for z3fold_pool mm/swap: make swap_address_space an inline function mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations mm/page_alloc: move prototype for find_suitable_fallback mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM Anshuman Khandual <anshuman.khandual@arm.com>: mm/thp: define default pmd_pgtable() Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: unconditionally use unbound work queue Subsystem: mm/hmm Alistair Popple <apopple@nvidia.com>: Patch series "Add support for SVM atomics in Nouveau", v11: mm: remove special swap entry functions mm/swapops: rework swap entry manipulation code mm/rmap: split try_to_munlock from try_to_unmap mm/rmap: split migration into its own function mm: rename migrate_pgmap_owner mm/memory.c: allow different return codes for copy_nonpresent_pte() mm: device exclusive memory access mm: selftests for exclusive device memory nouveau/svm: refactor nouveau_range_fault nouveau/svm: implement atomic SVM access Subsystem: procfs Marcelo Henrique Cerri <marcelo.cerri@canonical.com>: proc: Avoid mixing integer types in mem_rw() ZHOUFENG <zhoufeng.zf@bytedance.com>: fs/proc/kcore.c: add mmap interface Kalesh Singh <kaleshsingh@google.com>: procfs: allow reading fdinfo with PTRACE_MODE_READ procfs/dmabuf: add inode number to /proc/*/fdinfo Subsystem: sysctl Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: sysctl: remove redundant assignment to first Subsystem: misc Andy Shevchenko <andriy.shevchenko@linux.intel.com>: drm: include only needed headers in ascii85.h Subsystem: core-kernel Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out panic and oops helpers Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib: decompress_bunzip2: remove an unneeded semicolon Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3: lib/string_helpers: switch to use BIT() macro lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop lib/string_helpers: drop indentation level in string_escape_mem() lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable lib/string_helpers: allow to append additional characters to be escaped lib/test-string_helpers: print flags in hexadecimal format lib/test-string_helpers: get rid of trailing comma in terminators lib/test-string_helpers: add test cases for new features MAINTAINERS: add myself as designated reviewer for generic string library seq_file: introduce seq_escape_mem() seq_file: add seq_escape_str() as replica of string_escape_str() seq_file: convert seq_escape() to use seq_escape_str() nfsd: avoid non-flexible API in seq_quote_mem() seq_file: drop unused *_escape_mem_ascii() Trent Piepho <tpiepho@gmail.com>: lib/math/rational.c: fix divide by zero lib/math/rational: add Kunit test cases Zhen Lei <thunder.leizhen@huawei.com>: lib/decompressors: fix spelling mistakes lib/mpi: fix spelling mistakes Alexey Dobriyan <adobriyan@gmail.com>: lib: memscan() fixlet lib: uninline simple_strtoull() Matteo Croce <mcroce@microsoft.com>: lib/test_string.c: allow module removal Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out kstrtox() and simple_strtox() to a separate header Subsystem: lz4 Rajat Asthana <thisisrast7@gmail.com>: lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static Dimitri John Ledkov <dimitri.ledkov@canonical.com>: lib/decompress_unlz4.c: correctly handle zero-padding around initrds. Subsystem: checkpatch Guenter Roeck <linux@roeck-us.net>: checkpatch: scripts/spdxcheck.py now requires python3 Joe Perches <joe@perches.com>: checkpatch: improve the indented label test Guenter Roeck <linux@roeck-us.net>: checkpatch: do not complain about positive return values starting with EPOLL Subsystem: init Andrew Halaney <ahalaney@redhat.com>: init: print out unknown kernel parameters Subsystem: kprobes Barry Song <song.bao.hua@hisilicon.com>: kprobes: remove duplicated strong free_insn_page in x86 and s390 Subsystem: nilfs2 Colin Ian King <colin.king@canonical.com>: nilfs2: remove redundant continue statement in a while-loop Subsystem: hfs Zhen Lei <thunder.leizhen@huawei.com>: hfsplus: remove unnecessary oom message Chung-Chiang Cheng <shepjeng@gmail.com>: hfsplus: report create_date to kstat.btime Subsystem: signals Al Viro <viro@zeniv.linux.org.uk>: x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned Subsystem: exec Alexey Dobriyan <adobriyan@gmail.com>: exec: remove checks in __register_bimfmt() Subsystem: kcov Marco Elver <elver@google.com>: kcov: add __no_sanitize_coverage to fix noinstr for all architectures Subsystem: selftests Dave Hansen <dave.hansen@linux.intel.com>: Patch series "selftests/vm/pkeys: Bug fixes and a new test": selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random selftests/vm/pkeys: handle negative sys_pkey_alloc() return code selftests/vm/pkeys: refill shadow register after implicit kernel write selftests/vm/pkeys: exercise x86 XSAVE init state Subsystem: compress/decompress Yu Kuai <yukuai3@huawei.com>: lib/decompressors: remove set but not used variabled 'level' Subsystem: ipc Vasily Averin <vvs@virtuozzo.com>: Patch series "ipc: allocations cleanup", v2: ipc sem: use kvmalloc for sem_undo allocation ipc: use kmalloc for msg_queue and shmid_kernel Manfred Spraul <manfred@colorfullife.com>: ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock ipc/util.c: use binary search for max_idx Documentation/admin-guide/kernel-parameters.txt | 35 Documentation/admin-guide/mm/hugetlbpage.rst | 11 Documentation/admin-guide/mm/memory-hotplug.rst | 13 Documentation/admin-guide/mm/pagemap.rst | 2 Documentation/admin-guide/mm/userfaultfd.rst | 3 Documentation/core-api/kernel-api.rst | 7 Documentation/filesystems/proc.rst | 48 Documentation/vm/hmm.rst | 19 Documentation/vm/unevictable-lru.rst | 33 MAINTAINERS | 10 arch/alpha/Kconfig | 5 arch/alpha/include/asm/pgalloc.h | 1 arch/alpha/include/asm/pgtable.h | 1 arch/alpha/include/uapi/asm/mman.h | 3 arch/alpha/kernel/setup.c | 2 arch/arc/include/asm/pgalloc.h | 2 arch/arc/include/asm/pgtable.h | 8 arch/arm/Kconfig | 3 arch/arm/include/asm/pgalloc.h | 1 arch/arm64/Kconfig | 15 arch/arm64/include/asm/hugetlb.h | 3 arch/arm64/include/asm/memory.h | 2 arch/arm64/include/asm/page.h | 4 arch/arm64/include/asm/pgalloc.h | 1 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/kernel/setup.c | 1 arch/arm64/kvm/mmu.c | 2 arch/arm64/mm/hugetlbpage.c | 5 arch/arm64/mm/init.c | 51 arch/arm64/mm/ioremap.c | 4 arch/arm64/mm/mmu.c | 22 arch/csky/include/asm/pgalloc.h | 2 arch/csky/include/asm/pgtable.h | 1 arch/hexagon/include/asm/pgtable.h | 4 arch/ia64/Kconfig | 7 arch/ia64/include/asm/pal.h | 1 arch/ia64/include/asm/pgalloc.h | 1 arch/ia64/include/asm/pgtable.h | 1 arch/m68k/Kconfig | 5 arch/m68k/include/asm/mcf_pgalloc.h | 2 arch/m68k/include/asm/mcf_pgtable.h | 2 arch/m68k/include/asm/motorola_pgalloc.h | 1 arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/include/asm/pgtable_mm.h | 1 arch/m68k/include/asm/sun3_pgalloc.h | 1 arch/microblaze/Kconfig | 4 arch/microblaze/include/asm/pgalloc.h | 2 arch/microblaze/include/asm/pgtable.h | 2 arch/mips/Kconfig | 10 arch/mips/include/asm/pgalloc.h | 1 arch/mips/include/asm/pgtable-32.h | 1 arch/mips/include/asm/pgtable-64.h | 1 arch/mips/include/uapi/asm/mman.h | 3 arch/mips/kernel/relocate.c | 1 arch/mips/sgi-ip22/ip22-reset.c | 1 arch/mips/sgi-ip32/ip32-reset.c | 1 arch/nds32/include/asm/pgalloc.h | 5 arch/nios2/include/asm/pgalloc.h | 1 arch/nios2/include/asm/pgtable.h | 2 arch/openrisc/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgtable.h | 1 arch/parisc/include/asm/pgalloc.h | 1 arch/parisc/include/asm/pgtable.h | 2 arch/parisc/include/uapi/asm/mman.h | 3 arch/parisc/kernel/pdc_chassis.c | 1 arch/powerpc/Kconfig | 6 arch/powerpc/include/asm/book3s/pgtable.h | 1 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 5 arch/powerpc/include/asm/nohash/32/mmu-8xx.h | 43 arch/powerpc/include/asm/nohash/32/pgtable.h | 1 arch/powerpc/include/asm/nohash/64/pgtable.h | 2 arch/powerpc/include/asm/pgalloc.h | 5 arch/powerpc/include/asm/pgtable.h | 6 arch/powerpc/kernel/setup-common.c | 1 arch/powerpc/platforms/Kconfig.cputype | 1 arch/riscv/Kconfig | 5 arch/riscv/include/asm/pgalloc.h | 2 arch/riscv/include/asm/pgtable.h | 2 arch/s390/Kconfig | 6 arch/s390/include/asm/pgalloc.h | 3 arch/s390/include/asm/pgtable.h | 5 arch/s390/kernel/ipl.c | 1 arch/s390/kernel/kprobes.c | 5 arch/s390/mm/pgtable.c | 2 arch/sh/include/asm/pgalloc.h | 1 arch/sh/include/asm/pgtable.h | 2 arch/sparc/Kconfig | 5 arch/sparc/include/asm/pgalloc_32.h | 1 arch/sparc/include/asm/pgalloc_64.h | 1 arch/sparc/include/asm/pgtable_32.h | 3 arch/sparc/include/asm/pgtable_64.h | 8 arch/sparc/kernel/sstate.c | 1 arch/sparc/mm/hugetlbpage.c | 6 arch/sparc/mm/init_64.c | 1 arch/um/drivers/mconsole_kern.c | 1 arch/um/include/asm/pgalloc.h | 1 arch/um/include/asm/pgtable-2level.h | 1 arch/um/include/asm/pgtable-3level.h | 1 arch/um/kernel/um_arch.c | 1 arch/x86/Kconfig | 17 arch/x86/include/asm/desc.h | 1 arch/x86/include/asm/pgalloc.h | 2 arch/x86/include/asm/pgtable_types.h | 2 arch/x86/kernel/cpu/mshyperv.c | 1 arch/x86/kernel/kprobes/core.c | 6 arch/x86/kernel/setup.c | 1 arch/x86/mm/init_64.c | 21 arch/x86/mm/pgtable.c | 34 arch/x86/purgatory/purgatory.c | 2 arch/x86/xen/enlighten.c | 1 arch/xtensa/include/asm/pgalloc.h | 2 arch/xtensa/include/asm/pgtable.h | 1 arch/xtensa/include/uapi/asm/mman.h | 3 arch/xtensa/platforms/iss/setup.c | 1 drivers/block/zram/zram_drv.h | 2 drivers/bus/brcmstb_gisb.c | 1 drivers/char/ipmi/ipmi_msghandler.c | 1 drivers/clk/analogbits/wrpll-cln28hpc.c | 4 drivers/edac/altera_edac.c | 1 drivers/firmware/google/gsmi.c | 1 drivers/gpu/drm/nouveau/include/nvif/if000c.h | 1 drivers/gpu/drm/nouveau/nouveau_svm.c | 162 ++- drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h | 1 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c | 6 drivers/hv/vmbus_drv.c | 1 drivers/hwtracing/coresight/coresight-cpu-debug.c | 1 drivers/leds/trigger/ledtrig-activity.c | 1 drivers/leds/trigger/ledtrig-heartbeat.c | 1 drivers/leds/trigger/ledtrig-panic.c | 1 drivers/misc/bcm-vk/bcm_vk_dev.c | 1 drivers/misc/ibmasm/heartbeat.c | 1 drivers/misc/pvpanic/pvpanic.c | 1 drivers/net/ipa/ipa_smp2p.c | 1 drivers/parisc/power.c | 1 drivers/power/reset/ltc2952-poweroff.c | 1 drivers/remoteproc/remoteproc_core.c | 1 drivers/s390/char/con3215.c | 1 drivers/s390/char/con3270.c | 1 drivers/s390/char/sclp.c | 1 drivers/s390/char/sclp_con.c | 1 drivers/s390/char/sclp_vt220.c | 1 drivers/s390/char/zcore.c | 1 drivers/soc/bcm/brcmstb/pm/pm-arm.c | 1 drivers/staging/olpc_dcon/olpc_dcon.c | 1 drivers/video/fbdev/hyperv_fb.c | 1 drivers/virtio/virtio_mem.c | 2 fs/Kconfig | 15 fs/exec.c | 3 fs/hfsplus/inode.c | 5 fs/hfsplus/xattr.c | 1 fs/nfsd/nfs4state.c | 2 fs/nilfs2/btree.c | 1 fs/open.c | 13 fs/proc/base.c | 6 fs/proc/fd.c | 20 fs/proc/kcore.c | 136 ++ fs/proc/task_mmu.c | 34 fs/seq_file.c | 43 fs/userfaultfd.c | 15 include/asm-generic/bug.h | 3 include/linux/ascii85.h | 3 include/linux/bootmem_info.h | 68 + include/linux/compat.h | 2 include/linux/compiler-clang.h | 17 include/linux/compiler-gcc.h | 6 include/linux/compiler_types.h | 2 include/linux/huge_mm.h | 74 - include/linux/hugetlb.h | 80 + include/linux/hugetlb_cgroup.h | 19 include/linux/kcore.h | 3 include/linux/kernel.h | 227 ---- include/linux/kprobes.h | 1 include/linux/kstrtox.h | 155 ++ include/linux/memblock.h | 4 include/linux/memory_hotplug.h | 27 include/linux/mempolicy.h | 9 include/linux/memremap.h | 2 include/linux/migrate.h | 27 include/linux/mm.h | 18 include/linux/mm_types.h | 2 include/linux/mmu_notifier.h | 26 include/linux/mmzone.h | 27 include/linux/mpi.h | 4 include/linux/page-flags.h | 22 include/linux/panic.h | 98 + include/linux/panic_notifier.h | 12 include/linux/pgtable.h | 44 include/linux/rmap.h | 13 include/linux/seq_file.h | 10 include/linux/shmem_fs.h | 19 include/linux/signal.h | 2 include/linux/string.h | 7 include/linux/string_helpers.h | 31 include/linux/sunrpc/cache.h | 1 include/linux/swap.h | 19 include/linux/swapops.h | 171 +-- include/linux/thread_info.h | 1 include/linux/userfaultfd_k.h | 5 include/linux/vmalloc.h | 15 include/linux/zbud.h | 23 include/trace/events/vmscan.h | 41 include/uapi/asm-generic/mman-common.h | 3 include/uapi/linux/mempolicy.h | 1 include/uapi/linux/userfaultfd.h | 7 init/main.c | 42 ipc/msg.c | 6 ipc/sem.c | 25 ipc/shm.c | 6 ipc/util.c | 44 ipc/util.h | 3 kernel/hung_task.c | 1 kernel/kexec_core.c | 1 kernel/kprobes.c | 2 kernel/panic.c | 1 kernel/rcu/tree.c | 2 kernel/signal.c | 14 kernel/sysctl.c | 4 kernel/trace/trace.c | 1 lib/Kconfig.debug | 12 lib/decompress_bunzip2.c | 6 lib/decompress_unlz4.c | 8 lib/decompress_unlzo.c | 3 lib/decompress_unxz.c | 2 lib/decompress_unzstd.c | 4 lib/kstrtox.c | 5 lib/lz4/lz4_decompress.c | 2 lib/math/Makefile | 1 lib/math/rational-test.c | 56 + lib/math/rational.c | 16 lib/mpi/longlong.h | 4 lib/mpi/mpicoder.c | 6 lib/mpi/mpiutil.c | 2 lib/parser.c | 1 lib/string.c | 2 lib/string_helpers.c | 142 +- lib/test-string_helpers.c | 157 ++- lib/test_hmm.c | 127 ++ lib/test_hmm_uapi.h | 2 lib/test_string.c | 5 lib/vsprintf.c | 1 lib/xz/xz_dec_bcj.c | 2 lib/xz/xz_dec_lzma2.c | 8 lib/zlib_inflate/inffast.c | 2 lib/zstd/huf.h | 2 mm/Kconfig | 16 mm/Makefile | 2 mm/bootmem_info.c | 127 ++ mm/compaction.c | 20 mm/debug_vm_pgtable.c | 109 -- mm/gup.c | 58 + mm/hmm.c | 12 mm/huge_memory.c | 269 ++--- mm/hugetlb.c | 369 +++++-- mm/hugetlb_vmemmap.c | 332 ++++++ mm/hugetlb_vmemmap.h | 53 - mm/internal.h | 29 mm/kfence/core.c | 4 mm/khugepaged.c | 20 mm/madvise.c | 66 + mm/mapping_dirty_helpers.c | 2 mm/memblock.c | 28 mm/memcontrol.c | 4 mm/memory-failure.c | 38 mm/memory.c | 239 +++- mm/memory_hotplug.c | 161 --- mm/mempolicy.c | 323 ++---- mm/migrate.c | 268 +---- mm/mlock.c | 12 mm/mmap_lock.c | 59 - mm/mprotect.c | 18 mm/nommu.c | 5 mm/oom_kill.c | 2 mm/page_alloc.c | 5 mm/page_vma_mapped.c | 15 mm/rmap.c | 644 +++++++++--- mm/shmem.c | 125 -- mm/sparse-vmemmap.c | 432 +++++++- mm/sparse.c | 1 mm/swap.c | 2 mm/swapfile.c | 2 mm/userfaultfd.c | 249 ++-- mm/util.c | 40 mm/vmalloc.c | 37 mm/vmscan.c | 20 mm/workingset.c | 10 mm/z3fold.c | 39 mm/zbud.c | 235 ++-- mm/zsmalloc.c | 5 mm/zswap.c | 26 scripts/checkpatch.pl | 16 tools/testing/selftests/vm/.gitignore | 3 tools/testing/selftests/vm/Makefile | 5 tools/testing/selftests/vm/hmm-tests.c | 158 +++ tools/testing/selftests/vm/khugepaged.c | 4 tools/testing/selftests/vm/madv_populate.c | 342 ++++++ tools/testing/selftests/vm/pkey-x86.h | 1 tools/testing/selftests/vm/protection_keys.c | 85 + tools/testing/selftests/vm/run_vmtests.sh | 16 tools/testing/selftests/vm/userfaultfd.c | 1094 ++++++++++----------- 299 files changed, 6277 insertions(+), 3183 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-07-01 1:46 incoming Andrew Morton @ 2021-07-03 0:28 ` Linus Torvalds 2021-07-03 1:06 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2021-07-03 0:28 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > This is the rest of the -mm tree, less 66 patches which are dependent on > things which are (or were recently) in linux-next. I'll trickle that > material over next week. I haven't bisected this yet, but with the current -git I'm getting watchdog: BUG: soft lockup - CPU#41 stuck for 49s! and the common call chain seems to be in flush_tlb_mm_range -> on_each_cpu_cond_mask. Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking at the pulls and merges I've done since, this -mm series looks like the obvious culprit. I'll go start bisection, but I thought I'd give a heads-up in case somebody else has seen TLB-flush-related lockups and already figured out the guilty party.. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-07-03 0:28 ` incoming Linus Torvalds @ 2021-07-03 1:06 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2021-07-03 1:06 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking > at the pulls and merges I've done since, this -mm series looks like > the obvious culprit. No, unless my bisection is wrong, the -mm branch is innocent, and was discarded from the suspects on the very first bisection trial. So never mind. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-06-29 2:32 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-06-29 2:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2. Subsystems affected by this patch series: mm/gup mm/pagealloc kthread ia64 scripts ntfs squashfs ocfs2 z kernel/watchdog mm/slab mm/slub mm/kmemleak mm/dax mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mprotect mm/bootmem mm/dma mm/tracing mm/vmalloc mm/kasan mm/initialization mm/pagealloc mm/memory-failure Subsystem: mm/gup Jann Horn <jannh@google.com>: mm/gup: fix try_grab_compound_head() race with split_huge_page() Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc: fix memory map initialization for descending nodes Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: correct return value of populated elements if bulk array is populated Subsystem: kthread Jonathan Neuschäfer <j.neuschaefer@gmx.net>: kthread: switch to new kerneldoc syntax for named variable macro argument Petr Mladek <pmladek@suse.com>: kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync() Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: headers: drop duplicated words Arnd Bergmann <arnd@arndb.de>: ia64: mca_drv: fix incorrect array size calculation Subsystem: scripts "Steven Rostedt (VMware)" <rostedt@goodmis.org>: Patch series "streamline_config.pl: Fix Perl spacing": streamline_config.pl: make spacing consistent streamline_config.pl: add softtabstop=4 for vim users Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>: ntfs: fix validity check for file name attribute Subsystem: squashfs Vincent Whitchurch <vincent.whitchurch@axis.com>: squashfs: add option to panic on errors Subsystem: ocfs2 Yang Yingliang <yangyingliang@huawei.com>: ocfs2: remove unnecessary INIT_LIST_HEAD() Subsystem: z Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: fix snprintf() checking Colin Ian King <colin.king@canonical.com>: ocfs2: remove redundant assignment to pointer queue Wan Jiabing <wanjiabing@vivo.com>: ocfs2: remove repeated uptodate check for buffer Chen Huang <chenhuang5@huawei.com>: ocfs2: replace simple_strtoull() with kstrtoull() Colin Ian King <colin.king@canonical.com>: ocfs2: remove redundant initialization of variable ret Subsystem: kernel/watchdog Wang Qing <wangqing@vivo.com>: kernel: watchdog: modify the explanation related to watchdog thread doc: watchdog: modify the explanation related to watchdog thread doc: watchdog: modify the doc related to "watchdog/%u" Subsystem: mm/slab gumingtao <gumingtao1225@gmail.com>: slab: use __func__ to trace function name Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: kunit: make test->lock irq safe Oliver Glitta <glittao@gmail.com>: mm/slub, kunit: add a KUnit test for SLUB debugging functionality slub: remove resiliency_test() function Hyeonggon Yoo <42.hyeyoo@gmail.com>: mm, slub: change run-time assertion in kmalloc_index() to compile-time Stephen Boyd <swboyd@chromium.org>: slub: restore slub_debug=- behavior slub: actually use 'message' in restore_bytes() Joe Perches <joe@perches.com>: slub: indicate slab_fix() uses printf formats Stephen Boyd <swboyd@chromium.org>: slub: force on no_hash_pointers when slub_debug is enabled Faiyaz Mohammed <faiyazm@codeaurora.org>: mm: slub: move sysfs slab alloc/free interfaces to debugfs Georgi Djakov <quic_c_gdjako@quicinc.com>: mm/slub: add taint after the errors are printed Subsystem: mm/kmemleak Yanfei Xu <yanfei.xu@windriver.com>: mm/kmemleak: fix possible wrong memory scanning period Subsystem: mm/dax Jan Kara <jack@suse.cz>: dax: fix ENOMEM handling in grab_mapping_entry() Subsystem: mm/debug Tang Bin <tangbin@cmss.chinamobile.com>: tools/vm/page_owner_sort.c: check malloc() return Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage() Nicolas Saenz Julienne <nsaenzju@redhat.com>: mm: mmap_lock: use local locks instead of disabling preemption Gavin Shan <gshan@redhat.com>: Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4: mm/page_reporting: fix code style in __page_reporting_request() mm/page_reporting: export reporting order as module parameter mm/page_reporting: allow driver to specify reporting order virtio_balloon: specify page reporting order if needed Subsystem: mm/pagecache Kefeng Wang <wangkefeng.wang@huawei.com>: mm: page-writeback: kill get_writeback_state() comments Chi Wu <wuchi.zero@gmail.com>: mm/page-writeback: Fix performance when BDI's share of ratio is 0. mm/page-writeback: update the comment of Dirty position control mm/page-writeback: use __this_cpu_inc() in account_page_dirtied() Roman Gushchin <guro@fb.com>: Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9: writeback, cgroup: do not switch inodes with I_WILL_FREE flag writeback, cgroup: add smp_mb() to cgroup_writeback_umount() writeback, cgroup: increment isw_nr_in_flight before grabbing an inode writeback, cgroup: switch to rcu_work API in inode_switch_wbs() writeback, cgroup: keep list of inodes attached to bdi_writeback writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn() writeback, cgroup: support switching multiple inodes at once writeback, cgroup: release dying cgwbs by switching attached inodes Christoph Hellwig <hch@lst.de>: Patch series "remove the implicit .set_page_dirty default": fs: unexport __set_page_dirty fs: move ramfs_aops to libfs mm: require ->set_page_dirty to be explicitly wired up "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Further set_page_dirty cleanups": mm/writeback: move __set_page_dirty() to core mm mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers iomap: use __set_page_dirty_nobuffers fs: remove anon_set_page_dirty() fs: remove noop_set_page_dirty() mm: move page dirtying prototypes from mm.h Subsystem: mm/gup Peter Xu <peterx@redhat.com>: Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2: mm/gup_benchmark: support threading Andrea Arcangeli <aarcange@redhat.com>: mm: gup: allow FOLL_PIN to scale in SMP mm: gup: pack has_pinned in MMF_HAS_PINNED Christophe Leroy <christophe.leroy@csgroup.eu>: mm: pagewalk: fix walk for hugepage tables Subsystem: mm/swap Miaohe Lin <linmiaohe@huawei.com>: Patch series "close various race windows for swap", v6: mm/swapfile: use percpu_ref to serialize against concurrent swapoff swap: fix do_swap_page() race with swapoff mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info() mm/shmem: fix shmem_swapin() race with swapoff Patch series "Cleanups for swap", v2: mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION mm/swap: remove unused local variable nr_shadows mm/swap_slots.c: delete meaningless forward declarations Huang Ying <ying.huang@intel.com>: mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info() mm: free idle swap cache page after COW swap: check mapping_empty() for swap cache before being freed Subsystem: mm/memcg Waiman Long <longman@redhat.com>: Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6: mm/memcg: move mod_objcg_state() to memcontrol.c mm/memcg: cache vmstat data in percpu memcg_stock_pcp mm/memcg: improve refill_obj_stock() performance mm/memcg: optimize user context object stock access Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4: mm: memcg/slab: properly set up gfp flags for objcg pointer array mm: memcg/slab: create a new set of kmalloc-cg-<n> caches mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix root_mem_cgroup charging Patch series "memcontrol code cleanup and simplification", v3: mm: memcontrol: fix page charging in page replacement mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec mm: memcontrol: simplify lruvec_holds_page_lru_lock mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec mm: memcontrol: simplify the logic of objcg pinning memcg mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock mm: vmscan: remove noinline_for_stack wenhuizhang <wenhui@gwmail.gwu.edu>: memcontrol: use flexible-array member Dan Schatzberg <schatzberg.dan@gmail.com>: Patch series "Charge loop device i/o to issuing cgroup", v14: loop: use worker per cgroup instead of kworker mm: charge active memcg when no mm is set loop: charge i/o to mem and blk cg Huilong Deng <denghuilong@cdjrlc.com>: mm: memcontrol: remove trailing semicolon in macros Subsystem: mm/pagemap David Hildenbrand <david@redhat.com>: Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE": perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC binfmt: remove in-tree usage of MAP_EXECUTABLE mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff() Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>: mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap Liam Howlett <liam.howlett@oracle.com>: mm/mmap: introduce unlock_range() for code cleanup mm/mmap: use find_vma_intersection() in do_mmap() for overlap Liu Xiang <liu.xiang@zlingsmart.com>: mm/memory.c: fix comment of finish_mkwrite_fault() Liam Howlett <liam.howlett@oracle.com>: Patch series "mm: Add vma_lookup()", v2: mm: add vma_lookup(), update find_vma_intersection() comments drm/i915/selftests: use vma_lookup() in __igt_mmap() arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma() arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection() arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection() arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma() arch/mips/kernel/traps: use vma_lookup() instead of find_vma() arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush() x86/sgx: use vma_lookup() in sgx_encl_find() virt/kvm: use vma_lookup() instead of find_vma_intersection() vfio: use vma_lookup() instead of find_vma_intersection() net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive() drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages() media: videobuf2: use vma_lookup() in get_vaddr_frames() misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma() kernel/events/uprobes: use vma_lookup() in find_active_uprobe() lib/test_hmm: use vma_lookup() in dmirror_migrate() mm/ksm: use vma_lookup() in find_mergeable_vma() mm/migrate: use vma_lookup() in do_pages_stat_array() mm/mremap: use vma_lookup() in vma_to_resize() mm/memory.c: use vma_lookup() in __access_remote_vm() mm/mempolicy: use vma_lookup() in __access_remote_vm() Chen Li <chenli@uniontech.com>: mm: update legacy flush_tlb_* to use vma Subsystem: mm/mprotect Peter Collingbourne <pcc@google.com>: mm: improve mprotect(R|W) efficiency on pages referenced once Subsystem: mm/bootmem Souptick Joarder <jrdr.linux@gmail.com>: h8300: remove unused variable Subsystem: mm/dma YueHaibing <yuehaibing@huawei.com>: mm/dmapool: use DEVICE_ATTR_RO macro Subsystem: mm/tracing Vincent Whitchurch <vincent.whitchurch@axis.com>: mm, tracing: unify PFN format strings Subsystem: mm/vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: Patch series "vmalloc() vs bulk allocator", v2: mm/page_alloc: add an alloc_pages_bulk_array_node() helper mm/vmalloc: switch to bulk allocator in __vmalloc_area_node() mm/vmalloc: print a warning message first on failure mm/vmalloc: remove quoted strings split across lines Uladzislau Rezki <urezki@gmail.com>: mm/vmalloc: fallback to a single page allocator Rafael Aquini <aquini@redhat.com>: mm: vmalloc: add cond_resched() in __vunmap() Subsystem: mm/kasan Alexander Potapenko <glider@google.com>: printk: introduce dump_stack_lvl() kasan: use dump_stack_lvl(KERN_ERR) to print stacks David Gow <davidgow@google.com>: kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL() Daniel Axtens <dja@axtens.net>: Patch series "KASAN core changes for ppc64 radix KASAN", v16: kasan: allow an architecture to disable inline instrumentation kasan: allow architectures to provide an outline readiness check mm: define default MAX_PTRS_PER_* in include/pgtable.h kasan: use MAX_PTRS_PER_* for early shadow tables Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4: kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY kasan: integrate the common part of two KASAN tag-based modes kasan: add memory corruption identification support for hardware tag-based mode Subsystem: mm/initialization Jungseung Lee <js07.lee@samsung.com>: mm: report which part of mem is being freed on initmem case Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/mmzone.h: simplify is_highmem_idx() "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Constify struct page arguments": mm: make __dump_page static Aaron Tomlin <atomlin@redhat.com>: mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug: factor PagePoisoned out of __dump_page mm/page_owner: constify dump_page_owner mm: make compound_head const-preserving mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype mm: constify page_count and page_ref_count mm: optimise nth_page for contiguous memmap Heiner Kallweit <hkallweit1@gmail.com>: mm/page_alloc: switch to pr_debug Andrii Nakryiko <andrii@kernel.org>: kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21 Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: split per cpu page lists and zone stats mm/page_alloc: convert per-cpu list protection to local_lock mm/vmstat: convert NUMA statistics to basic NUMA counters mm/vmstat: inline NUMA event counter updates mm/page_alloc: batch the accounting updates in the bulk allocator mm/page_alloc: reduce duration that IRQs are disabled for VM counters mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok mm/page_alloc: avoid conflating IRQs disabled with zone->lock mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok Minchan Kim <minchan@kernel.org>: mm: page_alloc: dump migrate-failed pages only at -EBUSY Mel Gorman <mgorman@techsingularity.net>: Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2: mm/page_alloc: delete vm.percpu_pagelist_fraction mm/page_alloc: disassociate the pcp->high from pcp->batch mm/page_alloc: adjust pcp->high after CPU hotplug events mm/page_alloc: scale the number of pages that are batch freed mm/page_alloc: limit the number of pages on PCP lists when reclaim is active mm/page_alloc: introduce vm.percpu_pagelist_high_fraction Dong Aisheng <aisheng.dong@nxp.com>: mm: drop SECTION_SHIFT in code comments mm/page_alloc: improve memmap_pages dbg msg Liu Shixin <liushixin2@huawei.com>: mm/page_alloc: fix counting of managed_pages Mel Gorman <mgorman@techsingularity.net>: Patch series "Allow high order pages to be stored on PCP", v2: mm/page_alloc: move free_the_page Mike Rapoport <rppt@linux.ibm.com>: Patch series "Remove DISCONTIGMEM memory model", v3: alpha: remove DISCONTIGMEM and NUMA arc: update comment about HIGHMEM implementation arc: remove support for DISCONTIGMEM m68k: remove support for DISCONTIGMEM mm: remove CONFIG_DISCONTIGMEM arch, mm: remove stale mentions of DISCONIGMEM docs: remove description of DISCONTIGMEM mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: allow high-order pages to be stored on the per-cpu lists mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: send SIGBUS with error virutal address mm,hwpoison: make get_hwpoison_page() call get_any_page() Documentation/admin-guide/kernel-parameters.txt | 6 Documentation/admin-guide/lockup-watchdogs.rst | 4 Documentation/admin-guide/sysctl/kernel.rst | 10 Documentation/admin-guide/sysctl/vm.rst | 52 - Documentation/dev-tools/kasan.rst | 9 Documentation/vm/memory-model.rst | 45 arch/alpha/Kconfig | 22 arch/alpha/include/asm/machvec.h | 6 arch/alpha/include/asm/mmzone.h | 100 -- arch/alpha/include/asm/pgtable.h | 4 arch/alpha/include/asm/topology.h | 39 arch/alpha/kernel/core_marvel.c | 53 - arch/alpha/kernel/core_wildfire.c | 29 arch/alpha/kernel/pci_iommu.c | 29 arch/alpha/kernel/proto.h | 8 arch/alpha/kernel/setup.c | 16 arch/alpha/kernel/sys_marvel.c | 5 arch/alpha/kernel/sys_wildfire.c | 5 arch/alpha/mm/Makefile | 2 arch/alpha/mm/init.c | 3 arch/alpha/mm/numa.c | 223 ---- arch/arc/Kconfig | 13 arch/arc/include/asm/mmzone.h | 40 arch/arc/kernel/troubleshoot.c | 8 arch/arc/mm/init.c | 21 arch/arm/include/asm/tlbflush.h | 13 arch/arm/mm/tlb-v6.S | 2 arch/arm/mm/tlb-v7.S | 2 arch/arm64/Kconfig | 2 arch/arm64/kvm/mmu.c | 2 arch/h8300/kernel/setup.c | 2 arch/ia64/Kconfig | 2 arch/ia64/include/asm/pal.h | 2 arch/ia64/include/asm/spinlock.h | 2 arch/ia64/include/asm/uv/uv_hub.h | 2 arch/ia64/kernel/efi_stub.S | 2 arch/ia64/kernel/mca_drv.c | 2 arch/ia64/kernel/topology.c | 5 arch/ia64/mm/numa.c | 5 arch/m68k/Kconfig.cpu | 10 arch/m68k/include/asm/mmzone.h | 10 arch/m68k/include/asm/page.h | 2 arch/m68k/include/asm/page_mm.h | 35 arch/m68k/include/asm/tlbflush.h | 2 arch/m68k/kernel/sys_m68k.c | 4 arch/m68k/mm/init.c | 20 arch/mips/Kconfig | 2 arch/mips/include/asm/mmzone.h | 8 arch/mips/include/asm/page.h | 2 arch/mips/kernel/traps.c | 4 arch/mips/mm/init.c | 7 arch/nds32/include/asm/memory.h | 6 arch/openrisc/include/asm/tlbflush.h | 2 arch/powerpc/Kconfig | 2 arch/powerpc/include/asm/mmzone.h | 4 arch/powerpc/kernel/setup_64.c | 2 arch/powerpc/kernel/smp.c | 2 arch/powerpc/kexec/core.c | 4 arch/powerpc/kvm/book3s_hv.c | 4 arch/powerpc/kvm/book3s_hv_uvmem.c | 2 arch/powerpc/mm/Makefile | 2 arch/powerpc/mm/mem.c | 4 arch/riscv/Kconfig | 2 arch/s390/Kconfig | 2 arch/s390/include/asm/pgtable.h | 2 arch/sh/include/asm/mmzone.h | 4 arch/sh/kernel/topology.c | 2 arch/sh/mm/Kconfig | 2 arch/sh/mm/init.c | 2 arch/sparc/Kconfig | 2 arch/sparc/include/asm/mmzone.h | 4 arch/sparc/kernel/smp_64.c | 2 arch/sparc/mm/init_64.c | 12 arch/x86/Kconfig | 2 arch/x86/ia32/ia32_aout.c | 4 arch/x86/kernel/cpu/mce/core.c | 13 arch/x86/kernel/cpu/sgx/encl.h | 4 arch/x86/kernel/setup_percpu.c | 6 arch/x86/mm/init_32.c | 4 arch/xtensa/include/asm/page.h | 4 arch/xtensa/include/asm/tlbflush.h | 4 drivers/base/node.c | 18 drivers/block/loop.c | 270 ++++- drivers/block/loop.h | 15 drivers/dax/device.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 4 drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c | 2 drivers/media/common/videobuf2/frame_vector.c | 2 drivers/misc/sgi-gru/grufault.c | 4 drivers/vfio/vfio_iommu_type1.c | 2 drivers/virtio/virtio_balloon.c | 17 fs/adfs/inode.c | 1 fs/affs/file.c | 2 fs/bfs/file.c | 1 fs/binfmt_aout.c | 4 fs/binfmt_elf.c | 2 fs/binfmt_elf_fdpic.c | 11 fs/binfmt_flat.c | 2 fs/block_dev.c | 1 fs/buffer.c | 25 fs/configfs/inode.c | 8 fs/dax.c | 3 fs/ecryptfs/mmap.c | 13 fs/exfat/inode.c | 1 fs/ext2/inode.c | 4 fs/ext4/inode.c | 2 fs/fat/inode.c | 1 fs/fs-writeback.c | 366 +++++--- fs/fuse/dax.c | 3 fs/gfs2/aops.c | 2 fs/gfs2/meta_io.c | 2 fs/hfs/inode.c | 2 fs/hfsplus/inode.c | 2 fs/hpfs/file.c | 1 fs/iomap/buffered-io.c | 27 fs/jfs/inode.c | 1 fs/kernfs/inode.c | 8 fs/libfs.c | 44 fs/minix/inode.c | 1 fs/nilfs2/mdt.c | 1 fs/ntfs/inode.c | 2 fs/ocfs2/aops.c | 4 fs/ocfs2/cluster/heartbeat.c | 7 fs/ocfs2/cluster/nodemanager.c | 2 fs/ocfs2/dlm/dlmmaster.c | 2 fs/ocfs2/filecheck.c | 6 fs/ocfs2/stackglue.c | 8 fs/omfs/file.c | 1 fs/proc/task_mmu.c | 2 fs/ramfs/inode.c | 9 fs/squashfs/block.c | 5 fs/squashfs/squashfs_fs_sb.h | 1 fs/squashfs/super.c | 86 + fs/sysv/itree.c | 1 fs/udf/file.c | 1 fs/udf/inode.c | 1 fs/ufs/inode.c | 1 fs/xfs/xfs_aops.c | 4 fs/zonefs/super.c | 4 include/asm-generic/memory_model.h | 37 include/asm-generic/pgtable-nop4d.h | 1 include/asm-generic/topology.h | 2 include/kunit/test.h | 5 include/linux/backing-dev-defs.h | 20 include/linux/cpuhotplug.h | 2 include/linux/fs.h | 6 include/linux/gfp.h | 13 include/linux/iomap.h | 1 include/linux/kasan.h | 7 include/linux/kernel.h | 2 include/linux/kthread.h | 2 include/linux/memblock.h | 6 include/linux/memcontrol.h | 60 - include/linux/mm.h | 53 - include/linux/mm_types.h | 10 include/linux/mman.h | 2 include/linux/mmdebug.h | 3 include/linux/mmzone.h | 96 +- include/linux/page-flags.h | 10 include/linux/page_owner.h | 6 include/linux/page_ref.h | 4 include/linux/page_reporting.h | 3 include/linux/pageblock-flags.h | 2 include/linux/pagemap.h | 4 include/linux/pgtable.h | 22 include/linux/printk.h | 5 include/linux/sched/coredump.h | 8 include/linux/slab.h | 59 + include/linux/swap.h | 19 include/linux/swapops.h | 5 include/linux/vmstat.h | 69 - include/linux/writeback.h | 1 include/trace/events/cma.h | 4 include/trace/events/filemap.h | 2 include/trace/events/kmem.h | 12 include/trace/events/page_pool.h | 4 include/trace/events/pagemap.h | 4 include/trace/events/vmscan.h | 2 kernel/cgroup/cgroup.c | 1 kernel/crash_core.c | 4 kernel/events/core.c | 2 kernel/events/uprobes.c | 4 kernel/fork.c | 1 kernel/kthread.c | 19 kernel/sysctl.c | 16 kernel/watchdog.c | 12 lib/Kconfig.debug | 15 lib/Kconfig.kasan | 16 lib/Makefile | 1 lib/dump_stack.c | 20 lib/kunit/test.c | 18 lib/slub_kunit.c | 152 +++ lib/test_hmm.c | 5 lib/test_kasan.c | 11 lib/vsprintf.c | 2 mm/Kconfig | 38 mm/backing-dev.c | 66 + mm/compaction.c | 2 mm/debug.c | 27 mm/debug_vm_pgtable.c | 63 + mm/dmapool.c | 5 mm/filemap.c | 2 mm/gup.c | 81 + mm/hugetlb.c | 2 mm/internal.h | 9 mm/kasan/Makefile | 4 mm/kasan/common.c | 6 mm/kasan/generic.c | 3 mm/kasan/hw_tags.c | 22 mm/kasan/init.c | 6 mm/kasan/kasan.h | 12 mm/kasan/report.c | 6 mm/kasan/report_hw_tags.c | 5 mm/kasan/report_sw_tags.c | 45 mm/kasan/report_tags.c | 51 + mm/kasan/shadow.c | 6 mm/kasan/sw_tags.c | 45 mm/kasan/tags.c | 59 + mm/kfence/kfence_test.c | 5 mm/kmemleak.c | 18 mm/ksm.c | 6 mm/memblock.c | 8 mm/memcontrol.c | 385 ++++++-- mm/memory-failure.c | 344 +++++-- mm/memory.c | 22 mm/memory_hotplug.c | 6 mm/mempolicy.c | 4 mm/migrate.c | 4 mm/mmap.c | 54 - mm/mmap_lock.c | 33 mm/mprotect.c | 52 + mm/mremap.c | 5 mm/nommu.c | 2 mm/page-writeback.c | 89 + mm/page_alloc.c | 950 +++++++++++++-------- mm/page_ext.c | 2 mm/page_owner.c | 2 mm/page_reporting.c | 19 mm/page_reporting.h | 5 mm/pagewalk.c | 58 + mm/shmem.c | 18 mm/slab.h | 24 mm/slab_common.c | 60 - mm/slub.c | 420 +++++---- mm/sparse.c | 2 mm/swap.c | 4 mm/swap_slots.c | 2 mm/swap_state.c | 20 mm/swapfile.c | 177 +-- mm/vmalloc.c | 181 ++-- mm/vmscan.c | 43 mm/vmstat.c | 282 ++---- mm/workingset.c | 2 net/ipv4/tcp.c | 4 scripts/kconfig/streamline_config.pl | 76 - scripts/link-vmlinux.sh | 4 scripts/spelling.txt | 16 tools/testing/selftests/vm/gup_test.c | 96 +- tools/vm/page_owner_sort.c | 4 virt/kvm/kvm_main.c | 2 260 files changed, 3989 insertions(+), 2996 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-06-25 1:38 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-06-25 1:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6. Subsystems affected by this patch series: mm/thp nilfs2 mm/vmalloc kthread mm/hugetlb mm/memory-failure mm/pagealloc MAINTAINERS mailmap Subsystem: mm/thp Hugh Dickins <hughd@google.com>: Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes": mm: page_vma_mapped_walk(): use page for pvmw->page mm: page_vma_mapped_walk(): settle PageHuge on entry mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block mm: page_vma_mapped_walk(): crossing page table boundary mm: page_vma_mapped_walk(): add a level of indentation mm: page_vma_mapped_walk(): use goto instead of while (1) mm: page_vma_mapped_walk(): get vma_address_end() earlier mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk() Subsystem: nilfs2 Pavel Skripkin <paskripkin@gmail.com>: nilfs2: fix memory leak in nilfs_sysfs_delete_device_group Subsystem: mm/vmalloc Claudio Imbrenda <imbrenda@linux.ibm.com>: Patch series "mm: add vmalloc_no_huge and use it", v4: mm/vmalloc: add vmalloc_no_huge KVM: s390: prepare for hugepage vmalloc Daniel Axtens <dja@axtens.net>: mm/vmalloc: unbreak kasan vmalloc support Subsystem: kthread Petr Mladek <pmladek@suse.com>: Patch series "kthread_worker: Fix race between kthread_mod_delayed_work(): kthread_worker: split code for canceling the delayed work timer kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync() Subsystem: mm/hugetlb Hugh Dickins <hughd@google.com>: mm, futex: fix shared futex pgoff on shmem huge page Subsystem: mm/memory-failure Tony Luck <tony.luck@intel.com>: Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5: mm/memory-failure: use a mutex to avoid memory_failure() races Aili Yao <yaoaili@kingsoft.com>: mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned Naoya Horiguchi <naoya.horiguchi@nec.com>: mm/hwpoison: do not lock page again when me_huge_page() successfully recovers Subsystem: mm/pagealloc Rasmus Villemoes <linux@rasmusvillemoes.dk>: mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array Mel Gorman <mgorman@techsingularity.net>: mm/page_alloc: do bulk array bounds check after checking populated elements Subsystem: MAINTAINERS Marek Behún <kabel@kernel.org>: MAINTAINERS: fix Marek's identity again Subsystem: mailmap Marek Behún <kabel@kernel.org>: mailmap: add Marek's other e-mail address and identity without diacritics .mailmap | 2 MAINTAINERS | 4 arch/s390/kvm/pv.c | 7 + fs/nilfs2/sysfs.c | 1 include/linux/hugetlb.h | 16 --- include/linux/pagemap.h | 13 +- include/linux/vmalloc.h | 1 kernel/futex.c | 3 kernel/kthread.c | 81 ++++++++++------ mm/hugetlb.c | 5 - mm/memory-failure.c | 83 +++++++++++------ mm/page_alloc.c | 6 + mm/page_vma_mapped.c | 233 +++++++++++++++++++++++++++--------------------- mm/vmalloc.c | 41 ++++++-- 14 files changed, 297 insertions(+), 199 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-06-16 1:22 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-06-16 1:22 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71. Subsystems affected by this patch series: mm/memory-failure mm/swap mm/slub mm/hugetlb mm/memory-failure coredump mm/slub mm/thp mm/sparsemem Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: fix race with hugetlb page allocation Subsystem: mm/swap Peter Xu <peterx@redhat.com>: mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare Subsystem: mm/slub Kees Cook <keescook@chromium.org>: Patch series "Actually fix freelist pointer vs redzoning", v4: mm/slub: clarify verification reporting mm/slub: fix redzoning for small allocations mm/slub: actually fix freelist pointer vs redzoning Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: expand restore_reserve_on_error functionality Subsystem: mm/memory-failure yangerkun <yangerkun@huawei.com>: mm/memory-failure: make sure wait for page writeback in memory_failure Subsystem: coredump Pingfan Liu <kernelfans@gmail.com>: crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo Subsystem: mm/slub Andrew Morton <akpm@linux-foundation.org>: mm/slub.c: include swab.h Subsystem: mm/thp Xu Yu <xuyu@linux.alibaba.com>: mm, thp: use head page in __migration_entry_wait() Hugh Dickins <hughd@google.com>: Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10: mm/thp: fix __split_huge_pmd_locked() on shmem migration entry mm/thp: make is_huge_zero_pmd() safe and quicker mm/thp: try_to_unmap() use TTU_SYNC for safe splitting mm/thp: fix vma_address() if virtual address below file offset Jue Wang <juew@google.com>: mm/thp: fix page_address_in_vma() on file THP tails Hugh Dickins <hughd@google.com>: mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page() Yang Shi <shy828301@gmail.com>: mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split Subsystem: mm/sparsemem Miles Chen <miles.chen@mediatek.com>: mm/sparse: fix check_usemap_section_nr warnings Documentation/vm/slub.rst | 10 +-- fs/hugetlbfs/inode.c | 1 include/linux/huge_mm.h | 8 ++ include/linux/hugetlb.h | 8 ++ include/linux/mm.h | 3 + include/linux/rmap.h | 1 include/linux/swapops.h | 15 +++-- kernel/crash_core.c | 1 mm/huge_memory.c | 58 ++++++++++--------- mm/hugetlb.c | 137 +++++++++++++++++++++++++++++++++++++--------- mm/internal.h | 51 ++++++++++++----- mm/memory-failure.c | 36 +++++++++++- mm/memory.c | 41 +++++++++++++ mm/migrate.c | 1 mm/page_vma_mapped.c | 27 +++++---- mm/pgtable-generic.c | 5 - mm/rmap.c | 41 +++++++++---- mm/slab_common.c | 3 - mm/slub.c | 37 +++++------- mm/sparse.c | 13 +++- mm/swapfile.c | 2 mm/truncate.c | 43 ++++++-------- 22 files changed, 388 insertions(+), 154 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-06-05 3:00 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-06-05 3:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c. Subsystems affected by this patch series: mips mm/kfence init mm/debug mm/pagealloc mm/memory-hotplug mm/hugetlb proc mm/kasan mm/hugetlb lib ocfs2 mailmap Subsystem: mips Thomas Bogendoerfer <tsbogend@alpha.franken.de>: Revert "MIPS: make userspace mapping young by default" Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: use TASK_IDLE when awaiting allocation Subsystem: init Mark Rutland <mark.rutland@arm.com>: pid: take a reference when initializing `cad_pid` Subsystem: mm/debug Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests() Subsystem: mm/pagealloc Ding Hui <dinghui@sangfor.com.cn>: mm/page_alloc: fix counting of free pages after take off from buddy Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64 Subsystem: mm/hugetlb Naoya Horiguchi <naoya.horiguchi@nec.com>: hugetlb: pass head page to remove_hugetlb_page() Subsystem: proc David Matlack <dmatlack@google.com>: proc: add .gitignore for proc-subset-pid selftest Subsystem: mm/kasan Yu Kuai <yukuai3@huawei.com>: mm/kasan/init.c: fix doc warning Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY Subsystem: lib YueHaibing <yuehaibing@huawei.com>: lib: crc64: fix kernel-doc warning Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: fix data corruption by fallocate Subsystem: mailmap Michel Lespinasse <michel@lespinasse.org>: mailmap: use private address for Michel Lespinasse .mailmap | 3 + arch/mips/mm/cache.c | 30 ++++++++--------- drivers/base/memory.c | 6 +-- fs/ocfs2/file.c | 55 +++++++++++++++++++++++++++++--- include/linux/pgtable.h | 8 ++++ init/main.c | 2 - lib/crc64.c | 2 - mm/debug_vm_pgtable.c | 4 +- mm/hugetlb.c | 16 +++++++-- mm/kasan/init.c | 4 +- mm/kfence/core.c | 6 +-- mm/memory.c | 4 ++ mm/page_alloc.c | 2 + tools/testing/selftests/proc/.gitignore | 1 14 files changed, 107 insertions(+), 36 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-05-23 0:41 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-05-23 0:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c. Subsystems affected by this patch series: mm/pagealloc mm/gup ipc selftests mm/kasan kernel/watchdog bitmap procfs lib mm/userfaultfd Subsystem: mm/pagealloc Arnd Bergmann <arnd@arndb.de>: mm/shuffle: fix section mismatch warning Subsystem: mm/gup Michal Hocko <mhocko@suse.com>: Revert "mm/gup: check page posion status for coredump." Subsystem: ipc Varad Gautam <varad.gautam@suse.com>: ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry Subsystem: selftests Yang Yingliang <yangyingliang@huawei.com>: tools/testing/selftests/exec: fix link error Subsystem: mm/kasan Alexander Potapenko <glider@google.com>: kasan: slab: always reset the tag in get_freepointer_safe() Subsystem: kernel/watchdog Petr Mladek <pmladek@suse.com>: watchdog: reliable handling of timestamps Subsystem: bitmap Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: fix compilation error with GENMASK Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: remove Alexey from MAINTAINERS Subsystem: lib Zhen Lei <thunder.leizhen@huawei.com>: lib: kunit: suppress a compilation warning of frame size Subsystem: mm/userfaultfd Mike Kravetz <mike.kravetz@oracle.com>: userfaultfd: hugetlbfs: fix new flag usage in error path MAINTAINERS | 1 - fs/hugetlbfs/inode.c | 2 +- include/linux/bits.h | 2 +- include/linux/const.h | 8 ++++++++ include/linux/minmax.h | 10 ++-------- ipc/mqueue.c | 6 ++++-- ipc/msg.c | 6 ++++-- ipc/sem.c | 6 ++++-- kernel/watchdog.c | 34 ++++++++++++++++++++-------------- lib/Makefile | 1 + mm/gup.c | 4 ---- mm/internal.h | 20 -------------------- mm/shuffle.h | 4 ++-- mm/slub.c | 1 + mm/userfaultfd.c | 28 ++++++++++++++-------------- tools/include/linux/bits.h | 2 +- tools/include/linux/const.h | 8 ++++++++ tools/testing/selftests/exec/Makefile | 6 +++--- 18 files changed, 74 insertions(+), 75 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-05-15 0:26 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-05-15 0:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4. Subsystems affected by this patch series: mm/hugetlb mm/slub resource squashfs mm/userfaultfd mm/ksm mm/pagealloc mm/kasan mm/pagemap hfsplus modprobe mm/ioremap Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2: mm/hugetlb: fix F_SEAL_FUTURE_WRITE mm/hugetlb: fix cow where page writtable in child Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: move slub_debug static key enabling outside slab_mutex Subsystem: resource Alistair Popple <apopple@nvidia.com>: kernel/resource: fix return code check in __request_free_mem_region Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix divide error in calculate_skip() Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: release page in error path to avoid BUG_ON Subsystem: mm/ksm Hugh Dickins <hughd@google.com>: ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()" Subsystem: mm/pagealloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix struct page layout on 32-bit systems Subsystem: mm/kasan Peter Collingbourne <pcc@google.com>: kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled Subsystem: mm/pagemap "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap: fix readahead return types Subsystem: hfsplus Jouni Roivas <jouni.roivas@tuxera.com>: hfsplus: prevent corruption in shrinking truncate Subsystem: modprobe Rasmus Villemoes <linux@rasmusvillemoes.dk>: docs: admin-guide: update description for kernel.modprobe sysctl Subsystem: mm/ioremap Christophe Leroy <christophe.leroy@csgroup.eu>: mm/ioremap: fix iomap_max_page_shift Documentation/admin-guide/sysctl/kernel.rst | 9 ++++--- fs/hfsplus/extents.c | 7 +++-- fs/hugetlbfs/inode.c | 5 ++++ fs/iomap/buffered-io.c | 4 +-- fs/squashfs/file.c | 6 ++-- include/linux/mm.h | 32 ++++++++++++++++++++++++++ include/linux/mm_types.h | 4 +-- include/linux/pagemap.h | 6 ++-- include/net/page_pool.h | 12 +++++++++ kernel/resource.c | 2 - lib/test_kasan.c | 29 ++++++++++++++++++----- mm/hugetlb.c | 1 mm/ioremap.c | 6 ++-- mm/ksm.c | 3 +- mm/shmem.c | 34 ++++++++++++---------------- mm/slab_common.c | 10 ++++++++ mm/slub.c | 9 ------- net/core/page_pool.c | 12 +++++---- 18 files changed, 129 insertions(+), 62 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-05-07 1:01 Andrew Morton 2021-05-07 7:12 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-05-07 1:01 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm This is everything else from -mm for this merge window, with the possible exception of Mike Rapoport's "secretmem" syscall patch series (https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org). I've been wobbly about the secretmem patches due to doubts about whether the feature is sufficiently useful to justify inclusion, but developers are now weighing in with helpful information and I've asked Mike for an extensively updated [0/n] changelog. This will take a few days to play out so it is possible that I will prevail upon you for a post-rc1 merge. If that's a problem, there's always 5.13-rc1. 91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus previously sent patches. Thanks. Subsystems affected by this patch series: alpha procfs sysctl misc core-kernel bitmap lib compat checkpatch epoll isofs nilfs2 hpfs exit fork kexec gcov panic delayacct gdb resource selftests async initramfs ipc mm/cleanups drivers/char mm/slub spelling Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: eliminate old-style function definitions alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h> Subsystem: procfs Colin Ian King <colin.king@canonical.com>: fs/proc/generic.c: fix incorrect pde_is_permanent check Alexey Dobriyan <adobriyan@gmail.com>: proc: save LOC in __xlate_proc_name() proc: mandate ->proc_lseek in "struct proc_ops" proc: delete redundant subset=pid check selftests: proc: test subset=pid Subsystem: sysctl zhouchuangao <zhouchuangao@vivo.com>: proc/sysctl: fix function name error in comments Subsystem: misc "Matthew Wilcox (Oracle)" <willy@infradead.org>: include: remove pagemap.h from blkdev.h Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: drop inclusion in bitmap.h Wan Jiabing <wanjiabing@vivo.com>: linux/profile.h: remove unnecessary declaration Subsystem: core-kernel Rasmus Villemoes <linux@rasmusvillemoes.dk>: kernel/async.c: fix pr_debug statement kernel/cred.c: make init_groups static Subsystem: bitmap Yury Norov <yury.norov@gmail.com>: Patch series "lib/find_bit: fast path for small bitmaps", v6: tools: disable -Wno-type-limits tools: bitmap: sync function declarations with the kernel tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300 lib: extend the scope of small_const_nbits() macro tools: sync small_const_nbits() macro with the kernel lib: inline _find_next_bit() wrappers tools: sync find_next_bit implementation lib: add fast path for find_next_*_bit() lib: add fast path for find_first_*_bit() and find_last_bit() tools: sync lib/find_bit implementation MAINTAINERS: add entry for the bitmap API Subsystem: lib Bhaskar Chowdhury <unixbhaskar@gmail.com>: lib/bch.c: fix a typo in the file bch.c Wang Qing <wangqing@vivo.com>: lib: fix inconsistent indenting in process_bit1() ToastC <mrtoastcheng@gmail.com>: lib/list_sort.c: fix typo in function description Bhaskar Chowdhury <unixbhaskar@gmail.com>: lib/genalloc.c: Fix a typo Richard Fitzgerald <rf@opensource.cirrus.com>: lib: crc8: pointer to data block should be const Zqiang <qiang.zhang@windriver.com>: lib: stackdepot: turn depot_lock spinlock to raw_spinlock Alex Shi <alexs@kernel.org>: lib/percpu_counter: tame kernel-doc compile warning lib/genalloc: add parameter description to fix doc compile warning Randy Dunlap <rdunlap@infradead.org>: lib: parser: clean up kernel-doc Subsystem: compat Masahiro Yamada <masahiroy@kernel.org>: include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx() Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: warn when missing newline in return sysfs_emit() formats Vincent Mailhol <mailhol.vincent@wanadoo.fr>: checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE Christophe JAILLET <christophe.jaillet@wanadoo.fr>: checkpatch: improve ALLOC_ARRAY_ARGS test Subsystem: epoll Davidlohr Bueso <dave@stgolabs.net>: Patch series "fs/epoll: restore user-visible behavior upon event ready": kselftest: introduce new epoll test case fs/epoll: restore waking from ep_done_scan() Subsystem: isofs "Gustavo A. R. Silva" <gustavoars@kernel.org>: isofs: fix fall-through warnings for Clang Subsystem: nilfs2 Liu xuzhi <liu.xuzhi@zte.com.cn>: fs/nilfs2: fix misspellings using codespell tool Lu Jialin <lujialin4@huawei.com>: nilfs2: fix typos in comments Subsystem: hpfs "Gustavo A. R. Silva" <gustavoars@kernel.org>: hpfs: replace one-element array with flexible-array member Subsystem: exit Jim Newsome <jnewsome@torproject.org>: do_wait: make PIDTYPE_PID case O(1) instead of O(n) Subsystem: fork Rolf Eike Beer <eb@emlix.com>: kernel/fork.c: simplify copy_mm() Xiaofeng Cao <cxfcosmos@gmail.com>: kernel/fork.c: fix typos Subsystem: kexec Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>: kernel/crash_core: add crashkernel=auto for vmcore creation Joe LeVeque <jolevequ@microsoft.com>: kexec: Add kexec reboot string Jia-Ju Bai <baijiaju1990@gmail.com>: kernel: kexec_file: fix error return code of kexec_calculate_store_digests() Pavel Tatashin <pasha.tatashin@soleen.com>: kexec: dump kmessage before machine_kexec Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: gcov: combine common code gcov: simplify buffer allocation gcov: use kvmalloc() Nick Desaulniers <ndesaulniers@google.com>: gcov: clang: drop support for clang-10 and older Subsystem: panic He Ying <heying24@huawei.com>: smp: kernel/panic.c - silence warnings Subsystem: delayacct Yafang Shao <laoar.shao@gmail.com>: delayacct: clear right task's flag after blkio completes Subsystem: gdb Johannes Berg <johannes.berg@intel.com>: gdb: lx-symbols: store the abspath() Barry Song <song.bao.hua@hisilicon.com>: Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2: scripts/gdb: document lx_current is only supported by x86 scripts/gdb: add lx_current support for arm64 Subsystem: resource David Hildenbrand <david@redhat.com>: Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2: kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources kernel/resource: remove first_lvl / siblings_only logic Alistair Popple <apopple@nvidia.com>: kernel/resource: allow region_intersects users to hold resource_lock kernel/resource: refactor __request_region to allow external locking kernel/resource: fix locking in request_free_mem_region Subsystem: selftests Zhang Yunkai <zhang.yunkai@zte.com.cn>: selftests: remove duplicate include Subsystem: async Rasmus Villemoes <linux@rasmusvillemoes.dk>: kernel/async.c: stop guarding pr_debug() statements kernel/async.c: remove async_unregister_domain() Subsystem: initramfs Rasmus Villemoes <linux@rasmusvillemoes.dk>: Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3: init/initramfs.c: do unpacking asynchronously modules: add CONFIG_MODPROBE_PATH Subsystem: ipc Bhaskar Chowdhury <unixbhaskar@gmail.com>: ipc/sem.c: mundane typo fixes Subsystem: mm/cleanups Shijie Luo <luoshijie1@huawei.com>: mm: fix some typos and code style problems Subsystem: drivers/char David Hildenbrand <david@redhat.com>: Patch series "drivers/char: remove /dev/kmem for good": drivers/char: remove /dev/kmem for good mm: remove xlate_dev_kmem_ptr() mm/vmalloc: remove vwrite() Subsystem: mm/slub Maninder Singh <maninder1.s@samsung.com>: arm: print alloc free paths for address in registers Subsystem: spelling Drew Fustini <drew@beagleboard.org>: scripts/spelling.txt: add "overlfow" zuoqilin <zuoqilin@yulong.com>: scripts/spelling.txt: Add "diabled" typo Drew Fustini <drew@beagleboard.org>: scripts/spelling.txt: add "overflw" Colin Ian King <colin.king@canonical.com>: mm/slab.c: fix spelling mistake "disired" -> "desired" Bhaskar Chowdhury <unixbhaskar@gmail.com>: include/linux/pgtable.h: few spelling fixes zhouchuangao <zhouchuangao@vivo.com>: kernel/umh.c: fix some spelling mistakes Xiaofeng Cao <cxfcosmos@gmail.com>: kernel/user_namespace.c: fix typos Bhaskar Chowdhury <unixbhaskar@gmail.com>: kernel/up.c: fix typo Xiaofeng Cao <caoxiaofeng@yulong.com>: kernel/sys.c: fix typo dingsenjie <dingsenjie@yulong.com>: fs: fat: fix spelling typo of values Bhaskar Chowdhury <unixbhaskar@gmail.com>: ipc/sem.c: spelling fix Masahiro Yamada <masahiroy@kernel.org>: treewide: remove editor modelines and cruft Ingo Molnar <mingo@kernel.org>: mm: fix typos in comments Lu Jialin <lujialin4@huawei.com>: mm: fix typos in comments Documentation/admin-guide/devices.txt | 2 Documentation/admin-guide/kdump/kdump.rst | 3 Documentation/admin-guide/kernel-parameters.txt | 18 Documentation/dev-tools/gdb-kernel-debugging.rst | 4 MAINTAINERS | 16 arch/Kconfig | 20 arch/alpha/include/asm/io.h | 5 arch/alpha/kernel/pc873xx.c | 4 arch/alpha/lib/csum_partial_copy.c | 1 arch/arm/configs/dove_defconfig | 1 arch/arm/configs/magician_defconfig | 1 arch/arm/configs/moxart_defconfig | 1 arch/arm/configs/mps2_defconfig | 1 arch/arm/configs/mvebu_v5_defconfig | 1 arch/arm/configs/xcep_defconfig | 1 arch/arm/include/asm/bug.h | 1 arch/arm/include/asm/io.h | 5 arch/arm/kernel/process.c | 11 arch/arm/kernel/traps.c | 1 arch/h8300/include/asm/bitops.h | 8 arch/hexagon/configs/comet_defconfig | 1 arch/hexagon/include/asm/io.h | 1 arch/ia64/include/asm/io.h | 1 arch/ia64/include/asm/uaccess.h | 18 arch/m68k/atari/time.c | 7 arch/m68k/configs/amcore_defconfig | 1 arch/m68k/include/asm/bitops.h | 6 arch/m68k/include/asm/io_mm.h | 5 arch/mips/include/asm/io.h | 5 arch/openrisc/configs/or1ksim_defconfig | 1 arch/parisc/include/asm/io.h | 5 arch/parisc/include/asm/pdc_chassis.h | 1 arch/powerpc/include/asm/io.h | 5 arch/s390/include/asm/io.h | 5 arch/sh/configs/edosk7705_defconfig | 1 arch/sh/configs/se7206_defconfig | 1 arch/sh/configs/sh2007_defconfig | 1 arch/sh/configs/sh7724_generic_defconfig | 1 arch/sh/configs/sh7770_generic_defconfig | 1 arch/sh/configs/sh7785lcr_32bit_defconfig | 1 arch/sh/include/asm/bitops.h | 5 arch/sh/include/asm/io.h | 5 arch/sparc/configs/sparc64_defconfig | 1 arch/sparc/include/asm/io_64.h | 5 arch/um/drivers/cow.h | 7 arch/xtensa/configs/xip_kc705_defconfig | 1 block/blk-settings.c | 1 drivers/auxdisplay/panel.c | 7 drivers/base/firmware_loader/main.c | 2 drivers/block/brd.c | 1 drivers/block/loop.c | 1 drivers/char/Kconfig | 10 drivers/char/mem.c | 231 -------- drivers/gpu/drm/qxl/qxl_drv.c | 1 drivers/isdn/capi/kcapi_proc.c | 1 drivers/md/bcache/super.c | 1 drivers/media/usb/pwc/pwc-uncompress.c | 3 drivers/net/ethernet/adaptec/starfire.c | 8 drivers/net/ethernet/amd/atarilance.c | 8 drivers/net/ethernet/amd/pcnet32.c | 7 drivers/net/wireless/intersil/hostap/hostap_proc.c | 1 drivers/net/wireless/intersil/orinoco/orinoco_nortel.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_pci.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_plx.c | 8 drivers/net/wireless/intersil/orinoco/orinoco_tmd.c | 8 drivers/nvdimm/btt.c | 1 drivers/nvdimm/pmem.c | 1 drivers/parport/parport_ip32.c | 12 drivers/platform/x86/dell/dell_rbu.c | 3 drivers/scsi/53c700.c | 1 drivers/scsi/53c700.h | 1 drivers/scsi/ch.c | 6 drivers/scsi/esas2r/esas2r_main.c | 1 drivers/scsi/ips.c | 20 drivers/scsi/ips.h | 20 drivers/scsi/lasi700.c | 1 drivers/scsi/megaraid/mbox_defs.h | 2 drivers/scsi/megaraid/mega_common.h | 2 drivers/scsi/megaraid/megaraid_mbox.c | 2 drivers/scsi/megaraid/megaraid_mbox.h | 2 drivers/scsi/qla1280.c | 12 drivers/scsi/scsicam.c | 1 drivers/scsi/sni_53c710.c | 1 drivers/video/fbdev/matrox/matroxfb_base.c | 9 drivers/video/fbdev/vga16fb.c | 10 fs/configfs/configfs_internal.h | 4 fs/configfs/dir.c | 4 fs/configfs/file.c | 4 fs/configfs/inode.c | 4 fs/configfs/item.c | 4 fs/configfs/mount.c | 4 fs/configfs/symlink.c | 4 fs/eventpoll.c | 6 fs/fat/fatent.c | 2 fs/hpfs/hpfs.h | 3 fs/isofs/rock.c | 1 fs/nfs/dir.c | 7 fs/nfs/nfs4proc.c | 6 fs/nfs/nfs4renewd.c | 6 fs/nfs/nfs4state.c | 6 fs/nfs/nfs4xdr.c | 6 fs/nfsd/nfs4proc.c | 6 fs/nfsd/nfs4xdr.c | 6 fs/nfsd/xdr4.h | 6 fs/nilfs2/cpfile.c | 2 fs/nilfs2/ioctl.c | 4 fs/nilfs2/segment.c | 4 fs/nilfs2/the_nilfs.c | 2 fs/ocfs2/acl.c | 4 fs/ocfs2/acl.h | 4 fs/ocfs2/alloc.c | 4 fs/ocfs2/alloc.h | 4 fs/ocfs2/aops.c | 4 fs/ocfs2/aops.h | 4 fs/ocfs2/blockcheck.c | 4 fs/ocfs2/blockcheck.h | 4 fs/ocfs2/buffer_head_io.c | 4 fs/ocfs2/buffer_head_io.h | 4 fs/ocfs2/cluster/heartbeat.c | 4 fs/ocfs2/cluster/heartbeat.h | 4 fs/ocfs2/cluster/masklog.c | 4 fs/ocfs2/cluster/masklog.h | 4 fs/ocfs2/cluster/netdebug.c | 4 fs/ocfs2/cluster/nodemanager.c | 4 fs/ocfs2/cluster/nodemanager.h | 4 fs/ocfs2/cluster/ocfs2_heartbeat.h | 4 fs/ocfs2/cluster/ocfs2_nodemanager.h | 4 fs/ocfs2/cluster/quorum.c | 4 fs/ocfs2/cluster/quorum.h | 4 fs/ocfs2/cluster/sys.c | 4 fs/ocfs2/cluster/sys.h | 4 fs/ocfs2/cluster/tcp.c | 4 fs/ocfs2/cluster/tcp.h | 4 fs/ocfs2/cluster/tcp_internal.h | 4 fs/ocfs2/dcache.c | 4 fs/ocfs2/dcache.h | 4 fs/ocfs2/dir.c | 4 fs/ocfs2/dir.h | 4 fs/ocfs2/dlm/dlmapi.h | 4 fs/ocfs2/dlm/dlmast.c | 4 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/dlm/dlmconvert.c | 4 fs/ocfs2/dlm/dlmconvert.h | 4 fs/ocfs2/dlm/dlmdebug.c | 4 fs/ocfs2/dlm/dlmdebug.h | 4 fs/ocfs2/dlm/dlmdomain.c | 4 fs/ocfs2/dlm/dlmdomain.h | 4 fs/ocfs2/dlm/dlmlock.c | 4 fs/ocfs2/dlm/dlmmaster.c | 4 fs/ocfs2/dlm/dlmrecovery.c | 4 fs/ocfs2/dlm/dlmthread.c | 4 fs/ocfs2/dlm/dlmunlock.c | 4 fs/ocfs2/dlmfs/dlmfs.c | 4 fs/ocfs2/dlmfs/userdlm.c | 4 fs/ocfs2/dlmfs/userdlm.h | 4 fs/ocfs2/dlmglue.c | 4 fs/ocfs2/dlmglue.h | 4 fs/ocfs2/export.c | 4 fs/ocfs2/export.h | 4 fs/ocfs2/extent_map.c | 4 fs/ocfs2/extent_map.h | 4 fs/ocfs2/file.c | 4 fs/ocfs2/file.h | 4 fs/ocfs2/filecheck.c | 4 fs/ocfs2/filecheck.h | 4 fs/ocfs2/heartbeat.c | 4 fs/ocfs2/heartbeat.h | 4 fs/ocfs2/inode.c | 4 fs/ocfs2/inode.h | 4 fs/ocfs2/journal.c | 4 fs/ocfs2/journal.h | 4 fs/ocfs2/localalloc.c | 4 fs/ocfs2/localalloc.h | 4 fs/ocfs2/locks.c | 4 fs/ocfs2/locks.h | 4 fs/ocfs2/mmap.c | 4 fs/ocfs2/move_extents.c | 4 fs/ocfs2/move_extents.h | 4 fs/ocfs2/namei.c | 4 fs/ocfs2/namei.h | 4 fs/ocfs2/ocfs1_fs_compat.h | 4 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/ocfs2_fs.h | 4 fs/ocfs2/ocfs2_ioctl.h | 4 fs/ocfs2/ocfs2_lockid.h | 4 fs/ocfs2/ocfs2_lockingver.h | 4 fs/ocfs2/refcounttree.c | 4 fs/ocfs2/refcounttree.h | 4 fs/ocfs2/reservations.c | 4 fs/ocfs2/reservations.h | 4 fs/ocfs2/resize.c | 4 fs/ocfs2/resize.h | 4 fs/ocfs2/slot_map.c | 4 fs/ocfs2/slot_map.h | 4 fs/ocfs2/stack_o2cb.c | 4 fs/ocfs2/stack_user.c | 4 fs/ocfs2/stackglue.c | 4 fs/ocfs2/stackglue.h | 4 fs/ocfs2/suballoc.c | 4 fs/ocfs2/suballoc.h | 4 fs/ocfs2/super.c | 4 fs/ocfs2/super.h | 4 fs/ocfs2/symlink.c | 4 fs/ocfs2/symlink.h | 4 fs/ocfs2/sysfile.c | 4 fs/ocfs2/sysfile.h | 4 fs/ocfs2/uptodate.c | 4 fs/ocfs2/uptodate.h | 4 fs/ocfs2/xattr.c | 4 fs/ocfs2/xattr.h | 4 fs/proc/generic.c | 13 fs/proc/inode.c | 18 fs/proc/proc_sysctl.c | 2 fs/reiserfs/procfs.c | 10 include/asm-generic/bitops/find.h | 108 +++ include/asm-generic/bitops/le.h | 38 + include/asm-generic/bitsperlong.h | 12 include/asm-generic/io.h | 11 include/linux/align.h | 15 include/linux/async.h | 1 include/linux/bitmap.h | 11 include/linux/bitops.h | 12 include/linux/blkdev.h | 1 include/linux/compat.h | 1 include/linux/configfs.h | 4 include/linux/crc8.h | 2 include/linux/cred.h | 1 include/linux/delayacct.h | 20 include/linux/fs.h | 2 include/linux/genl_magic_func.h | 1 include/linux/genl_magic_struct.h | 1 include/linux/gfp.h | 2 include/linux/init_task.h | 1 include/linux/initrd.h | 2 include/linux/kernel.h | 9 include/linux/mm.h | 2 include/linux/mmzone.h | 2 include/linux/pgtable.h | 10 include/linux/proc_fs.h | 1 include/linux/profile.h | 3 include/linux/smp.h | 8 include/linux/swap.h | 1 include/linux/vmalloc.h | 7 include/uapi/linux/if_bonding.h | 11 include/uapi/linux/nfs4.h | 6 include/xen/interface/elfnote.h | 10 include/xen/interface/hvm/hvm_vcpu.h | 10 include/xen/interface/io/xenbus.h | 10 init/Kconfig | 12 init/initramfs.c | 38 + init/main.c | 1 ipc/sem.c | 12 kernel/async.c | 68 -- kernel/configs/android-base.config | 1 kernel/crash_core.c | 7 kernel/cred.c | 2 kernel/exit.c | 67 ++ kernel/fork.c | 23 kernel/gcov/Kconfig | 1 kernel/gcov/base.c | 49 + kernel/gcov/clang.c | 282 ---------- kernel/gcov/fs.c | 146 ++++- kernel/gcov/gcc_4_7.c | 173 ------ kernel/gcov/gcov.h | 14 kernel/kexec_core.c | 4 kernel/kexec_file.c | 4 kernel/kmod.c | 2 kernel/resource.c | 198 ++++--- kernel/sys.c | 14 kernel/umh.c | 8 kernel/up.c | 2 kernel/user_namespace.c | 6 lib/bch.c | 2 lib/crc8.c | 2 lib/decompress_unlzma.c | 2 lib/find_bit.c | 68 -- lib/genalloc.c | 7 lib/list_sort.c | 2 lib/parser.c | 61 +- lib/percpu_counter.c | 2 lib/stackdepot.c | 6 mm/balloon_compaction.c | 4 mm/compaction.c | 4 mm/filemap.c | 2 mm/gup.c | 2 mm/highmem.c | 2 mm/huge_memory.c | 6 mm/hugetlb.c | 6 mm/internal.h | 2 mm/kasan/kasan.h | 8 mm/kasan/quarantine.c | 4 mm/kasan/shadow.c | 4 mm/kfence/report.c | 2 mm/khugepaged.c | 2 mm/ksm.c | 6 mm/madvise.c | 4 mm/memcontrol.c | 18 mm/memory-failure.c | 2 mm/memory.c | 18 mm/mempolicy.c | 6 mm/migrate.c | 8 mm/mmap.c | 4 mm/mprotect.c | 2 mm/mremap.c | 2 mm/nommu.c | 10 mm/oom_kill.c | 2 mm/page-writeback.c | 4 mm/page_alloc.c | 16 mm/page_owner.c | 2 mm/page_vma_mapped.c | 2 mm/percpu-internal.h | 2 mm/percpu.c | 2 mm/pgalloc-track.h | 6 mm/rmap.c | 2 mm/slab.c | 8 mm/slub.c | 2 mm/swap.c | 4 mm/swap_slots.c | 2 mm/swap_state.c | 2 mm/vmalloc.c | 124 ---- mm/vmstat.c | 2 mm/z3fold.c | 2 mm/zpool.c | 2 mm/zsmalloc.c | 6 samples/configfs/configfs_sample.c | 2 scripts/checkpatch.pl | 15 scripts/gdb/linux/cpus.py | 23 scripts/gdb/linux/symbols.py | 3 scripts/spelling.txt | 3 tools/include/asm-generic/bitops/find.h | 85 ++- tools/include/asm-generic/bitsperlong.h | 3 tools/include/linux/bitmap.h | 18 tools/lib/bitmap.c | 4 tools/lib/find_bit.c | 56 - tools/scripts/Makefile.include | 1 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 44 + tools/testing/selftests/kvm/lib/sparsebit.c | 1 tools/testing/selftests/mincore/mincore_selftest.c | 1 tools/testing/selftests/powerpc/mm/tlbie_test.c | 1 tools/testing/selftests/proc/Makefile | 1 tools/testing/selftests/proc/proc-subset-pid.c | 121 ++++ tools/testing/selftests/proc/read.c | 4 tools/usb/hcd-tests.sh | 2 343 files changed, 1383 insertions(+), 2119 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-05-07 1:01 incoming Andrew Morton @ 2021-05-07 7:12 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2021-05-07 7:12 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > I've been wobbly about the secretmem patches due to doubts about > whether the feature is sufficiently useful to justify inclusion, but > developers are now weighing in with helpful information and I've asked Mike > for an extensively updated [0/n] changelog. This will take a few days > to play out so it is possible that I will prevail upon you for a post-rc1 > merge. Oh, much too late for this release by now. > If that's a problem, there's always 5.13-rc1. 5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time - and version numbers - fly. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-05-05 1:32 Andrew Morton 2021-05-05 1:47 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits The remainder of the main mm/ queue. 143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus previously sent patches. Subsystems affected by this patch series: mm/pagecache mm/hugetlb mm/userfaultfd mm/vmscan mm/compaction mm/migration mm/cma mm/ksm mm/vmstat mm/mmap mm/kconfig mm/util mm/memory-hotplug mm/zswap mm/zsmalloc mm/highmem mm/cleanups mm/kfence Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Remove nrexceptional tracking", v2: mm: introduce and use mapping_empty() mm: stop accounting shadow entries dax: account DAX entries as nrpages mm: remove nrexceptional from inode Hugh Dickins <hughd@google.com>: mm: remove nrexceptional from inode: remove BUG_ON Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4: hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share() hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: remove redundant reservation check condition in alloc_huge_page() Anshuman Khandual <anshuman.khandual@arm.com>: mm: generalize HUGETLB_PAGE_SIZE_VARIABLE Miaohe Lin <linmiaohe@huawei.com>: Patch series "Some cleanups for hugetlb": mm/hugetlb: use some helper functions to cleanup code mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state() mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate() mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page() mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case Patch series "Cleanup and fixup for khugepaged", v2: khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps() khugepaged: reuse the smp_wmb() inside __SetPageUptodate() khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter() khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate() mm/huge_memory.c: remove unnecessary local variable ret2 Patch series "Some cleanups for huge_memory", v3: mm/huge_memory.c: rework the function vma_adjust_trans_huge() mm/huge_memory.c: make get_huge_zero_page() return bool mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly mm/huge_memory.c: remove redundant PageCompound() check mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG mm/huge_memory.c: use helper function migration_entry_to_page() Yanfei Xu <yanfei.xu@windriver.com>: mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup for khugepaged": khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp() khugepaged: remove unnecessary out label in collapse_huge_page() khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd() Zi Yan <ziy@nvidia.com>: mm: huge_memory: a new debugfs interface for splitting THP tests mm: huge_memory: debugfs for file-backed THP split Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for hugetlb", v2: mm/hugeltb: remove redundant VM_BUG_ON() in region_add() mm/hugeltb: simplify the return code of __vma_reservation_common() mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages() mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts() mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages() Mike Kravetz <mike.kravetz@oracle.com>: Patch series "make hugetlb put_page safe for all calling contexts", v5: mm/cma: change cma mutex to irq safe spinlock hugetlb: no need to drop hugetlb_lock to call cma_release hugetlb: add per-hstate mutex to synchronize user adjustments hugetlb: create remove_hugetlb_page() to separate functionality hugetlb: call update_and_free_page without hugetlb_lock hugetlb: change free_pool_huge_page to remove_pool_huge_page hugetlb: make free_huge_page irq safe hugetlb: add lockdep_assert_held() calls for hugetlb_lock Oscar Salvador <osalvador@suse.de>: Patch series "Make alloc_contig_range handle Hugetlb pages", v10: mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range mm,compaction: let isolate_migratepages_{range,block} return error codes mm,hugetlb: drop clearing of flag from prep_new_huge_page mm,hugetlb: split prep_new_huge_page functionality mm: make alloc_contig_range handle free hugetlb pages mm: make alloc_contig_range handle in-use hugetlb pages mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig Subsystem: mm/userfaultfd Axel Rasmussen <axelrasmussen@google.com>: Patch series "userfaultfd: add minor fault handling", v9: userfaultfd: add minor fault registration mode userfaultfd: disable huge PMD sharing for MINOR registered VMAs userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled userfaultfd: add UFFDIO_CONTINUE ioctl userfaultfd: update documentation to describe minor fault handling userfaultfd/selftests: add test exercising minor fault handling Subsystem: mm/vmscan Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: move RECLAIM* bits to uapi header mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks Yang Shi <shy828301@gmail.com>: Patch series "Make shrinker's nr_deferred memcg aware", v10: mm: vmscan: use nid from shrink_control for tracepoint mm: vmscan: consolidate shrinker_maps handling code mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation mm: vmscan: remove memcg_shrinker_map_size mm: vmscan: use kvfree_rcu instead of call_rcu mm: memcontrol: rename shrinker_map to shrinker_info mm: vmscan: add shrinker_info_protected() helper mm: vmscan: use a new flag to indicate shrinker is registered mm: vmscan: add per memcg shrinker nr_deferred mm: vmscan: use per memcg nr_deferred of shrinker mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers mm: memcontrol: reparent nr_deferred when memcg offline mm: vmscan: shrink deferred objects proportional to priority Subsystem: mm/compaction Pintu Kumar <pintu@codeaurora.org>: mm/compaction: remove unused variable sysctl_compact_memory Charan Teja Reddy <charante@codeaurora.org>: mm: compaction: update the COMPACT[STALL|FAIL] events properly Subsystem: mm/migration Minchan Kim <minchan@kernel.org>: mm: disable LRU pagevec during the migration temporarily mm: replace migrate_[prep|finish] with lru_cache_[disable|enable] mm: fs: invalidate BH LRU during page migration Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for mm/migrate.c", v3: mm/migrate.c: make putback_movable_page() static mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page() mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole() Revert "mm: migrate: skip shared exec THP for NUMA balancing" Subsystem: mm/cma Minchan Kim <minchan@kernel.org>: mm: vmstat: add cma statistics Baolin Wang <baolin.wang@linux.alibaba.com>: mm: cma: use pr_err_ratelimited for CMA warning Liam Mark <lmark@codeaurora.org>: mm: cma: add trace events for CMA alloc perf testing Minchan Kim <minchan@kernel.org>: mm: cma: support sysfs mm: cma: add the CMA instance name to cma trace events mm: use proper type for cma_[alloc|release] Subsystem: mm/ksm Miaohe Lin <linmiaohe@huawei.com>: Patch series "Cleanup and fixup for ksm": ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search() ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree() ksm: remove dedicated macro KSM_FLAG_MASK ksm: fix potential missing rmap_item for stable_node Chengyang Fan <cy.fan@huawei.com>: mm/ksm: remove unused parameter from remove_trailing_rmap_items() Subsystem: mm/vmstat Hugh Dickins <hughd@google.com>: mm: restore node stat checking in /proc/sys/vm/stat_refresh mm: no more EINVAL from /proc/sys/vm/stat_refresh mm: /proc/sys/vm/stat_refresh skip checking known negative stats mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats Saravanan D <saravanand@fb.com>: x86/mm: track linear mapping split events Subsystem: mm/mmap Liam Howlett <liam.howlett@oracle.com>: mm/mmap.c: don't unlock VMAs in remap_file_pages() Subsystem: mm/kconfig Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm: some config cleanups", v2: mm: generalize ARCH_HAS_CACHE_LINE_SIZE mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE] mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE Subsystem: mm/util Joe Perches <joe@perches.com>: mm/util.c: reduce mem_dump_obj() object size Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/util.c: fix typo Subsystem: mm/memory-hotplug Pavel Tatashin <pasha.tatashin@soleen.com>: Patch series "prohibit pinning pages in ZONE_MOVABLE", v11: mm/gup: don't pin migrated cma pages in movable zone mm/gup: check every subpage of a compound page during isolation mm/gup: return an error on migration failure mm/gup: check for isolation errors mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN mm: apply per-task gfp constraints in fast path mm: honor PF_MEMALLOC_PIN for all movable pages mm/gup: do not migrate zero page mm/gup: migrate pinned pages out of movable zone memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning mm/gup: change index type to long as it counts pages mm/gup: longterm pin migration cleanup selftests/vm: gup_test: fix test flag selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages Mel Gorman <mgorman@techsingularity.net>: mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove Oscar Salvador <osalvador@suse.de>: Patch series "Allocate memmap from hotadded memory (per device)", v10: drivers/base/memory: introduce memory_block_{online,offline} mm,memory_hotplug: relax fully spanned sections check David Hildenbrand <david@redhat.com>: mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count() Oscar Salvador <osalvador@suse.de>: mm,memory_hotplug: allocate memmap from the added memory range acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported mm,memory_hotplug: add kernel boot option to enable memmap_on_memory x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE Subsystem: mm/zswap Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/zswap.c: switch from strlcpy to strscpy Subsystem: mm/zsmalloc zhouchuangao <zhouchuangao@vivo.com>: mm/zsmalloc: use BUG_ON instead of if condition followed by BUG. Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()": iov_iter: lift memzero_page() to highmem.h btrfs: use memzero_page() instead of open coded kmap pattern songqiang <songqiang@uniontech.com>: mm/highmem.c: fix coding style issue Subsystem: mm/cleanups Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/mempool: minor coding style tweaks Zhang Yunkai <zhang.yunkai@zte.com.cn>: mm/process_vm_access.c: remove duplicate include Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: zero guard page after out-of-bounds access Patch series "kfence: optimize timer scheduling", v2: kfence: await for allocation using wait_event kfence: maximize allocation wait timeout duration kfence: use power-efficient work queue to run delayed work Documentation/ABI/testing/sysfs-kernel-mm-cma | 25 Documentation/admin-guide/kernel-parameters.txt | 17 Documentation/admin-guide/mm/memory-hotplug.rst | 9 Documentation/admin-guide/mm/userfaultfd.rst | 105 +- arch/arc/Kconfig | 9 arch/arm/Kconfig | 10 arch/arm64/Kconfig | 34 arch/arm64/mm/hugetlbpage.c | 7 arch/ia64/Kconfig | 14 arch/ia64/mm/hugetlbpage.c | 3 arch/mips/Kconfig | 6 arch/mips/mm/hugetlbpage.c | 4 arch/parisc/Kconfig | 5 arch/parisc/mm/hugetlbpage.c | 2 arch/powerpc/Kconfig | 17 arch/powerpc/mm/hugetlbpage.c | 3 arch/powerpc/platforms/Kconfig.cputype | 16 arch/riscv/Kconfig | 5 arch/s390/Kconfig | 12 arch/s390/mm/hugetlbpage.c | 2 arch/sh/Kconfig | 7 arch/sh/mm/Kconfig | 8 arch/sh/mm/hugetlbpage.c | 2 arch/sparc/mm/hugetlbpage.c | 2 arch/x86/Kconfig | 33 arch/x86/mm/pat/set_memory.c | 8 drivers/acpi/acpi_memhotplug.c | 5 drivers/base/memory.c | 105 ++ fs/Kconfig | 5 fs/block_dev.c | 2 fs/btrfs/compression.c | 5 fs/btrfs/extent_io.c | 22 fs/btrfs/inode.c | 33 fs/btrfs/reflink.c | 6 fs/btrfs/zlib.c | 5 fs/btrfs/zstd.c | 5 fs/buffer.c | 36 fs/dax.c | 8 fs/gfs2/glock.c | 3 fs/hugetlbfs/inode.c | 9 fs/inode.c | 11 fs/proc/task_mmu.c | 3 fs/userfaultfd.c | 149 +++ include/linux/buffer_head.h | 4 include/linux/cma.h | 4 include/linux/compaction.h | 1 include/linux/fs.h | 2 include/linux/gfp.h | 2 include/linux/highmem.h | 7 include/linux/huge_mm.h | 3 include/linux/hugetlb.h | 37 include/linux/memcontrol.h | 27 include/linux/memory.h | 8 include/linux/memory_hotplug.h | 15 include/linux/memremap.h | 2 include/linux/migrate.h | 11 include/linux/mm.h | 28 include/linux/mmzone.h | 20 include/linux/pagemap.h | 5 include/linux/pgtable.h | 12 include/linux/sched.h | 2 include/linux/sched/mm.h | 27 include/linux/shrinker.h | 7 include/linux/swap.h | 21 include/linux/userfaultfd_k.h | 55 + include/linux/vm_event_item.h | 8 include/trace/events/cma.h | 92 +- include/trace/events/migrate.h | 25 include/trace/events/mmflags.h | 7 include/uapi/linux/mempolicy.h | 7 include/uapi/linux/userfaultfd.h | 36 init/Kconfig | 5 kernel/sysctl.c | 2 lib/Kconfig.kfence | 1 lib/iov_iter.c | 8 mm/Kconfig | 28 mm/Makefile | 6 mm/cma.c | 70 + mm/cma.h | 25 mm/cma_debug.c | 8 mm/cma_sysfs.c | 112 ++ mm/compaction.c | 113 ++ mm/filemap.c | 24 mm/frontswap.c | 12 mm/gup.c | 264 +++--- mm/gup_test.c | 29 mm/gup_test.h | 3 mm/highmem.c | 11 mm/huge_memory.c | 326 +++++++- mm/hugetlb.c | 843 ++++++++++++++-------- mm/hugetlb_cgroup.c | 9 mm/internal.h | 10 mm/kfence/core.c | 61 + mm/khugepaged.c | 63 - mm/ksm.c | 17 mm/list_lru.c | 6 mm/memcontrol.c | 137 --- mm/memory_hotplug.c | 220 +++++ mm/mempolicy.c | 16 mm/mempool.c | 2 mm/migrate.c | 103 -- mm/mlock.c | 4 mm/mmap.c | 18 mm/oom_kill.c | 2 mm/page_alloc.c | 83 +- mm/process_vm_access.c | 1 mm/shmem.c | 2 mm/sparse.c | 4 mm/swap.c | 69 + mm/swap_state.c | 4 mm/swapfile.c | 4 mm/truncate.c | 19 mm/userfaultfd.c | 39 - mm/util.c | 26 mm/vmalloc.c | 2 mm/vmscan.c | 543 +++++++++----- mm/vmstat.c | 45 - mm/workingset.c | 1 mm/zsmalloc.c | 6 mm/zswap.c | 2 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/gup_test.c | 38 tools/testing/selftests/vm/split_huge_page_test.c | 400 ++++++++++ tools/testing/selftests/vm/userfaultfd.c | 164 ++++ 125 files changed, 3596 insertions(+), 1668 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-05-05 1:32 incoming Andrew Morton @ 2021-05-05 1:47 ` Linus Torvalds 2021-05-05 3:16 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2021-05-05 1:47 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 143 patches Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing. Maybe just some mail delay? But at least right now https://lore.kernel.org/mm-commits/ doesn't show them (and thus 'b4' doesn't work). I'll check again later. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-05-05 1:47 ` incoming Linus Torvalds @ 2021-05-05 3:16 ` Andrew Morton 2021-05-05 17:10 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-05-05 3:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 143 patches > > Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing. > > Maybe just some mail delay? But at least right now > > https://lore.kernel.org/mm-commits/ > > doesn't show them (and thus 'b4' doesn't work). > > I'll check again later. > Well that's strange. I see all three via cc:me, but not on linux-mm or mm-commits. Let me resend right now with the same in-reply-to. Hopefully they will land in the correct place. ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-05-05 3:16 ` incoming Andrew Morton @ 2021-05-05 17:10 ` Linus Torvalds 2021-05-05 17:44 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Let me resend right now with the same in-reply-to. Hopefully they will > land in the correct place. Well, you re-sent it twice, and I have three copies in my own mailbox, bot they still don't show up on the mm-commits mailing list. So the list hates them for some odd reason. I've picked them up locally, but adding Konstantin to the participants to see if he can see what's up. Konstantin: patches 103/106/107 are missing on lore out of Andrew's series of 143. Odd. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-05-05 17:10 ` incoming Linus Torvalds @ 2021-05-05 17:44 ` Andrew Morton 2021-05-06 3:19 ` incoming Anshuman Khandual 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw) To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits [-- Attachment #1: Type: text/plain, Size: 1387 bytes --] On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Let me resend right now with the same in-reply-to. Hopefully they will > > land in the correct place. > > Well, you re-sent it twice, and I have three copies in my own mailbox, > bot they still don't show up on the mm-commits mailing list. > > So the list hates them for some odd reason. > > I've picked them up locally, but adding Konstantin to the participants > to see if he can see what's up. > > Konstantin: patches 103/106/107 are missing on lore out of Andrew's > series of 143. Odd. It's weird. They don't turn up on linux-mm either, and that's running at kvack.org, also majordomo. They don't get through when sent with either heirloom-mailx or with sylpheed. Also, it seems that when Anshuman originally sent the patch, linux-mm and linux-kernel didn't send it back out. So perhaps a spam filter triggered? I'm seeing https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/ which is via linux-arm-kernel@lists.infradead.org but the linux-kernel server massacred that patch series. Searching https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7 email series. One of the emails (as sent my me) is attached, if that helps. [-- Attachment #2: x.txt --] [-- Type: text/plain, Size: 21048 bytes --] Return-Path: <akpm@linux-foundation.org> X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y X-Spam-Level: (none) X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID, USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1 Received: from localhost.localdomain (localhost.localdomain [127.0.0.1]) by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202 for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700 Received: from imap.fastmail.com [66.111.4.135] by localhost.localdomain with IMAP (fetchmail-6.3.26) for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT) Received: from compute1.internal (compute1.nyi.internal [10.202.2.41]) by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA; Tue, 04 May 2021 23:16:31 -0400 X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249 X-Sieve: CMU Sieve 3.0 X-Resolved-to: akpm@mbx.kernel.org X-Delivered-to: akpm@mbx.kernel.org X-Mail-from: akpm@linux-foundation.org Received: from mx6 ([10.202.2.205]) by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400 Received: from mx6.messagingengine.com (localhost [127.0.0.1]) by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1 for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT) Received: from mx6.messagingengine.com (localhost [127.0.0.1]) by mx6.messagingengine.com (Authentication Milter) with ESMTP id 14870833D7F; Tue, 4 May 2021 23:16:31 -0400 ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t= 1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1 tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw== ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=date:from:to:subject:message-id :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh 7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ== ARC-Authentication-Results: i=2; mx6.messagingengine.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.215.198; bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256 header.s=korg x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=linux-foundation.org; iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com); spf=pass smtp.mailfrom=akpm@linux-foundation.org smtp.helo=mail-pg1-f198.google.com; x-aligned-from=pass (Address match); x-arc-spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1 x-arc-domain=google.com (Trusted from aar.1.google.com); x-csa=none; x-google-dkim=fail (message has been altered, 2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf; x-me-sender=none; x-ptr=pass smtp.helo=mail-pg1-f198.google.com policy.ptr=mail-pg1-f198.google.com; x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384 smtp.bits=256/256; x-vs=clean score=40 state=0 Authentication-Results: mx6.messagingengine.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.215.198; bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256 header.s=korg x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=linux-foundation.org; iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com); spf=pass smtp.mailfrom=akpm@linux-foundation.org smtp.helo=mail-pg1-f198.google.com; x-aligned-from=pass (Address match); x-arc-spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1 x-arc-domain=google.com (Trusted from aar.1.google.com); x-csa=none; x-google-dkim=fail (message has been altered, 2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf; x-me-sender=none; x-ptr=pass smtp.helo=mail-pg1-f198.google.com policy.ptr=mail-pg1-f198.google.com; x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384 smtp.bits=256/256; x-vs=clean score=40 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe X-ME-VSScore: 40 X-ME-VSCategory: clean X-ME-CSA: none Received-SPF: pass (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched)) receiver=mx6.messagingengine.com; identity=mailfrom; envelope-from="akpm@linux-foundation.org"; helo=mail-pg1-f198.google.com; client-ip=209.85.215.198 Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by mx6.messagingengine.com (Postfix) with ESMTPS for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT) Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5 for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id :in-reply-to:user-agent; bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=; b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X 25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2 vl3Q== X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U= X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161; Tue, 04 May 2021 20:16:29 -0700 (PDT) X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109; Tue, 04 May 2021 20:16:28 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none; d=google.com; s=arc-20160816; b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV 50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO 8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm pO/g== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=user-agent:in-reply-to:message-id:subject:to:from:date :dkim-signature; bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=; b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5 uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA rOOg== ARC-Authentication-Results: i=1; mx.google.com; dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9"; spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99]) by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27 (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128); Tue, 04 May 2021 20:16:28 -0700 (PDT) Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99; Authentication-Results: mx.google.com; dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9"; spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2; Wed, 5 May 2021 03:16:26 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org; s=korg; t=1620184587; bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=; h=Date:From:To:Subject:In-Reply-To:From; b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE= Date: Tue, 04 May 2021 20:16:26 -0700 From: Andrew Morton <akpm@linux-foundation.org> To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org> In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org> User-Agent: s-nail v14.8.16 X-Gm-Original-To: akpm@linux-foundation.org From: Anshuman Khandual <anshuman.khandual@arm.com> Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS) SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that subscribe it. Instead, just make it a generic option which can be selected on applicable platforms. Also rename it as ARCH_SUPPORTS_HUGETLBFS instead. This reduces code duplication and makes it cleaner. Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com> Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64] Acked-by: Palmer Dabbelt <palmerdabbelt@google.com> [riscv] Acked-by: Michael Ellerman <mpe@ellerman.id.au> [powerpc] Cc: Russell King <linux@armlinux.org.uk> Cc: Will Deacon <will@kernel.org> Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de> Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com> Cc: Helge Deller <deller@gmx.de> Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org> Cc: Paul Mackerras <paulus@samba.org> Cc: Paul Walmsley <paul.walmsley@sifive.com> Cc: Albert Ou <aou@eecs.berkeley.edu> Cc: Yoshinori Sato <ysato@users.sourceforge.jp> Cc: Rich Felker <dalias@libc.org> Cc: Alexander Viro <viro@zeniv.linux.org.uk> Cc: Arnd Bergmann <arnd@arndb.de> Cc: Borislav Petkov <bp@alien8.de> Cc: Christian Borntraeger <borntraeger@de.ibm.com> Cc: Heiko Carstens <hca@linux.ibm.com> Cc: "H. Peter Anvin" <hpa@zytor.com> Cc: Ingo Molnar <mingo@redhat.com> Cc: Thomas Gleixner <tglx@linutronix.de> Cc: Vasily Gorbik <gor@linux.ibm.com> Cc: Vineet Gupta <vgupta@synopsys.com> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- arch/arm/Kconfig | 5 +---- arch/arm64/Kconfig | 4 +--- arch/mips/Kconfig | 6 +----- arch/parisc/Kconfig | 5 +---- arch/powerpc/Kconfig | 3 --- arch/powerpc/platforms/Kconfig.cputype | 6 +++--- arch/riscv/Kconfig | 5 +---- arch/sh/Kconfig | 5 +---- fs/Kconfig | 5 ++++- 9 files changed, 13 insertions(+), 31 deletions(-) --- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/arm64/Kconfig @@ -73,6 +73,7 @@ config ARM64 select ARCH_USE_QUEUED_SPINLOCKS select ARCH_USE_SYM_ANNOTATIONS select ARCH_SUPPORTS_DEBUG_PAGEALLOC + select ARCH_SUPPORTS_HUGETLBFS select ARCH_SUPPORTS_MEMORY_FAILURE select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN @@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS def_bool y depends on ARM_PMU -config SYS_SUPPORTS_HUGETLBFS - def_bool y - config ARCH_HAS_FILTER_PGPROT def_bool y --- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/arm/Kconfig @@ -31,6 +31,7 @@ config ARM select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7 select ARCH_SUPPORTS_ATOMIC_RMW + select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE select ARCH_USE_BUILTIN_BSWAP select ARCH_USE_CMPXCHG_LOCKREF select ARCH_USE_MEMTEST @@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS def_bool y depends on ARM_PMU -config SYS_SUPPORTS_HUGETLBFS - def_bool y - depends on ARM_LPAE - config HAVE_ARCH_TRANSPARENT_HUGEPAGE def_bool y depends on ARM_LPAE --- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/mips/Kconfig @@ -19,6 +19,7 @@ config MIPS select ARCH_USE_MEMTEST select ARCH_USE_QUEUED_RWLOCKS select ARCH_USE_QUEUED_SPINLOCKS + select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU select ARCH_WANT_IPC_PARSE_VERSION select ARCH_WANT_LD_ORPHAN_WARN @@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN config SYS_SUPPORTS_LITTLE_ENDIAN bool -config SYS_SUPPORTS_HUGETLBFS - bool - depends on CPU_SUPPORTS_HUGEPAGES - default y - config MIPS_HUGE_TLB_SUPPORT def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE --- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/parisc/Kconfig @@ -12,6 +12,7 @@ config PARISC select ARCH_HAS_STRICT_KERNEL_RWX select ARCH_HAS_UBSAN_SANITIZE_ALL select ARCH_NO_SG_CHAIN + select ARCH_SUPPORTS_HUGETLBFS if PA20 select ARCH_SUPPORTS_MEMORY_FAILURE select DMA_OPS select RTC_CLASS @@ -138,10 +139,6 @@ config PGTABLE_LEVELS default 3 if 64BIT && PARISC_PAGE_SIZE_4KB default 2 -config SYS_SUPPORTS_HUGETLBFS - def_bool y if PA20 - - menu "Processor type and features" choice --- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/powerpc/Kconfig @@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT def_bool y depends on PPC_BOOK3S_64 -config SYS_SUPPORTS_HUGETLBFS - bool - config ILLEGAL_POINTER_VALUE hex # This is roughly half way between the top of user space and the bottom --- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/powerpc/platforms/Kconfig.cputype @@ -40,8 +40,8 @@ config PPC_85xx config PPC_8xx bool "Freescale 8xx" + select ARCH_SUPPORTS_HUGETLBFS select FSL_SOC - select SYS_SUPPORTS_HUGETLBFS select PPC_HAVE_KUEP select PPC_HAVE_KUAP select HAVE_ARCH_VMAP_STACK @@ -95,9 +95,9 @@ config PPC_BOOK3S_64 bool "Server processors" select PPC_FPU select PPC_HAVE_PMU_SUPPORT - select SYS_SUPPORTS_HUGETLBFS select HAVE_ARCH_TRANSPARENT_HUGEPAGE select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE + select ARCH_SUPPORTS_HUGETLBFS select ARCH_SUPPORTS_NUMA_BALANCING select IRQ_WORK select PPC_MM_SLICES @@ -278,9 +278,9 @@ config FSL_BOOKE # this is for common code between PPC32 & PPC64 FSL BOOKE config PPC_FSL_BOOK3E bool + select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64 select FSL_EMB_PERFMON select PPC_SMP_MUXED_IPI - select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64 select PPC_DOORBELL default y if FSL_BOOKE --- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/riscv/Kconfig @@ -30,6 +30,7 @@ config RISCV select ARCH_HAS_STRICT_KERNEL_RWX if MMU select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT + select ARCH_SUPPORTS_HUGETLBFS if MMU select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU select ARCH_WANT_FRAME_POINTERS select ARCH_WANT_HUGE_PMD_SHARE if 64BIT @@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB config ARCH_SUPPORTS_UPROBES def_bool y -config SYS_SUPPORTS_HUGETLBFS - depends on MMU - def_bool y - config STACKTRACE_SUPPORT def_bool y --- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/arch/sh/Kconfig @@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION bool select ARCH_SUSPEND_POSSIBLE -config SYS_SUPPORTS_HUGETLBFS - bool - config SYS_SUPPORTS_SMP bool @@ -175,12 +172,12 @@ config CPU_SH3 config CPU_SH4 bool + select ARCH_SUPPORTS_HUGETLBFS if MMU select CPU_HAS_INTEVT select CPU_HAS_SR_RB select CPU_HAS_FPU if !CPU_SH4AL_DSP select SH_INTC select SYS_SUPPORTS_SH_TMU - select SYS_SUPPORTS_HUGETLBFS if MMU config CPU_SH4A bool --- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs +++ a/fs/Kconfig @@ -223,10 +223,13 @@ config TMPFS_INODE64 If unsure, say N. +config ARCH_SUPPORTS_HUGETLBFS + def_bool n + config HUGETLBFS bool "HugeTLB file system support" depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \ - SYS_SUPPORTS_HUGETLBFS || BROKEN + ARCH_SUPPORTS_HUGETLBFS || BROKEN help hugetlbfs is a filesystem backing for HugeTLB pages, based on ramfs. For architectures that support it, say Y here and read _ ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-05-05 17:44 ` incoming Andrew Morton @ 2021-05-06 3:19 ` Anshuman Khandual 0 siblings, 0 replies; 389+ messages in thread From: Anshuman Khandual @ 2021-05-06 3:19 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits On 5/5/21 11:14 PM, Andrew Morton wrote: > On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > >> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote: >>> Let me resend right now with the same in-reply-to. Hopefully they will >>> land in the correct place. >> Well, you re-sent it twice, and I have three copies in my own mailbox, >> bot they still don't show up on the mm-commits mailing list. >> >> So the list hates them for some odd reason. >> >> I've picked them up locally, but adding Konstantin to the participants >> to see if he can see what's up. >> >> Konstantin: patches 103/106/107 are missing on lore out of Andrew's >> series of 143. Odd. > It's weird. They don't turn up on linux-mm either, and that's running > at kvack.org, also majordomo. They don't get through when sent with > either heirloom-mailx or with sylpheed. > > Also, it seems that when Anshuman originally sent the patch, linux-mm > and linux-kernel didn't send it back out. So perhaps a spam filter > triggered? > > I'm seeing > > https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/ > > which is via linux-arm-kernel@lists.infradead.org but the linux-kernel > server massacred that patch series. Searching > https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7 > email series. Yeah these patches faced problem from the very beginning getting into the MM/LKML list for some strange reason. ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-04-30 5:52 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-04-30 5:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few misc subsystems and some of MM. 178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0. Subsystems affected by this patch series: ia64 kbuild scripts sh ocfs2 kfifo vfs kernel/watchdog mm/slab-generic mm/slub mm/kmemleak mm/debug mm/pagecache mm/msync mm/gup mm/memremap mm/memcg mm/pagemap mm/mremap mm/dma mm/sparsemem mm/vmalloc mm/documentation mm/kasan mm/initialization mm/pagealloc mm/memory-failure Subsystem: ia64 Zhang Yunkai <zhang.yunkai@zte.com.cn>: arch/ia64/kernel/head.S: remove duplicate include Bhaskar Chowdhury <unixbhaskar@gmail.com>: arch/ia64/kernel/fsys.S: fix typos arch/ia64/include/asm/pgtable.h: minor typo fixes Valentin Schneider <valentin.schneider@arm.com>: ia64: ensure proper NUMA distance and possible map initialization Sergei Trofimovich <slyfox@gentoo.org>: ia64: drop unused IA64_FW_EMU ifdef ia64: simplify code flow around swiotlb init Bhaskar Chowdhury <unixbhaskar@gmail.com>: ia64: trivial spelling fixes Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix EFI_DEBUG build ia64: mca: always make IA64_MCA_DEBUG an expression ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP ia64: module: fix symbolizer crash on fdescr Subsystem: kbuild Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*() Subsystem: scripts Tom Saeger <tom.saeger@oracle.com>: scripts/spelling.txt: add entries for recent discoveries Wan Jiabing <wanjiabing@vivo.com>: scripts: a new script for checking duplicate struct declaration Subsystem: sh Zhang Yunkai <zhang.yunkai@zte.com.cn>: arch/sh/include/asm/tlb.h: remove duplicate include Subsystem: ocfs2 Yang Li <yang.lee@linux.alibaba.com>: ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: map flags directly in flags_to_o2dlm() Bhaskar Chowdhury <unixbhaskar@gmail.com>: ocfs2: fix a typo Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: ocfs2/dlm: remove unused function Subsystem: kfifo Dan Carpenter <dan.carpenter@oracle.com>: kfifo: fix ternary sign extension bugs Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: vfs: fs_parser: clean up kernel-doc warnings Subsystem: kernel/watchdog Petr Mladek <pmladek@suse.com>: Patch series "watchdog/softlockup: Report overall time and some cleanup", v2: watchdog: rename __touch_watchdog() to a better descriptive name watchdog: explicitly update timestamp when reporting softlockup watchdog/softlockup: report the overall time of softlockups watchdog/softlockup: remove logic that tried to prevent repeated reports watchdog: fix barriers when printing backtraces from all CPUs watchdog: cleanup handling of false positives Subsystem: mm/slab-generic Rafael Aquini <aquini@redhat.com>: mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: enable slub_debug static key when creating cache with explicit debug flags Oliver Glitta <glittao@gmail.com>: kunit: add a KUnit test for SLUB debugging functionality slub: remove resiliency_test() function Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/slub.c: trivial typo fixes Subsystem: mm/kmemleak Bhaskar Chowdhury <unixbhaskar@gmail.com>: mm/kmemleak.c: fix a typo Subsystem: mm/debug Georgi Djakov <georgi.djakov@linaro.org>: mm/page_owner: record the timestamp of all pages during free zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>: mm, page_owner: remove unused parameter in __set_page_owner_handle Sergei Trofimovich <slyfox@gentoo.org>: mm: page_owner: fetch backtrace only for tracked pages mm: page_owner: use kstrtobool() to parse bool option mm: page_owner: detect page_owner recursion via task_struct mm: page_poison: print page info when corruption is caught Anshuman Khandual <anshuman.khandual@arm.com>: mm/memtest: add ARCH_USE_MEMTEST Subsystem: mm/pagecache Jens Axboe <axboe@kernel.dk>: Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3: mm: provide filemap_range_needs_writeback() helper mm: use filemap_range_needs_writeback() for O_DIRECT reads iomap: use filemap_range_needs_writeback() for O_DIRECT reads "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap: use filemap_read_page in filemap_fault mm/filemap: drop check for truncated page after I/O Johannes Weiner <hannes@cmpxchg.org>: mm: page-writeback: simplify memcg handling in test_clear_page_writeback() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: move page_mapping_file to pagemap.h Rui Sun <sunrui26@huawei.com>: mm/filemap: update stale comment Subsystem: mm/msync Nikita Ermakov <sh1r4s3@mail.si-head.nl>: mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start Subsystem: mm/gup Joao Martins <joao.m.martins@oracle.com>: Patch series "mm/gup: page unpining improvements", v4: mm/gup: add compound page list iterator mm/gup: decrement head page once for group of subpages mm/gup: add a range variant of unpin_user_pages_dirty_lock() RDMA/umem: batch page unpin in __ib_umem_release() Yang Shi <shy828301@gmail.com>: mm: gup: remove FOLL_SPLIT Subsystem: mm/memremap Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/memremap.c: fix improper SPDX comment style Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix kernel stack account Shakeel Butt <shakeelb@google.com>: memcg: cleanup root memcg checks memcg: enable memcg oom-kill for __GFP_NOFAIL Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: switch to rstat", v3: mm: memcontrol: fix cpuhotplug statistics flushing mm: memcontrol: kill mem_cgroup_nodeinfo() mm: memcontrol: privatize memcg_page_state query functions cgroup: rstat: support cgroup1 cgroup: rstat: punt root-level optimization to individual controllers mm: memcontrol: switch to rstat mm: memcontrol: consolidate lruvec stat flushing kselftests: cgroup: update kmem test for new vmstat implementation Shakeel Butt <shakeelb@google.com>: memcg: charge before adding to swapcache on swapin Muchun Song <songmuchun@bytedance.com>: Patch series "Use obj_cgroup APIs to charge kmem pages", v5: mm: memcontrol: slab: fix obtain a reference to a freeing memcg mm: memcontrol: introduce obj_cgroup_{un}charge_pages mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c mm: memcontrol: change ug->dummy_page only if memcg changed mm: memcontrol: use obj_cgroup APIs to charge kmem pages mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages() mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM Wan Jiabing <wanjiabing@vivo.com>: linux/memcontrol.h: remove duplicate struct declaration Johannes Weiner <hannes@cmpxchg.org>: mm: page_counter: mitigate consequences of a page_counter underflow Subsystem: mm/pagemap Wang Qing <wangqing@vivo.com>: mm/memory.c: do_numa_page(): delete bool "migrated" Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/interval_tree: add comments to improve code readability Oscar Salvador <osalvador@suse.de>: Patch series "Cleanup and fixups for vmemmap handling", v6: x86/vmemmap: drop handling of 4K unaligned vmemmap range x86/vmemmap: drop handling of 1GB vmemmap ranges x86/vmemmap: handle unpopulated sub-pmd ranges x86/vmemmap: optimize for consecutive sections in partial populated PMDs Ovidiu Panait <ovidiu.panait@windriver.com>: mm, tracing: improve rss_stat tracepoint message Christoph Hellwig <hch@lst.de>: Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2: mm: add remap_pfn_range_notrack mm: add a io_mapping_map_user helper i915: use io_mapping_map_user i915: fix remap_io_sg to verify the pgprot Huang Ying <ying.huang@intel.com>: NUMA balancing: reduce TLB flush via delaying mapping on hint page fault Subsystem: mm/mremap Brian Geffon <bgeffon@google.com>: Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5: mm: extend MREMAP_DONTUNMAP to non-anonymous mappings Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio" selftests: add a MREMAP_DONTUNMAP selftest for shmem Subsystem: mm/dma Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/dmapool: switch from strlcpy to strscpy Subsystem: mm/sparsemem Wang Wensheng <wangwensheng4@huawei.com>: mm/sparse: add the missing sparse_buffer_fini() in error branch Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "remap_vmalloc_range cleanups": samples/vfio-mdev/mdpy: use remap_vmalloc_range mm: unexport remap_vmalloc_range_partial Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>: mm/vmalloc: use rb_tree instead of list for vread() lookups Nicholas Piggin <npiggin@gmail.com>: Patch series "huge vmalloc mappings", v13: ARM: mm: add missing pud_page define to 2-level page tables mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page mm: apply_to_pte_range warn and fail if a large pte is encountered mm/vmalloc: rename vmap_*_range vmap_pages_*_range mm/ioremap: rename ioremap_*_range to vmap_*_range mm: HUGE_VMAP arch support cleanup powerpc: inline huge vmap supported functions arm64: inline huge vmap supported functions x86: inline huge vmap supported functions mm/vmalloc: provide fallback arch huge vmap support functions mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c mm/vmalloc: add vmap_range_noflush variant mm/vmalloc: hugepage vmalloc mappings Patch series "mm/vmalloc: cleanup after hugepage series", v2: mm/vmalloc: remove map_kernel_range kernel/dma: remove unnecessary unmap_kernel_range powerpc/xive: remove unnecessary unmap_kernel_range mm/vmalloc: remove unmap_kernel_range mm/vmalloc: improve allocation failure error messages Vijayanand Jitta <vjitta@codeaurora.org>: mm: vmalloc: prevent use after free in _vm_unmap_aliases "Uladzislau Rezki (Sony)" <urezki@gmail.com>: lib/test_vmalloc.c: remove two kvfree_rcu() tests lib/test_vmalloc.c: add a new 'nr_threads' parameter vm/test_vmalloc.sh: adapt for updated driver interface mm/vmalloc: refactor the preloading loagic mm/vmalloc: remove an empty line Subsystem: mm/documentation "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/doc: fix fault_flag_allow_retry_first kerneldoc mm/doc: fix page_maybe_dma_pinned kerneldoc mm/doc: turn fault flags into an enum mm/doc: add mm.h and mm_types.h to the mm-api document Lukas Bulwahn <lukas.bulwahn@gmail.com>: Patch series "kernel-doc and MAINTAINERS clean-up": MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT pagewalk: prefix struct kernel-doc descriptions Subsystem: mm/kasan Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/kasan: switch from strlcpy to strscpy Peter Collingbourne <pcc@google.com>: kasan: fix kasan_byte_accessible() to be consistent with actual checks Andrey Konovalov <andreyknvl@google.com>: kasan: initialize shadow to TAG_INVALID for SW_TAGS mm, kasan: don't poison boot memory with tag-based modes Patch series "kasan: integrate with init_on_alloc/free", v3: arm64: kasan: allow to init memory when setting tags kasan: init memory in kasan_(un)poison for HW_TAGS kasan, mm: integrate page_alloc init with HW_TAGS kasan, mm: integrate slab init_on_alloc with HW_TAGS kasan, mm: integrate slab init_on_free with HW_TAGS kasan: docs: clean up sections kasan: docs: update overview section kasan: docs: update usage section kasan: docs: update error reports section kasan: docs: update boot parameters section kasan: docs: update GENERIC implementation details section kasan: docs: update SW_TAGS implementation details section kasan: docs: update HW_TAGS implementation details section kasan: docs: update shadow memory section kasan: docs: update ignoring accesses section kasan: docs: update tests section Walter Wu <walter-zh.wu@mediatek.com>: kasan: record task_work_add() call stack Andrey Konovalov <andreyknvl@google.com>: kasan: detect false-positives in tests Zqiang <qiang.zhang@windriver.com>: irq_work: record irq_work_queue() call stack Subsystem: mm/initialization Kefeng Wang <wangkefeng.wang@huawei.com>: mm: move mem_init_print_info() into mm_init() Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range() Minchan Kim <minchan@kernel.org>: mm: remove lru_add_drain_all in alloc_contig_range Yu Zhao <yuzhao@google.com>: include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH include/linux/page-flags-layout.h: cleanups "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Rationalise __alloc_pages wrappers", v3: mm/page_alloc: rename alloc_mask to alloc_gfp mm/page_alloc: rename gfp_mask to gfp mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask mm/mempolicy: rename alloc_pages_current to alloc_pages mm/mempolicy: rewrite alloc_pages documentation mm/mempolicy: rewrite alloc_pages_vma documentation mm/mempolicy: fix mpol_misplaced kernel-doc Minchan Kim <minchan@kernel.org>: mm: page_alloc: dump migrate-failed pages Geert Uytterhoeven <geert@linux-m68k.org>: mm/Kconfig: remove default DISCONTIGMEM_MANUAL Kefeng Wang <wangkefeng.wang@huawei.com>: mm, page_alloc: avoid page_to_pfn() in move_freepages() zhouchuangao <zhouchuangao@vivo.com>: mm/page_alloc: duplicate include linux/vmalloc.h Mel Gorman <mgorman@techsingularity.net>: Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6: mm/page_alloc: rename alloced to allocated mm/page_alloc: add a bulk page allocator mm/page_alloc: add an array-based interface to the bulk page allocator Jesper Dangaard Brouer <brouer@redhat.com>: mm/page_alloc: optimize code layout for __alloc_pages_bulk mm/page_alloc: inline __rmqueue_pcplist Chuck Lever <chuck.lever@oracle.com>: Patch series "SUNRPC consumer for the bulk page allocator": SUNRPC: set rq_page_end differently SUNRPC: refresh rq_pages using a bulk page allocator Jesper Dangaard Brouer <brouer@redhat.com>: net: page_pool: refactor dma_map into own function page_pool_dma_map net: page_pool: use alloc_pages_bulk in refill code path Sergei Trofimovich <slyfox@gentoo.org>: mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1 huxiang <huxiang@uniontech.com>: mm/page_alloc: redundant definition variables of pfn in for loop Mike Rapoport <rppt@linux.ibm.com>: mm/mmzone.h: fix existing kernel-doc comments and link them to core-api Subsystem: mm/memory-failure Jane Chu <jane.chu@oracle.com>: mm/memory-failure: unnecessary amount of unmapping Documentation/admin-guide/kernel-parameters.txt | 7 Documentation/admin-guide/mm/transhuge.rst | 2 Documentation/core-api/cachetlb.rst | 4 Documentation/core-api/mm-api.rst | 6 Documentation/dev-tools/kasan.rst | 355 +++++----- Documentation/vm/page_owner.rst | 2 Documentation/vm/transhuge.rst | 5 MAINTAINERS | 1 arch/Kconfig | 11 arch/alpha/mm/init.c | 1 arch/arc/mm/init.c | 1 arch/arm/Kconfig | 1 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/include/asm/pgtable.h | 3 arch/arm/mm/copypage-v4mc.c | 1 arch/arm/mm/copypage-v6.c | 1 arch/arm/mm/copypage-xscale.c | 1 arch/arm/mm/init.c | 2 arch/arm64/Kconfig | 1 arch/arm64/include/asm/memory.h | 4 arch/arm64/include/asm/mte-kasan.h | 39 - arch/arm64/include/asm/vmalloc.h | 38 - arch/arm64/mm/init.c | 4 arch/arm64/mm/mmu.c | 36 - arch/csky/abiv1/cacheflush.c | 1 arch/csky/mm/init.c | 1 arch/h8300/mm/init.c | 2 arch/hexagon/mm/init.c | 1 arch/ia64/Kconfig | 23 arch/ia64/configs/bigsur_defconfig | 1 arch/ia64/include/asm/meminit.h | 11 arch/ia64/include/asm/module.h | 6 arch/ia64/include/asm/page.h | 25 arch/ia64/include/asm/pgtable.h | 7 arch/ia64/kernel/Makefile | 2 arch/ia64/kernel/acpi.c | 7 arch/ia64/kernel/efi.c | 11 arch/ia64/kernel/fsys.S | 4 arch/ia64/kernel/head.S | 6 arch/ia64/kernel/ia64_ksyms.c | 12 arch/ia64/kernel/machine_kexec.c | 2 arch/ia64/kernel/mca.c | 4 arch/ia64/kernel/module.c | 29 arch/ia64/kernel/pal.S | 6 arch/ia64/mm/Makefile | 1 arch/ia64/mm/contig.c | 4 arch/ia64/mm/discontig.c | 21 arch/ia64/mm/fault.c | 15 arch/ia64/mm/init.c | 221 ------ arch/m68k/mm/init.c | 1 arch/microblaze/mm/init.c | 1 arch/mips/Kconfig | 1 arch/mips/loongson64/numa.c | 1 arch/mips/mm/cache.c | 1 arch/mips/mm/init.c | 1 arch/mips/sgi-ip27/ip27-memory.c | 1 arch/nds32/mm/init.c | 1 arch/nios2/mm/cacheflush.c | 1 arch/nios2/mm/init.c | 1 arch/openrisc/mm/init.c | 2 arch/parisc/mm/init.c | 2 arch/powerpc/Kconfig | 1 arch/powerpc/include/asm/vmalloc.h | 34 - arch/powerpc/kernel/isa-bridge.c | 4 arch/powerpc/kernel/pci_64.c | 2 arch/powerpc/mm/book3s64/radix_pgtable.c | 29 arch/powerpc/mm/ioremap.c | 2 arch/powerpc/mm/mem.c | 1 arch/powerpc/sysdev/xive/common.c | 4 arch/riscv/mm/init.c | 1 arch/s390/mm/init.c | 2 arch/sh/include/asm/tlb.h | 10 arch/sh/mm/cache-sh4.c | 1 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/init.c | 1 arch/sparc/include/asm/pgtable_32.h | 3 arch/sparc/mm/init_32.c | 2 arch/sparc/mm/init_64.c | 1 arch/sparc/mm/tlb.c | 1 arch/um/kernel/mem.c | 1 arch/x86/Kconfig | 1 arch/x86/include/asm/vmalloc.h | 42 - arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2 arch/x86/mm/init_32.c | 2 arch/x86/mm/init_64.c | 222 ++++-- arch/x86/mm/ioremap.c | 33 arch/x86/mm/pgtable.c | 13 arch/xtensa/Kconfig | 1 arch/xtensa/mm/init.c | 1 block/blk-cgroup.c | 17 drivers/gpu/drm/i915/Kconfig | 1 drivers/gpu/drm/i915/gem/i915_gem_mman.c | 9 drivers/gpu/drm/i915/i915_drv.h | 3 drivers/gpu/drm/i915/i915_mm.c | 117 --- drivers/infiniband/core/umem.c | 12 drivers/pci/pci.c | 2 fs/aio.c | 5 fs/fs_parser.c | 2 fs/iomap/direct-io.c | 24 fs/ocfs2/blockcheck.c | 2 fs/ocfs2/dlm/dlmrecovery.c | 7 fs/ocfs2/stack_o2cb.c | 36 - fs/ocfs2/stackglue.c | 2 include/linux/compiler-gcc.h | 8 include/linux/fs.h | 2 include/linux/gfp.h | 45 - include/linux/io-mapping.h | 3 include/linux/io.h | 9 include/linux/kasan.h | 51 + include/linux/memcontrol.h | 271 ++++---- include/linux/mm.h | 50 - include/linux/mmzone.h | 43 - include/linux/page-flags-layout.h | 64 - include/linux/pagemap.h | 10 include/linux/pagewalk.h | 4 include/linux/sched.h | 4 include/linux/slab.h | 2 include/linux/slub_def.h | 2 include/linux/vmalloc.h | 73 +- include/linux/vmstat.h | 24 include/net/page_pool.h | 2 include/trace/events/kmem.h | 24 init/main.c | 2 kernel/cgroup/cgroup.c | 34 - kernel/cgroup/rstat.c | 61 + kernel/dma/remap.c | 1 kernel/fork.c | 13 kernel/irq_work.c | 7 kernel/task_work.c | 3 kernel/watchdog.c | 102 +-- lib/Kconfig.debug | 14 lib/Makefile | 1 lib/test_kasan.c | 59 - lib/test_slub.c | 124 +++ lib/test_vmalloc.c | 128 +-- mm/Kconfig | 4 mm/Makefile | 1 mm/debug_vm_pgtable.c | 4 mm/dmapool.c | 2 mm/filemap.c | 61 + mm/gup.c | 145 +++- mm/hugetlb.c | 2 mm/internal.h | 25 mm/interval_tree.c | 2 mm/io-mapping.c | 29 mm/ioremap.c | 361 ++-------- mm/kasan/common.c | 53 - mm/kasan/generic.c | 12 mm/kasan/kasan.h | 28 mm/kasan/report_generic.c | 2 mm/kasan/shadow.c | 10 mm/kasan/sw_tags.c | 12 mm/kmemleak.c | 2 mm/memcontrol.c | 798 ++++++++++++------------ mm/memory-failure.c | 2 mm/memory.c | 191 +++-- mm/mempolicy.c | 78 -- mm/mempool.c | 4 mm/memremap.c | 2 mm/migrate.c | 2 mm/mm_init.c | 4 mm/mmap.c | 6 mm/mremap.c | 6 mm/msync.c | 6 mm/page-writeback.c | 9 mm/page_alloc.c | 430 +++++++++--- mm/page_counter.c | 8 mm/page_owner.c | 68 -- mm/page_poison.c | 6 mm/percpu-vm.c | 7 mm/slab.c | 43 - mm/slab.h | 24 mm/slab_common.c | 10 mm/slub.c | 215 ++---- mm/sparse.c | 1 mm/swap_state.c | 13 mm/util.c | 10 mm/vmalloc.c | 728 ++++++++++++++++----- net/core/page_pool.c | 127 ++- net/sunrpc/svc_xprt.c | 38 - samples/kfifo/bytestream-example.c | 8 samples/kfifo/inttype-example.c | 8 samples/kfifo/record-example.c | 8 samples/vfio-mdev/mdpy.c | 4 scripts/checkdeclares.pl | 53 + scripts/spelling.txt | 26 tools/testing/selftests/cgroup/test_kmem.c | 22 tools/testing/selftests/vm/mremap_dontunmap.c | 52 + tools/testing/selftests/vm/test_vmalloc.sh | 21 189 files changed, 3642 insertions(+), 3013 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-04-23 21:28 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966. Subsystems affected by this patch series: coda overlayfs mm/pagecache mm/memcg Subsystem: coda Christian König <christian.koenig@amd.com>: coda: fix reference counting in coda_file_mmap error path Subsystem: overlayfs Christian König <christian.koenig@amd.com>: ovl: fix reference counting in ovl_mmap error path Subsystem: mm/pagecache Hugh Dickins <hughd@google.com>: mm/filemap: fix find_lock_entries hang on 32-bit THP mm/filemap: fix mapping_seek_hole_data on THP & 32-bit Subsystem: mm/memcg Vasily Averin <vvs@virtuozzo.com>: tools/cgroup/slabinfo.py: updated to work on current kernel fs/coda/file.c | 6 +++--- fs/overlayfs/file.c | 11 +---------- mm/filemap.c | 31 +++++++++++++++++++------------ tools/cgroup/memcg_slabinfo.py | 8 ++++---- 4 files changed, 27 insertions(+), 29 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-04-16 22:45 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7. Subsystems affected by this patch series: mm/documentation mm/kasan csky ia64 mm/pagemap gcov lib Subsystem: mm/documentation Randy Dunlap <rdunlap@infradead.org>: mm: eliminate "expecting prototype" kernel-doc warnings Subsystem: mm/kasan Arnd Bergmann <arnd@arndb.de>: kasan: fix hwasan build for gcc Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: csky Randy Dunlap <rdunlap@infradead.org>: csky: change a Kconfig symbol name to fix e1000 build error Subsystem: ia64 Randy Dunlap <rdunlap@infradead.org>: ia64: remove duplicate entries in generic_defconfig ia64: fix discontig.c section mismatches John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>: ia64: tools: remove inclusion of ia64-specific version of errno.h header John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>: ia64: tools: remove duplicate definition of ia64_mf() on ia64 Subsystem: mm/pagemap Zack Rusin <zackr@vmware.com>: mm/mapping_dirty_helpers: guard hugepage pud's usage Christophe Leroy <christophe.leroy@csgroup.eu>: mm: ptdump: fix build failure Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: gcov: clang: fix clang-11+ build Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: remove "expecting prototype" kernel-doc warnings arch/arm64/kernel/sleep.S | 2 +- arch/csky/Kconfig | 2 +- arch/csky/include/asm/page.h | 2 +- arch/ia64/configs/generic_defconfig | 2 -- arch/ia64/mm/discontig.c | 6 +++--- arch/x86/kernel/acpi/wakeup_64.S | 2 +- include/linux/kasan.h | 2 +- kernel/gcov/clang.c | 2 +- lib/Kconfig.kasan | 9 ++------- lib/earlycpio.c | 4 ++-- lib/lru_cache.c | 3 ++- lib/parman.c | 4 ++-- lib/radix-tree.c | 11 ++++++----- mm/kasan/common.c | 2 +- mm/kasan/kasan.h | 2 +- mm/kasan/report_generic.c | 2 +- mm/mapping_dirty_helpers.c | 2 ++ mm/mmu_gather.c | 29 +++++++++++++++++++---------- mm/oom_kill.c | 2 +- mm/ptdump.c | 2 +- mm/shuffle.c | 4 ++-- scripts/Makefile.kasan | 22 ++++++++++++++-------- security/Kconfig.hardening | 4 ++-- tools/arch/ia64/include/asm/barrier.h | 3 --- tools/include/uapi/asm/errno.h | 2 -- 25 files changed, 67 insertions(+), 60 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-04-09 20:26 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9. Subsystems affected by this patch series: MAINTAINERS mailmap mm/kasan mm/gup nds32 gcov ocfs2 ia64 mm/pagecache mm/kasan mm/kfence lib Subsystem: MAINTAINERS Marek Behún <kabel@kernel.org>: MAINTAINERS: update CZ.NIC's Turris information treewide: change my e-mail address, fix my name Subsystem: mailmap Jordan Crouse <jordan@cosmicpenguin.net>: mailmap: update email address for Jordan Crouse Matthew Wilcox <willy@infradead.org>: .mailmap: fix old email addresses Subsystem: mm/kasan Arnd Bergmann <arnd@arndb.de>: kasan: fix hwasan build for gcc Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: mm/gup Aili Yao <yaoaili@kingsoft.com>: mm/gup: check page posion status for coredump. Subsystem: nds32 Mike Rapoport <rppt@linux.ibm.com>: nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: re-fix clang-11+ support Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: fix deadlock between setattr and dio_end_io_write Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix user_stack_pointer() for ptrace() Subsystem: mm/pagecache Jack Qiu <jack.qiu@huawei.com>: fs: direct-io: fix missing sdio->boundary Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix conflict with page poisoning Andrew Morton <akpm@linux-foundation.org>: lib/test_kasan_module.c: suppress unused var warning Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence, x86: fix preemptible warning on KPTI-enabled systems Subsystem: lib Julian Braha <julianbraha@gmail.com>: lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS .mailmap | 7 ++ Documentation/ABI/testing/debugfs-moxtet | 4 - Documentation/ABI/testing/debugfs-turris-mox-rwtm | 2 Documentation/ABI/testing/sysfs-bus-moxtet-devices | 6 +- Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia | 2 Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm | 10 +-- Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml | 2 MAINTAINERS | 13 +++- arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts | 2 arch/arm64/kernel/sleep.S | 2 arch/ia64/include/asm/ptrace.h | 8 -- arch/nds32/mm/cacheflush.c | 2 arch/x86/include/asm/kfence.h | 7 ++ arch/x86/kernel/acpi/wakeup_64.S | 2 drivers/bus/moxtet.c | 4 - drivers/firmware/turris-mox-rwtm.c | 4 - drivers/gpio/gpio-moxtet.c | 4 - drivers/leds/leds-turris-omnia.c | 4 - drivers/mailbox/armada-37xx-rwtm-mailbox.c | 4 - drivers/watchdog/armada_37xx_wdt.c | 4 - fs/direct-io.c | 5 + fs/ocfs2/aops.c | 11 --- fs/ocfs2/file.c | 8 ++ include/dt-bindings/bus/moxtet.h | 2 include/linux/armada-37xx-rwtm-mailbox.h | 2 include/linux/kasan.h | 2 include/linux/moxtet.h | 2 kernel/gcov/clang.c | 29 ++++++---- lib/Kconfig.debug | 6 +- lib/Kconfig.kasan | 9 --- lib/test_kasan_module.c | 2 mm/gup.c | 4 + mm/internal.h | 20 ++++++ mm/kasan/common.c | 2 mm/kasan/kasan.h | 2 mm/kasan/report_generic.c | 2 mm/page_poison.c | 4 + scripts/Makefile.kasan | 18 ++++-- security/Kconfig.hardening | 4 - 39 files changed, 136 insertions(+), 91 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-03-25 4:36 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-03-25 4:36 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc. Subsystems affected by this patch series: mm/hugetlb mm/kasan mm/gup mm/selftests mm/z3fold squashfs ia64 gcov mm/kfence mm/memblock mm/highmem mailmap Subsystem: mm/hugetlb Miaohe Lin <linmiaohe@huawei.com>: hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix per-page tags for non-page_alloc pages Subsystem: mm/gup Sean Christopherson <seanjc@google.com>: mm/mmu_notifiers: ensure range_end() is paired with range_start() Subsystem: mm/selftests Rong Chen <rong.a.chen@intel.com>: selftests/vm: fix out-of-tree build Subsystem: mm/z3fold Thomas Hebb <tommyhebb@gmail.com>: z3fold: prevent reclaim/free race for headless pages Subsystem: squashfs Sean Nyekjaer <sean@geanix.com>: squashfs: fix inode lookup sanity checks Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix xattr id and id lookup sanity checks Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: mca: allocate early mca with GFP_ATOMIC ia64: fix format strings for err_inject Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: fix clang-11+ support Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: make compatible with kmemleak Subsystem: mm/memblock Mike Rapoport <rppt@linux.ibm.com>: mm: memblock: fix section mismatch warning again Subsystem: mm/highmem Ira Weiny <ira.weiny@intel.com>: mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP Subsystem: mailmap Andrey Konovalov <andreyknvl@google.com>: mailmap: update Andrey Konovalov's email address .mailmap | 1 arch/ia64/kernel/err_inject.c | 22 +++++------ arch/ia64/kernel/mca.c | 2 - fs/squashfs/export.c | 8 +++- fs/squashfs/id.c | 6 ++- fs/squashfs/squashfs_fs.h | 1 fs/squashfs/xattr_id.c | 6 ++- include/linux/hugetlb_cgroup.h | 15 ++++++- include/linux/memblock.h | 4 +- include/linux/mm.h | 18 +++++++-- include/linux/mmu_notifier.h | 10 ++--- kernel/gcov/clang.c | 69 ++++++++++++++++++++++++++++++++++++ mm/highmem.c | 4 +- mm/hugetlb.c | 41 +++++++++++++++++++-- mm/hugetlb_cgroup.c | 10 ++++- mm/kfence/core.c | 9 ++++ mm/kmemleak.c | 3 + mm/mmu_notifier.c | 23 ++++++++++++ mm/z3fold.c | 16 +++++++- tools/testing/selftests/vm/Makefile | 4 +- 20 files changed, 230 insertions(+), 42 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-03-13 5:06 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-03-13 5:06 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50. Subsystems affected by this patch series: mm/memblock core-kernel kconfig mm/pagealloc fork mm/hugetlb mm/highmem binfmt MAINTAINERS kbuild mm/kfence mm/oom-kill mm/madvise mm/kasan mm/userfaultfd mm/memory-failure ia64 mm/memcg mm/zram Subsystem: mm/memblock Arnd Bergmann <arnd@arndb.de>: memblock: fix section mismatch warning Subsystem: core-kernel Arnd Bergmann <arnd@arndb.de>: stop_machine: mark helpers __always_inline Subsystem: kconfig Masahiro Yamada <masahiroy@kernel.org>: init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: mm/page_alloc.c: refactor initialization of struct page for holes in memory layout Subsystem: fork Fenghua Yu <fenghua.yu@intel.com>: mm/fork: clear PASID for new mm Subsystem: mm/hugetlb Peter Xu <peterx@redhat.com>: Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5: hugetlb: dedup the code to add a new file_region hugetlb: break earlier in add_reservation_in_range() when we can mm: introduce page_needs_cow_for_dma() for deciding whether cow mm: use is_cow_mapping() across tree where proper hugetlb: do early cow when page pinned on src mm Subsystem: mm/highmem OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: mm/highmem.c: fix zero_user_segments() with start > end Subsystem: binfmt Lior Ribak <liorribak@gmail.com>: binfmt_misc: fix possible deadlock in bm_register_write Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: exclude uapi directories in API/ABI section Subsystem: kbuild Arnd Bergmann <arnd@arndb.de>: linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP* Subsystem: mm/kfence Marco Elver <elver@google.com>: kfence: fix printk format for ptrdiff_t kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations kfence: fix reports if constant function prefixes exist Subsystem: mm/oom-kill "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/sched/mm.h: use rcu_dereference in in_vfork() Subsystem: mm/madvise Suren Baghdasaryan <surenb@google.com>: mm/madvise: replace ptrace attach requirement for process_madvise Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC kasan: fix KASAN_STACK dependency for HW_TAGS Subsystem: mm/userfaultfd Nadav Amit <namit@vmware.com>: mm/userfaultfd: fix memory corruption due to writeprotect Subsystem: mm/memory-failure Naoya Horiguchi <naoya.horiguchi@nec.com>: mm, hwpoison: do not lock page again when me_huge_page() successfully recovers Subsystem: ia64 Sergei Trofimovich <slyfox@gentoo.org>: ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign Subsystem: mm/memcg Zhou Guanghui <zhouguanghui1@huawei.com>: mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument mm/memcg: set memcg when splitting page Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: zram: fix return value on writeback_store zram: fix broken page writeback MAINTAINERS | 4 arch/ia64/include/asm/syscall.h | 2 arch/ia64/kernel/ptrace.c | 24 +++- drivers/block/zram/zram_drv.c | 17 +- drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c | 4 drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c | 2 fs/binfmt_misc.c | 29 ++--- fs/proc/task_mmu.c | 2 include/linux/compiler-clang.h | 6 + include/linux/memblock.h | 4 include/linux/memcontrol.h | 6 - include/linux/mm.h | 21 +++ include/linux/mm_types.h | 1 include/linux/sched/mm.h | 3 include/linux/stop_machine.h | 11 + init/Kconfig | 3 kernel/fork.c | 8 + lib/Kconfig.kasan | 1 mm/highmem.c | 17 ++ mm/huge_memory.c | 10 - mm/hugetlb.c | 123 +++++++++++++++------ mm/internal.h | 5 mm/kfence/report.c | 30 +++-- mm/madvise.c | 13 ++ mm/memcontrol.c | 15 +- mm/memory-failure.c | 4 mm/memory.c | 16 +- mm/page_alloc.c | 167 ++++++++++++++--------------- mm/slab.c | 2 29 files changed, 334 insertions(+), 216 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-02-26 1:14 Andrew Morton 2021-02-26 17:55 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-02-26 1:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - The rest of MM. Includes kfence - another runtime memory validator. Not as thorough as KASAN, but it has unmeasurable overhead and is intended to be usable in production builds. - Everything else 118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab. Subsystems affected by this patch series: mm/thp mm/cma mm/vmstat mm/memory-hotplug mm/mlock mm/rmap mm/zswap mm/zsmalloc mm/cleanups mm/kfence mm/kasan2 alpha procfs sysctl misc core-kernel MAINTAINERS lib bitops checkpatch init coredump seq_file gdb ubsan initramfs mm/pagemap2 Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Overhaul multi-page lookups for THP", v4: mm: make pagecache tagged lookups return only head pages mm/shmem: use pagevec_lookup in shmem_unlock_mapping mm/swap: optimise get_shadow_from_swap_cache mm: add FGP_ENTRY mm/filemap: rename find_get_entry to mapping_get_entry mm/filemap: add helper for finding pages mm/filemap: add mapping_seek_hole_data iomap: use mapping_seek_hole_data mm: add and use find_lock_entries mm: add an 'end' parameter to find_get_entries mm: add an 'end' parameter to pagevec_lookup_entries mm: remove nr_entries parameter from pagevec_lookup_entries mm: pass pvec directly to find_get_entries mm: remove pagevec_lookup_entries Rik van Riel <riel@surriel.com>: Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6: mm,thp,shmem: limit shmem THP alloc gfp_mask mm,thp,shm: limit gfp mask to no more than specified mm,thp,shmem: make khugepaged obey tmpfs mount flags mm,shmem,thp: limit shmem THP allocations to requested zones Subsystem: mm/cma Roman Gushchin <guro@fb.com>: mm: cma: allocate cma areas bottom-up David Hildenbrand <david@redhat.com>: mm/cma: expose all pages to the buddy if activation of an area fails mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo Patrick Daly <pdaly@codeaurora.org>: mm: cma: print region name on failure Subsystem: mm/vmstat Johannes Weiner <hannes@cmpxchg.org>: mm: vmstat: fix NOHZ wakeups for node stat changes mm: vmstat: add some comments on internal storage of byte items Jiang Biao <benbjiang@tencent.com>: mm/vmstat.c: erase latency in vmstat_shepherd Subsystem: mm/memory-hotplug Dan Williams <dan.j.williams@intel.com>: Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4: mm: move pfn_to_online_page() out of line mm: teach pfn_to_online_page() to consider subsection validity mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions mm: fix memory_failure() handling of dax-namespace metadata Anshuman Khandual <anshuman.khandual@arm.com>: mm/memory_hotplug: rename all existing 'memhp' into 'mhp' David Hildenbrand <david@redhat.com>: mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE Miaohe Lin <linmiaohe@huawei.com>: mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn David Hildenbrand <david@redhat.com>: drivers/base/memory: don't store phys_device in memory blocks Documentation: sysfs/memory: clarify some memory block device properties Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5: mm/memory_hotplug: prevalidate the address range being added with platform arm64/mm: define arch_get_mappable_range() s390/mm: define arch_get_mappable_range() David Hildenbrand <david@redhat.com>: virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug Subsystem: mm/mlock Miaohe Lin <linmiaohe@huawei.com>: mm/mlock: stop counting mlocked pages when none vma is found Subsystem: mm/rmap Miaohe Lin <linmiaohe@huawei.com>: mm/rmap: correct some obsolete comments of anon_vma mm/rmap: remove unneeded semicolon in page_not_mapped() mm/rmap: fix obsolete comment in __page_check_anon_rmap() mm/rmap: use page_not_mapped in try_to_unmap() mm/rmap: correct obsolete comment of page_get_anon_vma() mm/rmap: fix potential pte_unmap on an not mapped pte Subsystem: mm/zswap Randy Dunlap <rdunlap@infradead.org>: mm: zswap: clean up confusing comment Tian Tao <tiantao6@hisilicon.com>: Patch series "Fix the compatibility of zsmalloc and zswap": mm/zswap: add the flag can_sleep_mapped mm: set the sleep_mapped to true for zbud and z3fold Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage() Rokudo Yan <wu-yan@tcl.com>: zsmalloc: account the number of compacted pages correctly Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: use page_private() to access page->private Subsystem: mm/cleanups Guo Ren <guoren@linux.alibaba.com>: mm: page-flags.h: Typo fix (It -> If) Daniel Vetter <daniel.vetter@ffwll.ch>: mm/dmapool: use might_alloc() mm/backing-dev.c: use might_alloc() Stephen Zhang <stephenzhangzsd@gmail.com>: mm/early_ioremap.c: use __func__ instead of function name Subsystem: mm/kfence Alexander Potapenko <glider@google.com>: Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7: mm: add Kernel Electric-Fence infrastructure x86, kfence: enable KFENCE for x86 Marco Elver <elver@google.com>: arm64, kfence: enable KFENCE for ARM64 kfence: use pt_regs to generate stack trace on faults Alexander Potapenko <glider@google.com>: mm, kfence: insert KFENCE hooks for SLAB mm, kfence: insert KFENCE hooks for SLUB kfence, kasan: make KFENCE compatible with KASAN Marco Elver <elver@google.com>: kfence, Documentation: add KFENCE documentation kfence: add test suite MAINTAINERS: add entry for KFENCE kfence: report sensitive information based on no_hash_pointers Alexander Potapenko <glider@google.com>: Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3: tracing: add error_report_end trace point kfence: use error_report_end tracepoint kasan: use error_report_end tracepoint Subsystem: mm/kasan2 Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: optimizations and fixes for HW_TAGS", v4: kasan, mm: don't save alloc stacks twice kasan, mm: optimize kmalloc poisoning kasan: optimize large kmalloc poisoning kasan: clean up setting free info in kasan_slab_free kasan: unify large kfree checks kasan: rework krealloc tests kasan, mm: fail krealloc on freed objects kasan, mm: optimize krealloc poisoning kasan: ensure poisoning size alignment arm64: kasan: simplify and inline MTE functions kasan: inline HW_TAGS helper functions kasan: clarify that only first bug is reported in HW_TAGS Subsystem: alpha Randy Dunlap <rdunlap@infradead.org>: alpha: remove CONFIG_EXPERIMENTAL from defconfigs Subsystem: procfs Helge Deller <deller@gmx.de>: proc/wchan: use printk format instead of lookup_symbol_name() Josef Bacik <josef@toxicpanda.com>: proc: use kvzalloc for our kernel buffer Subsystem: sysctl Lin Feng <linf@wangsu.com>: sysctl.c: fix underflow value setting risk in vm_table Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: include/linux: remove repeated words Miguel Ojeda <ojeda@kernel.org>: treewide: Miguel has moved Subsystem: core-kernel Hubert Jasudowicz <hubert.jasudowicz@gmail.com>: groups: use flexible-array member in struct group_info groups: simplify struct group_info allocation Randy Dunlap <rdunlap@infradead.org>: kernel: delete repeated words in comments Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: add uapi directories to API/ABI section Subsystem: lib Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc.c: change return type to unsigned long for bitmap_set_ll Francis Laniel <laniel_francis@privacyrequired.com>: string.h: move fortified functions definitions in a dedicated header. Yogesh Lal <ylal@codeaurora.org>: lib: stackdepot: add support to configure STACK_HASH_SIZE Vijayanand Jitta <vjitta@codeaurora.org>: lib: stackdepot: add support to disable stack depot lib: stackdepot: fix ignoring return value warning Masahiro Yamada <masahiroy@kernel.org>: lib/cmdline: remove an unneeded local variable in next_arg() Subsystem: bitops Geert Uytterhoeven <geert+renesas@glider.be>: include/linux/bitops.h: spelling s/synomyn/synonym/ Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: improve blank line after declaration test Peng Wang <rocking@linux.alibaba.com>: checkpatch: ignore warning designated initializers using NR_CPUS Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: trivial style fixes Joe Perches <joe@perches.com>: checkpatch: prefer ftrace over function entry/exit printks checkpatch: improve TYPECAST_INT_CONSTANT test message Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add warning for avoiding .L prefix symbols in assembly files Joe Perches <joe@perches.com>: checkpatch: add kmalloc_array_node to unnecessary OOM message check Chris Down <chris@chrisdown.name>: checkpatch: don't warn about colon termination in linker scripts Song Liu <songliubraving@fb.com>: checkpatch: do not apply "initialise globals to 0" check to BPF progs Subsystem: init Masahiro Yamada <masahiroy@kernel.org>: init/version.c: remove Version_<LINUX_VERSION_CODE> symbol init: clean up early_param_on_off() macro Bhaskar Chowdhury <unixbhaskar@gmail.com>: init/Kconfig: fix a typo in CC_VERSION_TEXT help text Subsystem: coredump Ira Weiny <ira.weiny@intel.com>: fs/coredump: use kmap_local_page() Subsystem: seq_file NeilBrown <neilb@suse.de>: Patch series "Fix some seq_file users that were recently broken": seq_file: document how per-entry resources are managed. x86: fix seq_file iteration for pat/memtype.c Subsystem: gdb George Prekas <prekageo@amazon.com>: scripts/gdb: fix list_for_each Sumit Garg <sumit.garg@linaro.org>: kgdb: fix to kill breakpoints on initmem after boot Subsystem: ubsan Andrey Ryabinin <ryabinin.a.a@gmail.com>: ubsan: remove overflow checks Subsystem: initramfs Florian Fainelli <f.fainelli@gmail.com>: initramfs: panic with memory information Subsystem: mm/pagemap2 Huang Pei <huangpei@loongson.cn>: MIPS: make userspace mapping young by default .mailmap | 1 CREDITS | 9 Documentation/ABI/testing/sysfs-devices-memory | 58 - Documentation/admin-guide/auxdisplay/cfag12864b.rst | 2 Documentation/admin-guide/auxdisplay/ks0108.rst | 2 Documentation/admin-guide/kernel-parameters.txt | 6 Documentation/admin-guide/mm/memory-hotplug.rst | 20 Documentation/dev-tools/index.rst | 1 Documentation/dev-tools/kasan.rst | 8 Documentation/dev-tools/kfence.rst | 318 +++++++ Documentation/filesystems/seq_file.rst | 6 MAINTAINERS | 26 arch/alpha/configs/defconfig | 1 arch/arm64/Kconfig | 1 arch/arm64/include/asm/cache.h | 1 arch/arm64/include/asm/kasan.h | 1 arch/arm64/include/asm/kfence.h | 26 arch/arm64/include/asm/mte-def.h | 2 arch/arm64/include/asm/mte-kasan.h | 65 + arch/arm64/include/asm/mte.h | 2 arch/arm64/kernel/mte.c | 46 - arch/arm64/lib/mte.S | 16 arch/arm64/mm/fault.c | 8 arch/arm64/mm/mmu.c | 23 arch/mips/mm/cache.c | 30 arch/s390/mm/init.c | 1 arch/s390/mm/vmem.c | 14 arch/x86/Kconfig | 1 arch/x86/include/asm/kfence.h | 76 + arch/x86/mm/fault.c | 10 arch/x86/mm/pat/memtype.c | 4 drivers/auxdisplay/cfag12864b.c | 4 drivers/auxdisplay/cfag12864bfb.c | 4 drivers/auxdisplay/ks0108.c | 4 drivers/base/memory.c | 35 drivers/block/zram/zram_drv.c | 2 drivers/hv/hv_balloon.c | 2 drivers/virtio/virtio_mem.c | 43 drivers/xen/balloon.c | 2 fs/coredump.c | 4 fs/iomap/seek.c | 125 -- fs/proc/base.c | 21 fs/proc/proc_sysctl.c | 4 include/linux/bitops.h | 2 include/linux/cfag12864b.h | 2 include/linux/cred.h | 2 include/linux/fortify-string.h | 302 ++++++ include/linux/gfp.h | 2 include/linux/init.h | 4 include/linux/kasan.h | 25 include/linux/kfence.h | 230 +++++ include/linux/kgdb.h | 2 include/linux/khugepaged.h | 2 include/linux/ks0108.h | 2 include/linux/mdev.h | 2 include/linux/memory.h | 3 include/linux/memory_hotplug.h | 33 include/linux/memremap.h | 6 include/linux/mmzone.h | 49 - include/linux/page-flags.h | 4 include/linux/pagemap.h | 10 include/linux/pagevec.h | 10 include/linux/pgtable.h | 8 include/linux/ptrace.h | 2 include/linux/rmap.h | 3 include/linux/slab_def.h | 3 include/linux/slub_def.h | 3 include/linux/stackdepot.h | 9 include/linux/string.h | 282 ------ include/linux/vmstat.h | 6 include/linux/zpool.h | 3 include/linux/zsmalloc.h | 2 include/trace/events/error_report.h | 74 + include/uapi/linux/firewire-cdev.h | 2 include/uapi/linux/input.h | 2 init/Kconfig | 2 init/initramfs.c | 19 init/main.c | 6 init/version.c | 8 kernel/debug/debug_core.c | 11 kernel/events/core.c | 8 kernel/events/uprobes.c | 2 kernel/groups.c | 7 kernel/locking/rtmutex.c | 4 kernel/locking/rwsem.c | 2 kernel/locking/semaphore.c | 2 kernel/sched/fair.c | 2 kernel/sched/membarrier.c | 2 kernel/sysctl.c | 8 kernel/trace/Makefile | 1 kernel/trace/error_report-traces.c | 12 lib/Kconfig | 9 lib/Kconfig.debug | 1 lib/Kconfig.kfence | 84 + lib/Kconfig.ubsan | 17 lib/cmdline.c | 7 lib/genalloc.c | 3 lib/stackdepot.c | 41 lib/test_kasan.c | 111 ++ lib/test_ubsan.c | 49 - lib/ubsan.c | 68 - mm/Makefile | 1 mm/backing-dev.c | 3 mm/cma.c | 64 - mm/dmapool.c | 3 mm/early_ioremap.c | 12 mm/filemap.c | 361 +++++--- mm/huge_memory.c | 6 mm/internal.h | 6 mm/kasan/common.c | 213 +++- mm/kasan/generic.c | 3 mm/kasan/hw_tags.c | 2 mm/kasan/kasan.h | 97 +- mm/kasan/report.c | 8 mm/kasan/shadow.c | 78 + mm/kfence/Makefile | 6 mm/kfence/core.c | 875 +++++++++++++++++++- mm/kfence/kfence.h | 126 ++ mm/kfence/kfence_test.c | 860 +++++++++++++++++++ mm/kfence/report.c | 350 ++++++-- mm/khugepaged.c | 22 mm/memory-failure.c | 6 mm/memory.c | 4 mm/memory_hotplug.c | 178 +++- mm/memremap.c | 23 mm/mlock.c | 2 mm/page_alloc.c | 1 mm/rmap.c | 24 mm/shmem.c | 160 +-- mm/slab.c | 38 mm/slab_common.c | 29 mm/slub.c | 63 + mm/swap.c | 54 - mm/swap_state.c | 7 mm/truncate.c | 141 --- mm/vmstat.c | 35 mm/z3fold.c | 1 mm/zbud.c | 1 mm/zpool.c | 13 mm/zsmalloc.c | 22 mm/zswap.c | 57 + samples/auxdisplay/cfag12864b-example.c | 2 scripts/Makefile.ubsan | 2 scripts/checkpatch.pl | 152 ++- scripts/gdb/linux/lists.py | 5 145 files changed, 5046 insertions(+), 1682 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-02-26 1:14 incoming Andrew Morton @ 2021-02-26 17:55 ` Linus Torvalds 2021-02-26 19:16 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - The rest of MM. > > Includes kfence - another runtime memory validator. Not as > thorough as KASAN, but it has unmeasurable overhead and is intended > to be usable in production builds. > > - Everything else Just to clarify: you have nothing else really pending? I'm hoping to just do -rc1 this weekend after all - despite my late start due to loss of power for several days. I'll allow late stragglers with good reason through, but the fewer of those there are, the better, of course. Thanks, Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-02-26 17:55 ` incoming Linus Torvalds @ 2021-02-26 19:16 ` Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - The rest of MM. > > > > Includes kfence - another runtime memory validator. Not as > > thorough as KASAN, but it has unmeasurable overhead and is intended > > to be usable in production builds. > > > > - Everything else > > Just to clarify: you have nothing else really pending? Yes, that's it from me for -rc1. ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-02-24 19:58 Andrew Morton 2021-02-24 21:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few small subsystems and some of MM. 173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194. Subsystems affected by this patch series: hexagon scripts ntfs ocfs2 vfs mm/slab-generic mm/slab mm/slub mm/debug mm/pagecache mm/swap mm/memcg mm/pagemap mm/mprotect mm/mremap mm/page-reporting mm/vmalloc mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/vmscan mm/z3fold mm/compaction mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration Subsystem: hexagon Randy Dunlap <rdunlap@infradead.org>: hexagon: remove CONFIG_EXPERIMENTAL from defconfigs Subsystem: scripts tangchunyou <tangchunyou@yulong.com>: scripts/spelling.txt: increase error-prone spell checking zuoqilin <zuoqilin@yulong.com>: scripts/spelling.txt: check for "exeeds" dingsenjie <dingsenjie@yulong.com>: scripts/spelling.txt: add "allocted" and "exeeds" typo Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Randy Dunlap <rdunlap@infradead.org>: ntfs: layout.h: delete duplicated words Rustam Kovhaev <rkovhaev@gmail.com>: ntfs: check for valid standard information attribute Subsystem: ocfs2 Yi Li <yili@winhong.com>: ocfs2: remove redundant conditional before iput guozh <guozh88@chinatelecom.cn>: ocfs2: clean up some definitions which are not used any more Dan Carpenter <dan.carpenter@oracle.com>: ocfs2: fix a use after free on error Jiapeng Chong <jiapeng.chong@linux.alibaba.com>: ocfs2: simplify the calculation of variables Subsystem: vfs Randy Dunlap <rdunlap@infradead.org>: fs: delete repeated words in comments Alexey Dobriyan <adobriyan@gmail.com>: ramfs: support O_TMPFILE Subsystem: mm/slab-generic Jacob Wen <jian.w.wen@oracle.com>: mm, tracing: record slab name for kmem_cache_free() Nikolay Borisov <nborisov@suse.com>: mm/sl?b.c: remove ctor argument from kmem_cache_flags Subsystem: mm/slab Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/slab: minor coding style tweaks Subsystem: mm/slub Johannes Berg <johannes.berg@intel.com>: mm/slub: disable user tracing for kmemleak caches by default Vlastimil Babka <vbabka@suse.cz>: Patch series "mm, slab, slub: remove cpu and memory hotplug locks": mm, slub: stop freeing kmem_cache_node structures on node offline mm, slab, slub: stop taking memory hotplug lock mm, slab, slub: stop taking cpu hotplug lock mm, slub: splice cpu and page freelists in deactivate_slab() mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/slub: minor coding style tweaks Subsystem: mm/debug "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/debug: improve memcg debugging Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug_vm_pgtable: Some minor updates", v3: mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect mm/debug_vm_pgtable/basic: iterate over entire protection_map[] Miaohe Lin <linmiaohe@huawei.com>: mm/page_owner: use helper function zone_end_pfn() to get end_pfn Subsystem: mm/pagecache Baolin Wang <baolin.wang@linux.alibaba.com>: mm/filemap: remove unused parameter and change to void type for replace_page_cache_page() Pavel Begunkov <asml.silence@gmail.com>: mm/filemap: don't revert iter on -EIOCBQUEUED "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Refactor generic_file_buffered_read", v5: mm/filemap: rename generic_file_buffered_read subfunctions mm/filemap: remove dynamically allocated array from filemap_read mm/filemap: convert filemap_get_pages to take a pagevec mm/filemap: use head pages in generic_file_buffered_read mm/filemap: pass a sleep state to put_and_wait_on_page_locked mm/filemap: support readpage splitting a page mm/filemap: inline __wait_on_page_locked_async into caller mm/filemap: don't call ->readpage if IOCB_WAITQ is set mm/filemap: change filemap_read_page calling conventions mm/filemap: change filemap_create_page calling conventions mm/filemap: convert filemap_update_page to return an errno mm/filemap: move the iocb checks into filemap_update_page mm/filemap: add filemap_range_uptodate mm/filemap: split filemap_readahead out of filemap_get_pages mm/filemap: restructure filemap_get_pages mm/filemap: don't relock the page after calling readpage Christoph Hellwig <hch@lst.de>: mm/filemap: rename generic_file_buffered_read to filemap_read mm/filemap: simplify generic_file_read_iter Yang Guo <guoyang2@huawei.com>: fs/buffer.c: add checking buffer head stat before clear Baolin Wang <baolin.wang@linux.alibaba.com>: mm: backing-dev: Remove duplicated macro definition Subsystem: mm/swap Yang Li <abaci-bugfix@linux.alibaba.com>: mm/swap_slots.c: remove redundant NULL check Stephen Zhang <stephenzhangzsd@gmail.com>: mm/swapfile.c: fix debugging information problem Georgi Djakov <georgi.djakov@linaro.org>: mm/page_io: use pr_alert_ratelimited for swap read/write errors Rikard Falkeborn <rikard.falkeborn@gmail.com>: mm/swap_state: constify static struct attribute_group Yu Zhao <yuzhao@google.com>: mm/swap: don't SetPageWorkingset unconditionally during swapin Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: optimize per-lruvec stats counter memory usage Patch series "Convert all THP vmstat counters to pages", v6: mm: memcontrol: fix NR_ANON_THPS accounting in charge moving mm: memcontrol: convert NR_ANON_THPS account to pages mm: memcontrol: convert NR_FILE_THPS account to pages mm: memcontrol: convert NR_SHMEM_THPS account to pages mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages mm: memcontrol: make the slab calculation consistent Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: revise the using condition of lock_page_lruvec function series mm/memcg: remove rcu locking for lock_page_lruvec function series Shakeel Butt <shakeelb@google.com>: mm: memcg: add swapcache stat for memcg v2 Roman Gushchin <guro@fb.com>: mm: kmem: make __memcg_kmem_(un)charge static Feng Tang <feng.tang@intel.com>: mm: page_counter: re-layout structure to reduce false sharing Yang Li <abaci-bugfix@linux.alibaba.com>: mm/memcontrol: remove redundant NULL check Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: replace the loop with a list_for_each_entry() Shakeel Butt <shakeelb@google.com>: mm/list_lru.c: remove kvfree_rcu_local() Johannes Weiner <hannes@cmpxchg.org>: fs: buffer: use raw page_memcg() on locked page Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix swap undercounting in cgroup2 mm: memcontrol: fix get_active_memcg return value mm: memcontrol: fix slub memory accounting Subsystem: mm/pagemap Adrian Huang <ahuang12@lenovo.com>: mm/mmap.c: remove unnecessary local variable Miaohe Lin <linmiaohe@huawei.com>: mm/memory.c: fix potential pte_unmap_unlock pte error mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush() mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush() mm/memory.c: fix potential pte_unmap_unlock pte error Subsystem: mm/mprotect Tianjia Zhang <tianjia.zhang@linux.alibaba.com>: mm/mprotect.c: optimize error detection in do_mprotect_pkey() Subsystem: mm/mremap Li Xinhai <lixinhai.lxh@gmail.com>: mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas() mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success Subsystem: mm/page-reporting sh <sh_def@163.com>: mm/page_reporting: use list_entry_is_head() in page_reporting_cycle() Subsystem: mm/vmalloc Yang Li <abaci-bugfix@linux.alibaba.com>: vmalloc: remove redundant NULL check Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: HW_TAGS tests support and fixes", v4: kasan: prefix global functions with kasan_ kasan: clarify HW_TAGS impact on TBI kasan: clean up comments in tests kasan: add macros to simplify checking test constraints kasan: add match-all tag tests kasan, arm64: allow using KUnit tests with HW_TAGS mode kasan: rename CONFIG_TEST_KASAN_MODULE kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL kasan: adapt kmalloc_uaf2 test to HW_TAGS mode kasan: fix memory corruption in kasan_bitops_tags test kasan: move _RET_IP_ to inline wrappers kasan: fix bug detection via ksize for HW_TAGS mode kasan: add proper page allocator tests kasan: add a test for kmem_cache_alloc/free_bulk kasan: don't run tests when KASAN is not enabled Walter Wu <walter-zh.wu@mediatek.com>: kasan: remove redundant config option Subsystem: mm/pagealloc Baoquan He <bhe@redhat.com>: Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5: mm: fix prototype warning from kernel test robot mm: rename memmap_init() and memmap_init_zone() mm: simplify parater of function memmap_init_zone() mm: simplify parameter of setup_usemap() mm: remove unneeded local variable in free_area_init_core David Hildenbrand <david@redhat.com>: Patch series "mm: simplify free_highmem_page() and free_reserved_page()": video: fbdev: acornfb: remove free_unused_pages() mm: simplify free_highmem_page() and free_reserved_page() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/gfp: add kernel-doc for gfp_t Subsystem: mm/memory-failure Aili Yao <yaoaili@kingsoft.com>: mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events Subsystem: mm/hugetlb Bibo Mao <maobibo@loongson.cn>: mm/huge_memory.c: update tlb entry if pmd is changed MIPS: do not call flush_tlb_all when setting pmd entry Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix potential double free in hugetlb_register_node() error path Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb.c: fix unnecessary address expansion of pmd sharing Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call mm/hugetlb: use helper huge_page_order and pages_per_huge_page mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>: mm/hugetlb: simplify the calculation of variables Joao Martins <joao.m.martins@oracle.com>: Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2: mm/hugetlb: grab head page refcount once for group of subpages mm/hugetlb: refactor subpage recording Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix some comment typos Yanfei Xu <yanfei.xu@windriver.com>: mm/hugetlb: remove redundant check in preparing and destroying gigantic page Zhiyuan Dai <daizhiyuan@phytium.com.cn>: mm/hugetlb.c: fix typos in comments Miaohe Lin <linmiaohe@huawei.com>: mm/huge_memory.c: remove unused return value of set_huge_zero_page() "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled Miaohe Lin <linmiaohe@huawei.com>: hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup mm/hugetlb: use helper function range_in_vma() in page_table_shareable() mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage() mm/hugetlb: use helper huge_page_size() to get hugepage size Mike Kravetz <mike.kravetz@oracle.com>: hugetlb: fix update_and_free_page contig page struct assumption hugetlb: fix copy_huge_page_from_user contig page struct assumption Chen Wandun <chenwandun@huawei.com>: mm/hugetlb: suppress wrong warning info when alloc gigantic page Subsystem: mm/vmscan Alex Shi <alex.shi@linux.alibaba.com>: mm/vmscan: __isolate_lru_page_prepare() cleanup Miaohe Lin <linmiaohe@huawei.com>: mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes() Yu Zhao <yuzhao@google.com>: Patch series "mm: lru related cleanups", v2: mm/vmscan.c: use add_page_to_lru_list() include/linux/mm_inline.h: shuffle lru list addition and deletion functions mm: don't pass "enum lru_list" to lru list addition functions mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion() mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list() mm: add __clear_page_lru_flags() to replace page_off_lru() mm: VM_BUG_ON lru page flags include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller include/linux/mm_inline.h: fold __update_lru_size() into its sole caller mm/vmscan.c: make lruvec_lru_size() static Oscar Salvador <osalvador@suse.de>: mm: workingset: clarify eviction order and distance calculation Mike Kravetz <mike.kravetz@oracle.com>: Patch series "create hugetlb flags to consolidate state", v3: hugetlb: use page.private for hugetlb specific page flags hugetlb: convert page_huge_active() HPageMigratable flag hugetlb: convert PageHugeTemporary() to HPageTemporary flag hugetlb: convert PageHugeFreed to HPageFreed flag include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags hugetlb: fix uninitialized subpool pointer Dave Hansen <dave.hansen@linux.intel.com>: mm/vmscan: restore zone_reclaim_mode ABI Subsystem: mm/z3fold Miaohe Lin <linmiaohe@huawei.com>: z3fold: remove unused attribute for release_z3fold_page z3fold: simplify the zhdr initialization code in init_z3fold_page() Subsystem: mm/compaction Alex Shi <alex.shi@linux.alibaba.com>: mm/compaction: remove rcu_read_lock during page compaction Miaohe Lin <linmiaohe@huawei.com>: mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked Charan Teja Reddy <charante@codeaurora.org>: mm/compaction: correct deferral logic for proactive compaction Wonhyuk Yang <vvghjk1234@gmail.com>: mm/compaction: fix misbehaviors of fast_find_migrateblock() Vlastimil Babka <vbabka@suse.cz>: mm, compaction: make fast_isolate_freepages() stay within zone Subsystem: mm/mempolicy Huang Ying <ying.huang@intel.com>: numa balancing: migrate on fault among multiple bound nodes Miaohe Lin <linmiaohe@huawei.com>: mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk() Subsystem: mm/oom-kill Tang Yizhou <tangyizhou@huawei.com>: mm, oom: fix a comment in dump_task() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: change hugetlb_reserve_pages() to type bool hugetlbfs: remove special hugetlbfs_set_page_dirty() Miaohe Lin <linmiaohe@huawei.com>: hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr() hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs hugetlbfs: correct obsolete function name in hugetlbfs_read_iter() hugetlbfs: remove meaningless variable avoid_reserve hugetlbfs: make hugepage size conversion more readable hugetlbfs: correct some obsolete comments about inode i_mutex hugetlbfs: fix some comment typos hugetlbfs: remove unneeded return value of hugetlb_vmtruncate() Subsystem: mm/migration Chengyang Fan <cy.fan@huawei.com>: mm/migrate: remove unneeded semicolons Documentation/admin-guide/cgroup-v2.rst | 4 Documentation/admin-guide/kernel-parameters.txt | 8 Documentation/admin-guide/sysctl/vm.rst | 10 Documentation/core-api/mm-api.rst | 7 Documentation/dev-tools/kasan.rst | 24 Documentation/vm/arch_pgtable_helpers.rst | 8 arch/arm64/include/asm/memory.h | 1 arch/arm64/include/asm/mte-kasan.h | 12 arch/arm64/kernel/mte.c | 12 arch/arm64/kernel/sleep.S | 2 arch/arm64/mm/fault.c | 20 arch/hexagon/configs/comet_defconfig | 1 arch/ia64/include/asm/pgtable.h | 6 arch/ia64/mm/init.c | 18 arch/mips/mm/pgtable-32.c | 1 arch/mips/mm/pgtable-64.c | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 drivers/base/node.c | 33 drivers/video/fbdev/acornfb.c | 34 fs/block_dev.c | 2 fs/btrfs/file.c | 2 fs/buffer.c | 7 fs/dcache.c | 4 fs/direct-io.c | 4 fs/exec.c | 4 fs/fhandle.c | 2 fs/fuse/dev.c | 6 fs/hugetlbfs/inode.c | 72 -- fs/ntfs/inode.c | 6 fs/ntfs/layout.h | 4 fs/ocfs2/cluster/heartbeat.c | 8 fs/ocfs2/dlm/dlmast.c | 10 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/refcounttree.c | 2 fs/ocfs2/super.c | 2 fs/pipe.c | 2 fs/proc/meminfo.c | 10 fs/proc/vmcore.c | 7 fs/ramfs/inode.c | 13 include/linux/fs.h | 4 include/linux/gfp.h | 14 include/linux/highmem-internal.h | 5 include/linux/huge_mm.h | 15 include/linux/hugetlb.h | 98 ++ include/linux/kasan-checks.h | 6 include/linux/kasan.h | 39 - include/linux/memcontrol.h | 43 - include/linux/migrate.h | 2 include/linux/mm.h | 28 include/linux/mm_inline.h | 123 +-- include/linux/mmzone.h | 30 include/linux/page-flags.h | 6 include/linux/page_counter.h | 9 include/linux/pagemap.h | 5 include/linux/swap.h | 8 include/trace/events/kmem.h | 24 include/trace/events/pagemap.h | 11 include/uapi/linux/mempolicy.h | 4 init/Kconfig | 14 lib/Kconfig.kasan | 14 lib/Makefile | 2 lib/test_kasan.c | 446 ++++++++---- lib/test_kasan_module.c | 5 mm/backing-dev.c | 6 mm/compaction.c | 73 +- mm/debug.c | 10 mm/debug_vm_pgtable.c | 86 ++ mm/filemap.c | 859 +++++++++++------------- mm/gup.c | 5 mm/huge_memory.c | 28 mm/hugetlb.c | 376 ++++------ mm/hugetlb_cgroup.c | 6 mm/kasan/common.c | 60 - mm/kasan/generic.c | 40 - mm/kasan/hw_tags.c | 16 mm/kasan/kasan.h | 87 +- mm/kasan/quarantine.c | 22 mm/kasan/report.c | 15 mm/kasan/report_generic.c | 10 mm/kasan/report_hw_tags.c | 8 mm/kasan/report_sw_tags.c | 8 mm/kasan/shadow.c | 27 mm/kasan/sw_tags.c | 22 mm/khugepaged.c | 6 mm/list_lru.c | 12 mm/memcontrol.c | 309 ++++---- mm/memory-failure.c | 34 mm/memory.c | 24 mm/memory_hotplug.c | 11 mm/mempolicy.c | 18 mm/mempool.c | 2 mm/migrate.c | 10 mm/mlock.c | 3 mm/mmap.c | 4 mm/mprotect.c | 7 mm/mremap.c | 8 mm/oom_kill.c | 5 mm/page_alloc.c | 70 - mm/page_io.c | 12 mm/page_owner.c | 4 mm/page_reporting.c | 2 mm/pgtable-generic.c | 9 mm/rmap.c | 35 mm/shmem.c | 2 mm/slab.c | 21 mm/slab.h | 20 mm/slab_common.c | 40 - mm/slob.c | 2 mm/slub.c | 169 ++-- mm/swap.c | 54 - mm/swap_slots.c | 3 mm/swap_state.c | 31 mm/swapfile.c | 8 mm/vmscan.c | 100 +- mm/vmstat.c | 14 mm/workingset.c | 7 mm/z3fold.c | 11 scripts/Makefile.kasan | 10 scripts/spelling.txt | 30 tools/objtool/check.c | 2 120 files changed, 2249 insertions(+), 1954 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-02-24 19:58 incoming Andrew Morton @ 2021-02-24 21:30 ` Linus Torvalds 2021-02-24 21:37 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > A few small subsystems and some of MM. Hmm. I haven't bisected things yet, but I suspect it's something with the KASAN patches. With this all applied, I get: lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] and lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is larger than 2048 bytes [-Wframe-larger-than=] which is obviously not really acceptable. A 11kB stack frame _will_ cause issues. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-02-24 21:30 ` incoming Linus Torvalds @ 2021-02-24 21:37 ` Linus Torvalds 2021-02-25 8:53 ` incoming Arnd Bergmann 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw) To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Hmm. I haven't bisected things yet, but I suspect it's something with > the KASAN patches. With this all applied, I get: > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > and > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > larger than 2048 bytes [-Wframe-larger-than=] > > which is obviously not really acceptable. A 11kB stack frame _will_ > cause issues. A quick bisect shoes that this was introduced by "[patch 101/173] kasan: remove redundant config option". I didn't check what part of that patch screws up, but it's definitely doing something bad. I will drop that patch. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-02-24 21:37 ` incoming Linus Torvalds @ 2021-02-25 8:53 ` Arnd Bergmann 2021-02-25 9:12 ` incoming Andrey Ryabinin 0 siblings, 1 reply; 389+ messages in thread From: Arnd Bergmann @ 2021-02-25 8:53 UTC (permalink / raw) To: Linus Torvalds Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > the KASAN patches. With this all applied, I get: > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > and > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > larger than 2048 bytes [-Wframe-larger-than=] > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > cause issues. > > A quick bisect shoes that this was introduced by "[patch 101/173] > kasan: remove redundant config option". > > I didn't check what part of that patch screws up, but it's definitely > doing something bad. I'm not sure why that patch surfaced the bug, but it's worth pointing out that the underlying problem is asan-stack in combination with the structleak plugin. This will happen for every user of kunit. I sent a series[1] out earlier this year to turn off the structleak plugin as an alternative workaround, but need to follow up on the remaining patches. Someone suggested adding a more generic way to turn off the plugin for a file instead of open-coding the CLFAGS_REMOVE_*.o Makefile bit, which would help. I am also still hoping that someone can come up with a way to make kunit work better with the structleak plugin, as there shouldn't be a fundamental reason why it can't work, just that it the code pattern triggers a particularly bad case in the compiler. Arnd [1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/ ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-02-25 8:53 ` incoming Arnd Bergmann @ 2021-02-25 9:12 ` Andrey Ryabinin 2021-02-25 11:07 ` incoming Walter Wu 0 siblings, 1 reply; 389+ messages in thread From: Andrey Ryabinin @ 2021-02-25 9:12 UTC (permalink / raw) To: Arnd Bergmann Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote: > > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > > <torvalds@linux-foundation.org> wrote: > > > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > > the KASAN patches. With this all applied, I get: > > > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > > > and > > > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > > larger than 2048 bytes [-Wframe-larger-than=] > > > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > > cause issues. > > > > A quick bisect shoes that this was introduced by "[patch 101/173] > > kasan: remove redundant config option". > > > > I didn't check what part of that patch screws up, but it's definitely > > doing something bad. > > I'm not sure why that patch surfaced the bug, but it's worth pointing > out that the underlying problem is asan-stack in combination > with the structleak plugin. This will happen for every user of kunit. > The patch didn't update KASAN_STACK dependency in kconfig: config GCC_PLUGIN_STRUCTLEAK_BYREF .... depends on !(KASAN && KASAN_STACK=1) This 'depends on' stopped working with the patch ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-02-25 9:12 ` incoming Andrey Ryabinin @ 2021-02-25 11:07 ` Walter Wu 0 siblings, 0 replies; 389+ messages in thread From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw) To: Andrey Ryabinin Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov, Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko Hi Andrey, On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote: > On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote: > > > > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds > > <torvalds@linux-foundation.org> wrote: > > > > > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds > > > <torvalds@linux-foundation.org> wrote: > > > > > > > > Hmm. I haven't bisected things yet, but I suspect it's something with > > > > the KASAN patches. With this all applied, I get: > > > > > > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’: > > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of > > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=] > > > > > > > > and > > > > > > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’: > > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is > > > > larger than 2048 bytes [-Wframe-larger-than=] > > > > > > > > which is obviously not really acceptable. A 11kB stack frame _will_ > > > > cause issues. > > > > > > A quick bisect shoes that this was introduced by "[patch 101/173] > > > kasan: remove redundant config option". > > > > > > I didn't check what part of that patch screws up, but it's definitely > > > doing something bad. > > > > I'm not sure why that patch surfaced the bug, but it's worth pointing > > out that the underlying problem is asan-stack in combination > > with the structleak plugin. This will happen for every user of kunit. > > > > The patch didn't update KASAN_STACK dependency in kconfig: > config GCC_PLUGIN_STRUCTLEAK_BYREF > .... > depends on !(KASAN && KASAN_STACK=1) > > This 'depends on' stopped working with the patch Thanks for pointing out this problem. I will re-send that patch. Walter ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-02-13 4:52 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-02-13 4:52 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749. Subsystems affected by this patch series: mm/pagemap scripts MAINTAINERS h8300 Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU Subsystem: scripts Rong Chen <rong.a.chen@intel.com>: scripts/recordmcount.pl: support big endian for ARCH sh Subsystem: MAINTAINERS Andrey Konovalov <andreyknvl@google.com>: MAINTAINERS: update KASAN file list MAINTAINERS: update Andrey Konovalov's email address MAINTAINERS: add Andrey Konovalov to KASAN reviewers Subsystem: h8300 Randy Dunlap <rdunlap@infradead.org>: h8300: fix PREEMPTION build, TI_PRE_COUNT undefined MAINTAINERS | 8 +++++--- arch/h8300/kernel/asm-offsets.c | 3 +++ arch/m68k/include/asm/page.h | 2 +- scripts/recordmcount.pl | 6 +++++- 4 files changed, 14 insertions(+), 5 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-02-09 21:41 Andrew Morton 2021-02-10 19:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6. Subsystems affected by this patch series: squashfs mm/kasan firmware mm/mremap mm/tmpfs mm/selftests MAINTAINERS mm/memcg mm/slub nilfs2 Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: Patch series "Squashfs: fix BIO migration regression and add sanity checks": squashfs: avoid out of bounds writes in decompressors squashfs: add more sanity checks in id lookup squashfs: add more sanity checks in inode lookup squashfs: add more sanity checks in xattr id lookup Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix stack traces dependency for HW_TAGS Subsystem: firmware Fangrui Song <maskray@google.com>: firmware_loader: align .builtin_fw to 8 Subsystem: mm/mremap Arnd Bergmann <arnd@arndb.de>: mm/mremap: fix BUILD_BUG_ON() error in get_extent Subsystem: mm/tmpfs Seth Forshee <seth.forshee@canonical.com>: tmpfs: disallow CONFIG_TMPFS_INODE64 on s390 tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha Subsystem: mm/selftests Rong Chen <rong.a.chen@intel.com>: selftests/vm: rename file run_vmtests to run_vmtests.sh Subsystem: MAINTAINERS Andrey Ryabinin <ryabinin.a.a@gmail.com>: MAINTAINERS: update Andrey Ryabinin's email address Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: Revert "mm: memcontrol: avoid workload stalls when lowering memory.high" Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: better heuristic for number of cpus when calculating slab order Subsystem: nilfs2 Joachim Henke <joachim.henke@t-systems.com>: nilfs2: make splice write available again .mailmap | 1 Documentation/dev-tools/kasan.rst | 3 - MAINTAINERS | 2 - fs/Kconfig | 4 +- fs/nilfs2/file.c | 1 fs/squashfs/block.c | 8 ++++ fs/squashfs/export.c | 41 +++++++++++++++++++---- fs/squashfs/id.c | 40 ++++++++++++++++++----- fs/squashfs/squashfs_fs_sb.h | 1 fs/squashfs/super.c | 6 +-- fs/squashfs/xattr.h | 10 +++++ fs/squashfs/xattr_id.c | 66 ++++++++++++++++++++++++++++++++------ include/asm-generic/vmlinux.lds.h | 2 - mm/kasan/hw_tags.c | 8 +--- mm/memcontrol.c | 5 +- mm/mremap.c | 5 +- mm/slub.c | 18 +++++++++- 17 files changed, 172 insertions(+), 49 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-02-09 21:41 incoming Andrew Morton @ 2021-02-10 19:30 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits Hah. This series shows a small deficiency in your scripting wrt the diffstat: On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > .mailmap | 1 ... > mm/slub.c | 18 +++++++++- > 17 files changed, 172 insertions(+), 49 deletions(-) It actually has 18 files changed, but one of them is a pure rename (no change to the content), and apparently your diffstat tool can't handle that case. It *should* have ended with ... mm/slub.c | 18 +++++- .../selftests/vm/{run_vmtests => run_vmtests.sh} | 0 18 files changed, 172 insertions(+), 49 deletions(-) rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%) if you'd done a proper "git diff -M --stat --summary" of the series. [ Ok, by default git would actually have said 18 files changed, 171 insertions(+), 48 deletions(-) but it looks like you use the patience diff option, which gives that extra insertion/deletion line because it generates the diff a bit differently ] Not a big deal,, but it made me briefly wonder "why doesn't my diffstat match yours". Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-02-05 2:31 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-02-05 2:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97. Subsystems affected by this patch series: mm/hugetlb mm/compaction mm/vmalloc gcov mm/shmem mm/memblock mailmap mm/pagecache mm/kasan ubsan mm/hugetlb MAINTAINERS Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page mm: hugetlb: fix a race between freeing and dissolving the page mm: hugetlb: fix a race between isolating and freeing page mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active mm: migrate: do not migrate HugeTLB page whose refcount is one Subsystem: mm/compaction Rokudo Yan <wu-yan@tcl.com>: mm, compaction: move high_pfn to the for loop scope Subsystem: mm/vmalloc Rick Edgecombe <rick.p.edgecombe@intel.com>: mm/vmalloc: separate put pages and flush VM flags Subsystem: gcov Johannes Berg <johannes.berg@intel.com>: init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov Subsystem: mm/shmem Hugh Dickins <hughd@google.com>: mm: thp: fix MADV_REMOVE deadlock on shmem THP Subsystem: mm/memblock Roman Gushchin <guro@fb.com>: memblock: do not start bottom-up allocations with kernel_end Subsystem: mailmap Viresh Kumar <viresh.kumar@linaro.org>: mailmap: fix name/email for Viresh Kumar Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>: mailmap: add entries for Manivannan Sadhasivam Subsystem: mm/pagecache Waiman Long <longman@redhat.com>: mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked() Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5: kasan: add explicit preconditions to kasan_report() kasan: make addr_has_metadata() return true for valid addresses Subsystem: ubsan Nathan Chancellor <nathan@kernel.org>: ubsan: implement __ubsan_handle_alignment_assumption Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm: hugetlb: fix missing put_page in gather_surplus_pages() Subsystem: MAINTAINERS Nathan Chancellor <nathan@kernel.org>: MAINTAINERS/.mailmap: use my @kernel.org address .mailmap | 5 ++++ MAINTAINERS | 2 - fs/hugetlbfs/inode.c | 3 +- include/linux/hugetlb.h | 2 + include/linux/kasan.h | 7 ++++++ include/linux/vmalloc.h | 9 +------- init/Kconfig | 1 init/main.c | 8 ++++++- kernel/gcov/Kconfig | 2 - lib/ubsan.c | 31 ++++++++++++++++++++++++++++ lib/ubsan.h | 6 +++++ mm/compaction.c | 3 +- mm/filemap.c | 4 +++ mm/huge_memory.c | 37 ++++++++++++++++++++------------- mm/hugetlb.c | 53 ++++++++++++++++++++++++++++++++++++++++++------ mm/kasan/kasan.h | 2 - mm/memblock.c | 49 +++++--------------------------------------- mm/migrate.c | 6 +++++ 18 files changed, 153 insertions(+), 77 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-01-24 5:00 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2021-01-24 5:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1. Subsystems affected by this patch series: mm/pagealloc mm/memcg mm/kasan ubsan mm/memory-failure mm/highmem proc MAINTAINERS Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: fix initialization of struct page for holes in memory layout", v3: x86/setup: don't remove E820_TYPE_RAM for pfn 0 mm: fix initialization of struct page for holes in memory layout Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: optimize objcg stock draining Shakeel Butt <shakeelb@google.com>: mm: memcg: fix memcg file_dirty numa stat mm: fix numa stats for thp migration Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: prevent starvation when writing memory.high Subsystem: mm/kasan Lecopzer Chen <lecopzer@gmail.com>: kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow kasan: fix incorrect arguments passing in kasan_add_zero_shadow Andrey Konovalov <andreyknvl@google.com>: kasan: fix HW_TAGS boot parameters kasan, mm: fix conflicts with init_on_alloc/free kasan, mm: fix resetting page_alloc tags for HW_TAGS Subsystem: ubsan Arnd Bergmann <arnd@arndb.de>: ubsan: disable unsigned-overflow check for i386 Subsystem: mm/memory-failure Dan Williams <dan.j.williams@intel.com>: mm: fix page reference leak in soft_offline_page() Subsystem: mm/highmem Thomas Gleixner <tglx@linutronix.de>: Patch series "mm/highmem: Fix fallout from generic kmap_local conversions": sparc/mm/highmem: flush cache and TLB mm/highmem: prepare for overriding set_pte_at() mips/mm/highmem: use set_pte() for kmap_local() powerpc/mm/highmem: use __set_pte_at() for kmap_local() Subsystem: proc Xiaoming Ni <nixiaoming@huawei.com>: proc_sysctl: fix oops caused by incorrect command parameters Subsystem: MAINTAINERS Nathan Chancellor <natechancellor@gmail.com>: MAINTAINERS: add a couple more files to the Clang/LLVM section Documentation/dev-tools/kasan.rst | 27 ++--------- MAINTAINERS | 2 arch/mips/include/asm/highmem.h | 1 arch/powerpc/include/asm/highmem.h | 2 arch/sparc/include/asm/highmem.h | 9 ++- arch/x86/kernel/setup.c | 20 +++----- fs/proc/proc_sysctl.c | 7 ++- lib/Kconfig.ubsan | 1 mm/highmem.c | 7 ++- mm/kasan/hw_tags.c | 77 +++++++++++++-------------------- mm/kasan/init.c | 23 +++++---- mm/memcontrol.c | 11 +--- mm/memory-failure.c | 20 ++++++-- mm/migrate.c | 27 ++++++----- mm/page_alloc.c | 86 ++++++++++++++++++++++--------------- mm/slub.c | 7 +-- 16 files changed, 173 insertions(+), 154 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2021-01-12 23:48 Andrew Morton 2021-01-15 23:32 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c. Subsystems affected by this patch series: mm/slub mm/pagealloc mm/memcg mm/kasan mm/vmalloc mm/migration mm/hugetlb MAINTAINERS mm/memory-failure mm/process_vm_access Subsystem: mm/slub Jann Horn <jannh@google.com>: mm, slub: consider rest of partial list if acquire_slab() fails Subsystem: mm/pagealloc Hailong liu <liu.hailong6@zte.com.cn>: mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint Subsystem: mm/memcg Hugh Dickins <hughd@google.com>: mm/memcontrol: fix warning in mem_cgroup_page_lruvec() Subsystem: mm/kasan Hailong Liu <liu.hailong6@zte.com.cn>: arm/kasan: fix the array size of kasan_early_shadow_pte[] Subsystem: mm/vmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/vmalloc.c: fix potential memory leak Subsystem: mm/migration Jan Stancek <jstancek@redhat.com>: mm: migrate: initialize err in do_migrate_pages Subsystem: mm/hugetlb Miaohe Lin <linmiaohe@huawei.com>: mm/hugetlb: fix potential missing huge page size info Subsystem: MAINTAINERS Vlastimil Babka <vbabka@suse.cz>: MAINTAINERS: add Vlastimil as slab allocators maintainer Subsystem: mm/memory-failure Oscar Salvador <osalvador@suse.de>: mm,hwpoison: fix printing of page flags Subsystem: mm/process_vm_access Andrew Morton <akpm@linux-foundation.org>: mm/process_vm_access.c: include compat.h MAINTAINERS | 1 + include/linux/kasan.h | 6 +++++- include/linux/memcontrol.h | 2 +- mm/hugetlb.c | 2 +- mm/kasan/init.c | 3 ++- mm/memory-failure.c | 2 +- mm/mempolicy.c | 2 +- mm/page_alloc.c | 31 ++++++++++++++++--------------- mm/process_vm_access.c | 1 + mm/slub.c | 2 +- mm/vmalloc.c | 4 +++- 11 files changed, 33 insertions(+), 23 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2021-01-12 23:48 incoming Andrew Morton @ 2021-01-15 23:32 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c. Whee. I had completely dropped the ball on this - I had built my usual "akpm" branch with the patches, but then had completely forgotten about it after doing my basic build tests. I tend to leave it for a while to see if people send belated ACK/NAK's for the patches, but that "for a while" is typically "overnight", not several days. So if you ever notice that I haven't merged your patch submission, and you haven't seen me comment on them, feel free to ping me to remind me. Because it might just have gotten lost in the shuffle for some random reason. Admittedly it's rare - I think this is the first time I just randomly noticed three days later that I'd never done the actual merge of the patch-series). Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-12-29 23:13 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3. Subsystems affected by this patch series: mm/selftests mm/hugetlb kbuild checkpatch mm/pagecache mm/mremap mm/kasan misc lib mm/slub Subsystem: mm/selftests Harish <harish@linux.ibm.com>: selftests/vm: fix building protection keys test Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb: fix deadlock in hugetlb_cow error path Subsystem: kbuild Masahiro Yamada <masahiroy@kernel.org>: Revert "kbuild: avoid static_assert for genksyms" Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: prefer strscpy to strlcpy Subsystem: mm/pagecache Souptick Joarder <jrdr.linux@gmail.com>: mm: add prototype for __add_to_page_cache_locked() Baoquan He <bhe@redhat.com>: mm: memmap defer init doesn't work as expected Subsystem: mm/mremap Kalesh Singh <kaleshsingh@google.com>: mm/mremap.c: fix extent calculation Nicholas Piggin <npiggin@gmail.com>: mm: generalise COW SMC TLB flushing race comment Subsystem: mm/kasan Walter Wu <walter-zh.wu@mediatek.com>: kasan: fix null pointer dereference in kasan_record_aux_stack Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: local64.h: make <asm/local64.h> mandatory Huang Shijie <sjhuang@iluvatar.ai>: sizes.h: add SZ_8G/SZ_16G/SZ_32G macros Josh Poimboeuf <jpoimboe@redhat.com>: kdev_t: always inline major/minor helper functions Subsystem: lib Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc: fix the overflow when size is too big Ilya Leoshkevich <iii@linux.ibm.com>: lib/zlib: fix inflating zlib streams on s390 Randy Dunlap <rdunlap@infradead.org>: zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c Subsystem: mm/slub Roman Gushchin <guro@fb.com>: mm: slub: call account_slab_page() after slab page initialization arch/alpha/include/asm/local64.h | 1 - arch/arc/include/asm/Kbuild | 1 - arch/arm/include/asm/Kbuild | 1 - arch/arm64/include/asm/Kbuild | 1 - arch/csky/include/asm/Kbuild | 1 - arch/h8300/include/asm/Kbuild | 1 - arch/hexagon/include/asm/Kbuild | 1 - arch/ia64/include/asm/local64.h | 1 - arch/ia64/mm/init.c | 4 ++-- arch/m68k/include/asm/Kbuild | 1 - arch/microblaze/include/asm/Kbuild | 1 - arch/mips/include/asm/Kbuild | 1 - arch/nds32/include/asm/Kbuild | 1 - arch/openrisc/include/asm/Kbuild | 1 - arch/parisc/include/asm/Kbuild | 1 - arch/powerpc/include/asm/Kbuild | 1 - arch/riscv/include/asm/Kbuild | 1 - arch/s390/include/asm/Kbuild | 1 - arch/sh/include/asm/Kbuild | 1 - arch/sparc/include/asm/Kbuild | 1 - arch/x86/include/asm/local64.h | 1 - arch/xtensa/include/asm/Kbuild | 1 - include/asm-generic/Kbuild | 1 + include/linux/build_bug.h | 5 ----- include/linux/kdev_t.h | 22 +++++++++++----------- include/linux/mm.h | 12 ++++++++++-- include/linux/sizes.h | 3 +++ lib/genalloc.c | 25 +++++++++++++------------ lib/zlib_dfltcc/Makefile | 2 +- lib/zlib_dfltcc/dfltcc.c | 6 +++++- lib/zlib_dfltcc/dfltcc_deflate.c | 3 +++ lib/zlib_dfltcc/dfltcc_inflate.c | 4 ++-- lib/zlib_dfltcc/dfltcc_syms.c | 17 ----------------- mm/hugetlb.c | 22 +++++++++++++++++++++- mm/kasan/generic.c | 2 ++ mm/memory.c | 8 +++++--- mm/memory_hotplug.c | 2 +- mm/mremap.c | 4 +++- mm/page_alloc.c | 8 +++++--- mm/slub.c | 5 ++--- scripts/checkpatch.pl | 6 ++++++ tools/testing/selftests/vm/Makefile | 10 +++++----- 42 files changed, 101 insertions(+), 91 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-12-22 19:58 Andrew Morton 2020-12-22 21:43 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e. Subsystems affected by this patch series: mm/kasan Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: add hardware tag-based mode for arm64", v11: kasan: drop unnecessary GPL text from comment headers kasan: KASAN_VMALLOC depends on KASAN_GENERIC kasan: group vmalloc code kasan: shadow declarations only for software modes kasan: rename (un)poison_shadow to (un)poison_range kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_* kasan: only build init.c for software modes kasan: split out shadow.c from common.c kasan: define KASAN_MEMORY_PER_SHADOW_PAGE kasan: rename report and tags files kasan: don't duplicate config dependencies kasan: hide invalid free check implementation kasan: decode stack frame only with KASAN_STACK_ENABLE kasan, arm64: only init shadow for software modes kasan, arm64: only use kasan_depth for software modes kasan, arm64: move initialization message kasan, arm64: rename kasan_init_tags and mark as __init kasan: rename addr_has_shadow to addr_has_metadata kasan: rename print_shadow_for_address to print_memory_metadata kasan: rename SHADOW layout macros to META kasan: separate metadata_fetch_row for each mode kasan: introduce CONFIG_KASAN_HW_TAGS Vincenzo Frascino <vincenzo.frascino@arm.com>: arm64: enable armv8.5-a asm-arch option arm64: mte: add in-kernel MTE helpers arm64: mte: reset the page tag in page->flags arm64: mte: add in-kernel tag fault handler arm64: kasan: allow enabling in-kernel MTE arm64: mte: convert gcr_user into an exclude mask arm64: mte: switch GCR_EL1 in kernel entry and exit kasan, mm: untag page address in free_reserved_area Andrey Konovalov <andreyknvl@google.com>: arm64: kasan: align allocations for HW_TAGS arm64: kasan: add arch layer for memory tagging helpers kasan: define KASAN_GRANULE_SIZE for HW_TAGS kasan, x86, s390: update undef CONFIG_KASAN kasan, arm64: expand CONFIG_KASAN checks kasan, arm64: implement HW_TAGS runtime kasan, arm64: print report from tag fault handler kasan, mm: reset tags when accessing metadata kasan, arm64: enable CONFIG_KASAN_HW_TAGS kasan: add documentation for hardware tag-based mode Vincenzo Frascino <vincenzo.frascino@arm.com>: kselftest/arm64: check GCR_EL1 after context switch Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: boot parameters for hardware tag-based mode", v4: kasan: simplify quarantine_put call site kasan: rename get_alloc/free_info kasan: introduce set_alloc_info kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK kasan: allow VMAP_STACK for HW_TAGS mode kasan: remove __kasan_unpoison_stack kasan: inline kasan_reset_tag for tag-based modes kasan: inline random_tag for HW_TAGS kasan: open-code kasan_unpoison_slab kasan: inline (un)poison_range and check_invalid_free kasan: add and integrate kasan boot parameters kasan, mm: check kasan_enabled in annotations kasan, mm: rename kasan_poison_kfree kasan: don't round_up too much kasan: simplify assign_tag and set_tag calls kasan: clarify comment in __kasan_kfree_large kasan: sanitize objects when metadata doesn't fit kasan, mm: allow cache merging with no metadata kasan: update documentation Documentation/dev-tools/kasan.rst | 274 ++- arch/Kconfig | 8 arch/arm64/Kconfig | 9 arch/arm64/Makefile | 7 arch/arm64/include/asm/assembler.h | 2 arch/arm64/include/asm/cache.h | 3 arch/arm64/include/asm/esr.h | 1 arch/arm64/include/asm/kasan.h | 17 arch/arm64/include/asm/memory.h | 15 arch/arm64/include/asm/mte-def.h | 16 arch/arm64/include/asm/mte-kasan.h | 67 arch/arm64/include/asm/mte.h | 22 arch/arm64/include/asm/processor.h | 2 arch/arm64/include/asm/string.h | 5 arch/arm64/include/asm/uaccess.h | 23 arch/arm64/kernel/asm-offsets.c | 3 arch/arm64/kernel/cpufeature.c | 3 arch/arm64/kernel/entry.S | 41 arch/arm64/kernel/head.S | 2 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/image-vars.h | 2 arch/arm64/kernel/kaslr.c | 3 arch/arm64/kernel/module.c | 6 arch/arm64/kernel/mte.c | 124 + arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/sleep.S | 2 arch/arm64/kernel/smp.c | 2 arch/arm64/lib/mte.S | 16 arch/arm64/mm/copypage.c | 9 arch/arm64/mm/fault.c | 59 arch/arm64/mm/kasan_init.c | 41 arch/arm64/mm/mteswap.c | 9 arch/arm64/mm/proc.S | 23 arch/arm64/mm/ptdump.c | 6 arch/s390/boot/string.c | 1 arch/x86/boot/compressed/misc.h | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 include/linux/kasan-checks.h | 2 include/linux/kasan.h | 423 ++++- include/linux/mm.h | 24 include/linux/moduleloader.h | 3 include/linux/page-flags-layout.h | 2 include/linux/sched.h | 2 include/linux/string.h | 2 init/init_task.c | 2 kernel/fork.c | 4 lib/Kconfig.kasan | 71 lib/test_kasan.c | 2 lib/test_kasan_module.c | 2 mm/kasan/Makefile | 33 mm/kasan/common.c | 1006 +++----------- mm/kasan/generic.c | 72 - mm/kasan/generic_report.c | 13 mm/kasan/hw_tags.c | 276 +++ mm/kasan/init.c | 25 mm/kasan/kasan.h | 195 ++ mm/kasan/quarantine.c | 35 mm/kasan/report.c | 363 +---- mm/kasan/report_generic.c | 169 ++ mm/kasan/report_hw_tags.c | 44 mm/kasan/report_sw_tags.c | 22 mm/kasan/shadow.c | 528 +++++++ mm/kasan/sw_tags.c | 34 mm/kasan/tags.c | 7 mm/kasan/tags_report.c | 7 mm/mempool.c | 4 mm/page_alloc.c | 9 mm/page_poison.c | 2 mm/ptdump.c | 13 mm/slab_common.c | 5 mm/slub.c | 29 scripts/Makefile.lib | 2 tools/testing/selftests/arm64/mte/Makefile | 2 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 ++ 74 files changed, 2869 insertions(+), 1553 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-12-22 19:58 incoming Andrew Morton @ 2020-12-22 21:43 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e. I see that you enabled renaming in the patches. Lovely. Can you also enable it in the diffstat? > 74 files changed, 2869 insertions(+), 1553 deletions(-) With -M in the diffstat, you should have seen 72 files changed, 2775 insertions(+), 1460 deletions(-) and if you add "--summary", you'll also see the rename part ofthe file create/delete summary: rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%) which is often nice to see in addition to the line stats.. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-12-18 22:00 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87. Subsystems affected by this patch series: mm/memcg epoll mm/kasan mm/cleanups epoll Subsystem: mm/memcg Alex Shi <alex.shi@linux.alibaba.com>: Patch series "bail out early for memcg disable": mm/memcg: bail early from swap accounting if memcg disabled mm/memcg: warning on !memcg after readahead page charged Wei Yang <richard.weiyang@gmail.com>: mm/memcg: remove unused definitions Shakeel Butt <shakeelb@google.com>: mm, kvm: account kvm_vcpu_mmap to kmemcg Hui Su <sh_def@163.com>: mm/memcontrol:rewrite mem_cgroup_page_lruvec() Subsystem: epoll Soheil Hassas Yeganeh <soheil@google.com>: Patch series "simplify ep_poll": epoll: check for events when removing a timed out thread from the wait queue epoll: simplify signal handling epoll: pull fatal signal checks into ep_send_events() epoll: move eavail next to the list_empty_careful check epoll: simplify and optimize busy loop logic epoll: pull all code between fetch_events and send_event into the loop epoll: replace gotos with a proper loop epoll: eliminate unnecessary lock for zero timeout Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: add hardware tag-based mode for arm64", v11: kasan: drop unnecessary GPL text from comment headers kasan: KASAN_VMALLOC depends on KASAN_GENERIC kasan: group vmalloc code kasan: shadow declarations only for software modes kasan: rename (un)poison_shadow to (un)poison_range kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_* kasan: only build init.c for software modes kasan: split out shadow.c from common.c kasan: define KASAN_MEMORY_PER_SHADOW_PAGE kasan: rename report and tags files kasan: don't duplicate config dependencies kasan: hide invalid free check implementation kasan: decode stack frame only with KASAN_STACK_ENABLE kasan, arm64: only init shadow for software modes kasan, arm64: only use kasan_depth for software modes kasan, arm64: move initialization message kasan, arm64: rename kasan_init_tags and mark as __init kasan: rename addr_has_shadow to addr_has_metadata kasan: rename print_shadow_for_address to print_memory_metadata kasan: rename SHADOW layout macros to META kasan: separate metadata_fetch_row for each mode kasan: introduce CONFIG_KASAN_HW_TAGS Vincenzo Frascino <vincenzo.frascino@arm.com>: arm64: enable armv8.5-a asm-arch option arm64: mte: add in-kernel MTE helpers arm64: mte: reset the page tag in page->flags arm64: mte: add in-kernel tag fault handler arm64: kasan: allow enabling in-kernel MTE arm64: mte: convert gcr_user into an exclude mask arm64: mte: switch GCR_EL1 in kernel entry and exit kasan, mm: untag page address in free_reserved_area Andrey Konovalov <andreyknvl@google.com>: arm64: kasan: align allocations for HW_TAGS arm64: kasan: add arch layer for memory tagging helpers kasan: define KASAN_GRANULE_SIZE for HW_TAGS kasan, x86, s390: update undef CONFIG_KASAN kasan, arm64: expand CONFIG_KASAN checks kasan, arm64: implement HW_TAGS runtime kasan, arm64: print report from tag fault handler kasan, mm: reset tags when accessing metadata kasan, arm64: enable CONFIG_KASAN_HW_TAGS kasan: add documentation for hardware tag-based mode Vincenzo Frascino <vincenzo.frascino@arm.com>: kselftest/arm64: check GCR_EL1 after context switch Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: boot parameters for hardware tag-based mode", v4: kasan: simplify quarantine_put call site kasan: rename get_alloc/free_info kasan: introduce set_alloc_info kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK kasan: allow VMAP_STACK for HW_TAGS mode kasan: remove __kasan_unpoison_stack kasan: inline kasan_reset_tag for tag-based modes kasan: inline random_tag for HW_TAGS kasan: open-code kasan_unpoison_slab kasan: inline (un)poison_range and check_invalid_free kasan: add and integrate kasan boot parameters kasan, mm: check kasan_enabled in annotations kasan, mm: rename kasan_poison_kfree kasan: don't round_up too much kasan: simplify assign_tag and set_tag calls kasan: clarify comment in __kasan_kfree_large kasan: sanitize objects when metadata doesn't fit kasan, mm: allow cache merging with no metadata kasan: update documentation Subsystem: mm/cleanups Colin Ian King <colin.king@canonical.com>: mm/Kconfig: fix spelling mistake "whats" -> "what's" Subsystem: epoll Willem de Bruijn <willemb@google.com>: Patch series "add epoll_pwait2 syscall", v4: epoll: convert internal api to timespec64 epoll: add syscall epoll_pwait2 epoll: wire up syscall epoll_pwait2 selftests/filesystems: expand epoll with epoll_pwait2 Documentation/dev-tools/kasan.rst | 274 +- arch/Kconfig | 8 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/Kconfig | 9 arch/arm64/Makefile | 7 arch/arm64/include/asm/assembler.h | 2 arch/arm64/include/asm/cache.h | 3 arch/arm64/include/asm/esr.h | 1 arch/arm64/include/asm/kasan.h | 17 arch/arm64/include/asm/memory.h | 15 arch/arm64/include/asm/mte-def.h | 16 arch/arm64/include/asm/mte-kasan.h | 67 arch/arm64/include/asm/mte.h | 22 arch/arm64/include/asm/processor.h | 2 arch/arm64/include/asm/string.h | 5 arch/arm64/include/asm/uaccess.h | 23 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/arm64/kernel/asm-offsets.c | 3 arch/arm64/kernel/cpufeature.c | 3 arch/arm64/kernel/entry.S | 41 arch/arm64/kernel/head.S | 2 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/image-vars.h | 2 arch/arm64/kernel/kaslr.c | 3 arch/arm64/kernel/module.c | 6 arch/arm64/kernel/mte.c | 124 + arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/sleep.S | 2 arch/arm64/kernel/smp.c | 2 arch/arm64/lib/mte.S | 16 arch/arm64/mm/copypage.c | 9 arch/arm64/mm/fault.c | 59 arch/arm64/mm/kasan_init.c | 41 arch/arm64/mm/mteswap.c | 9 arch/arm64/mm/proc.S | 23 arch/arm64/mm/ptdump.c | 6 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/s390/boot/string.c | 1 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/x86/boot/compressed/misc.h | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/kernel/acpi/wakeup_64.S | 2 arch/x86/kvm/x86.c | 2 arch/xtensa/kernel/syscalls/syscall.tbl | 1 fs/eventpoll.c | 359 ++- include/linux/compat.h | 6 include/linux/kasan-checks.h | 2 include/linux/kasan.h | 423 ++-- include/linux/memcontrol.h | 137 - include/linux/mm.h | 24 include/linux/mmdebug.h | 13 include/linux/moduleloader.h | 3 include/linux/page-flags-layout.h | 2 include/linux/sched.h | 2 include/linux/string.h | 2 include/linux/syscalls.h | 5 include/uapi/asm-generic/unistd.h | 4 init/init_task.c | 2 kernel/fork.c | 4 kernel/sys_ni.c | 2 lib/Kconfig.kasan | 71 lib/test_kasan.c | 2 lib/test_kasan_module.c | 2 mm/Kconfig | 2 mm/kasan/Makefile | 33 mm/kasan/common.c | 1006 ++-------- mm/kasan/generic.c | 72 mm/kasan/generic_report.c | 13 mm/kasan/hw_tags.c | 294 ++ mm/kasan/init.c | 25 mm/kasan/kasan.h | 204 +- mm/kasan/quarantine.c | 35 mm/kasan/report.c | 363 +-- mm/kasan/report_generic.c | 169 + mm/kasan/report_hw_tags.c | 44 mm/kasan/report_sw_tags.c | 22 mm/kasan/shadow.c | 541 +++++ mm/kasan/sw_tags.c | 34 mm/kasan/tags.c | 7 mm/kasan/tags_report.c | 7 mm/memcontrol.c | 53 mm/mempool.c | 4 mm/page_alloc.c | 9 mm/page_poison.c | 2 mm/ptdump.c | 13 mm/slab_common.c | 5 mm/slub.c | 29 scripts/Makefile.lib | 2 tools/testing/selftests/arm64/mte/Makefile | 2 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 + tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 72 virt/kvm/coalesced_mmio.c | 2 virt/kvm/kvm_main.c | 2 105 files changed, 3268 insertions(+), 1873 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-12-16 4:41 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-12-16 4:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - lots of little subsystems - a few post-linux-next MM material. Most of this awaits more merging of other trees. 95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4. Subsystems affected by this patch series: mm/swap mm/memory-hotplug alpha procfs misc core-kernel bitmap lib lz4 bitops checkpatch nilfs kdump rapidio gcov bfs relay resource ubsan reboot fault-injection lzo apparmor mm/pagemap mm/cleanups mm/gup Subsystem: mm/swap Zhaoyang Huang <huangzhaoyang@gmail.com>: mm: fix a race on nr_swap_pages Subsystem: mm/memory-hotplug Laurent Dufour <ldufour@linux.ibm.com>: mm/memory_hotplug: quieting offline operation Subsystem: alpha Thomas Gleixner <tglx@linutronix.de>: alpha: replace bogus in_interrupt() Subsystem: procfs Randy Dunlap <rdunlap@infradead.org>: procfs: delete duplicated words + other fixes Anand K Mistry <amistry@google.com>: proc: provide details on indirect branch speculation Alexey Dobriyan <adobriyan@gmail.com>: proc: fix lookup in /proc/net subdirectories after setns(2) Hui Su <sh_def@163.com>: fs/proc: make pde_get() return nothing Subsystem: misc Christophe Leroy <christophe.leroy@csgroup.eu>: asm-generic: force inlining of get_order() to work around gcc10 poor decision Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out mathematical helpers Subsystem: core-kernel Hui Su <sh_def@163.com>: kernel/acct.c: use #elif instead of #end and #elif Subsystem: bitmap Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean "Ma, Jianpeng" <jianpeng.ma@intel.com>: bitmap: remove unused function declaration Subsystem: lib Geert Uytterhoeven <geert@linux-m68k.org>: lib/test_free_pages.c: add basic progress indicators "Gustavo A. R. Silva" <gustavoars@kernel.org>: Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member": lib/stackdepot.c: replace one-element array with flexible-array member lib/stackdepot.c: use flex_array_size() helper in memcpy() lib/stackdepot.c: use array_size() helper in jhash2() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/list_kunit: follow new file name convention for KUnit tests lib/linear_ranges_kunit: follow new file name convention for KUnit tests lib/bits_kunit: follow new file name convention for KUnit tests lib/cmdline: fix get_option() for strings starting with hyphen lib/cmdline: allow NULL to be an output for get_option() lib/cmdline_kunit: add a new test suite for cmdline API Jakub Jelinek <jakub@redhat.com>: ilog2: improve ilog2 for constant arguments Nick Desaulniers <ndesaulniers@google.com>: lib/string: remove unnecessary #undefs Daniel Axtens <dja@axtens.net>: Patch series "Fortify strscpy()", v7: lib: string.h: detect intra-object overflow in fortified string functions lkdtm: tests for FORTIFY_SOURCE Francis Laniel <laniel_francis@privacyrequired.com>: string.h: add FORTIFY coverage for strscpy() drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment Alexey Dobriyan <adobriyan@gmail.com>: lib: cleanup kstrto*() usage Subsystem: lz4 Gao Xiang <hsiangkao@redhat.com>: lib/lz4: explicitly support in-place decompression Subsystem: bitops Syed Nayyar Waris <syednwaris@gmail.com>: Patch series "Introduce the for_each_set_clump macro", v12: bitops: introduce the for_each_set_clump macro lib/test_bitmap.c: add for_each_set_clump test cases gpio: thunderx: utilize for_each_set_clump macro gpio: xilinx: utilize generic bitmap_get_value and _set_value Subsystem: checkpatch Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add new exception to repeated word check Aditya Srivastava <yashsri421@gmail.com>: checkpatch: fix false positives in REPEATED_WORD warning Łukasz Stelmach <l.stelmach@samsung.com>: checkpatch: ignore generated CamelCase defines and enum values Joe Perches <joe@perches.com>: checkpatch: prefer static const declarations checkpatch: allow --fix removal of unnecessary break statements Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: extend attributes check to handle more patterns Tom Rix <trix@redhat.com>: checkpatch: add a fixer for missing newline at eof Joe Perches <joe@perches.com>: checkpatch: update __attribute__((section("name"))) quote removal Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add fix option for GERRIT_CHANGE_ID Joe Perches <joe@perches.com>: checkpatch: add __alias and __weak to suggested __attribute__ conversions Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: improve email parsing checkpatch: fix spelling errors and remove repeated word Aditya Srivastava <yashsri421@gmail.com>: checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: fix unescaped left brace Aditya Srivastava <yashsri421@gmail.com>: checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS checkpatch: add fix option for LOGICAL_CONTINUATIONS checkpatch: add fix and improve warning msg for non-standard signature Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi] checkpatch: add warning for lines starting with a '#' in commit log checkpatch: fix TYPO_SPELLING check for words with apostrophe Joe Perches <joe@perches.com>: checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning Subsystem: nilfs Alex Shi <alex.shi@linux.alibaba.com>: fs/nilfs2: remove some unused macros to tame gcc Subsystem: kdump Alexander Egorenkov <egorenar@linux.ibm.com>: kdump: append uts_namespace.name offset to VMCOREINFO Subsystem: rapidio Sebastian Andrzej Siewior <bigeasy@linutronix.de>: rapidio: remove unused rio_get_asm() and rio_get_device() Subsystem: gcov Nick Desaulniers <ndesaulniers@google.com>: gcov: remove support for GCC < 4.9 Alex Shi <alex.shi@linux.alibaba.com>: gcov: fix kernel-doc markup issue Subsystem: bfs Randy Dunlap <rdunlap@infradead.org>: bfs: don't use WARNING: string when it's just info. Subsystem: relay Jani Nikula <jani.nikula@intel.com>: Patch series "relay: cleanup and const callbacks", v2: relay: remove unused buf_mapped and buf_unmapped callbacks relay: require non-NULL callbacks in relay_open() relay: make create_buf_file and remove_buf_file callbacks mandatory relay: allow the use of const callback structs drm/i915: make relay callbacks const ath10k: make relay callbacks const ath11k: make relay callbacks const ath9k: make relay callbacks const blktrace: make relay callbacks const Subsystem: resource Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: kernel/resource.c: fix kernel-doc markups Subsystem: ubsan Kees Cook <keescook@chromium.org>: Patch series "Clean up UBSAN Makefile", v2: ubsan: remove redundant -Wno-maybe-uninitialized ubsan: move cc-option tests into Kconfig ubsan: disable object-size sanitizer under GCC ubsan: disable UBSAN_TRAP for all*config ubsan: enable for all*config builds ubsan: remove UBSAN_MISC in favor of individual options ubsan: expand tests and reporting Dmitry Vyukov <dvyukov@google.com>: kcov: don't instrument with UBSAN Zou Wei <zou_wei@huawei.com>: lib/ubsan.c: mark type_check_kinds with static keyword Subsystem: reboot Matteo Croce <mcroce@microsoft.com>: reboot: refactor and comment the cpu selection code reboot: allow to specify reboot mode via sysfs reboot: remove cf9_safe from allowed types and rename cf9_force Patch series "reboot: sysfs improvements": reboot: allow to override reboot type if quirks are found reboot: hide from sysfs not applicable settings Subsystem: fault-injection Barnabás Pőcze <pobrn@protonmail.com>: fault-injection: handle EI_ETYPE_TRUE Subsystem: lzo Jason Yan <yanaijie@huawei.com>: lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static Subsystem: apparmor Andy Shevchenko <andriy.shevchenko@linux.intel.com>: apparmor: remove duplicate macro list_entry_is_head() Subsystem: mm/pagemap Christoph Hellwig <hch@lst.de>: Patch series "simplify follow_pte a bit": mm: unexport follow_pte_pmd mm: simplify follow_pte{,pmd} Subsystem: mm/cleanups Haitao Shi <shihaitao1@huawei.com>: mm: fix some spelling mistakes in comments Subsystem: mm/gup Jann Horn <jannh@google.com>: mmap locking API: don't check locking if the mm isn't live yet mm/gup: assert that the mmap lock is held in __get_user_pages() Documentation/ABI/testing/sysfs-kernel-reboot | 32 Documentation/admin-guide/kdump/vmcoreinfo.rst | 6 Documentation/dev-tools/ubsan.rst | 1 Documentation/filesystems/proc.rst | 2 MAINTAINERS | 5 arch/alpha/kernel/process.c | 2 arch/powerpc/kernel/vmlinux.lds.S | 4 arch/s390/pci/pci_mmio.c | 4 drivers/gpio/gpio-thunderx.c | 11 drivers/gpio/gpio-xilinx.c | 61 - drivers/gpu/drm/i915/gt/uc/intel_guc_log.c | 2 drivers/misc/lkdtm/Makefile | 1 drivers/misc/lkdtm/bugs.c | 50 + drivers/misc/lkdtm/core.c | 3 drivers/misc/lkdtm/fortify.c | 82 ++ drivers/misc/lkdtm/lkdtm.h | 19 drivers/net/wireless/ath/ath10k/spectral.c | 2 drivers/net/wireless/ath/ath11k/spectral.c | 2 drivers/net/wireless/ath/ath9k/common-spectral.c | 2 drivers/rapidio/rio.c | 81 -- fs/bfs/inode.c | 2 fs/dax.c | 9 fs/exec.c | 8 fs/nfs/callback_proc.c | 5 fs/nilfs2/segment.c | 5 fs/proc/array.c | 28 fs/proc/base.c | 2 fs/proc/generic.c | 24 fs/proc/internal.h | 10 fs/proc/proc_net.c | 20 include/asm-generic/bitops/find.h | 19 include/asm-generic/getorder.h | 2 include/linux/bitmap.h | 67 +- include/linux/bitops.h | 24 include/linux/dcache.h | 1 include/linux/iommu-helper.h | 4 include/linux/kernel.h | 173 ----- include/linux/log2.h | 3 include/linux/math.h | 177 +++++ include/linux/mm.h | 6 include/linux/mm_types.h | 10 include/linux/mmap_lock.h | 16 include/linux/proc_fs.h | 8 include/linux/rcu_node_tree.h | 2 include/linux/relay.h | 29 include/linux/rio_drv.h | 3 include/linux/string.h | 75 +- include/linux/units.h | 2 kernel/Makefile | 3 kernel/acct.c | 7 kernel/crash_core.c | 1 kernel/fail_function.c | 6 kernel/gcov/gcc_4_7.c | 10 kernel/reboot.c | 308 ++++++++- kernel/relay.c | 111 --- kernel/resource.c | 24 kernel/trace/blktrace.c | 2 lib/Kconfig.debug | 11 lib/Kconfig.ubsan | 154 +++- lib/Makefile | 7 lib/bits_kunit.c | 75 ++ lib/cmdline.c | 20 lib/cmdline_kunit.c | 100 +++ lib/errname.c | 1 lib/error-inject.c | 2 lib/errseq.c | 1 lib/find_bit.c | 17 lib/linear_ranges_kunit.c | 228 +++++++ lib/list-test.c | 748 ----------------------- lib/list_kunit.c | 748 +++++++++++++++++++++++ lib/lz4/lz4_decompress.c | 6 lib/lz4/lz4defs.h | 1 lib/lzo/lzo1x_compress.c | 2 lib/math/div64.c | 4 lib/math/int_pow.c | 2 lib/math/int_sqrt.c | 3 lib/math/reciprocal_div.c | 9 lib/stackdepot.c | 11 lib/string.c | 4 lib/test_bitmap.c | 143 ++++ lib/test_bits.c | 75 -- lib/test_firmware.c | 9 lib/test_free_pages.c | 5 lib/test_kmod.c | 26 lib/test_linear_ranges.c | 228 ------- lib/test_lockup.c | 16 lib/test_ubsan.c | 74 ++ lib/ubsan.c | 2 mm/filemap.c | 2 mm/gup.c | 2 mm/huge_memory.c | 2 mm/khugepaged.c | 2 mm/memblock.c | 2 mm/memory.c | 36 - mm/memory_hotplug.c | 2 mm/migrate.c | 2 mm/page_ext.c | 2 mm/swapfile.c | 11 scripts/Makefile.ubsan | 49 - scripts/checkpatch.pl | 495 +++++++++++---- security/apparmor/apparmorfs.c | 3 tools/testing/selftests/lkdtm/tests.txt | 1 102 files changed, 3022 insertions(+), 1899 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-12-15 20:32 Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 0 siblings, 2 replies; 389+ messages in thread From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - more MM work: a memcg scalability improvememt 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. Subsystems affected by this patch series: Alex Shi <alex.shi@linux.alibaba.com>: Patch series "per memcg lru lock", v21: mm/thp: move lru_add_page_tail() to huge_memory.c mm/thp: use head for head page in lru_add_page_tail() mm/thp: simplify lru_add_page_tail() mm/thp: narrow lru locking mm/vmscan: remove unnecessary lruvec adding mm/rmap: stop store reordering issue on page->mapping Hugh Dickins <hughd@google.com>: mm: page_idle_get_page() does not need lru_lock Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: add debug checking in lock_page_memcg mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn mm/lru: move lock into lru_note_cost mm/vmscan: remove lruvec reget in move_pages_to_lru mm/mlock: remove lru_lock on TestClearPageMlocked mm/mlock: remove __munlock_isolate_lru_page() mm/lru: introduce TestClearPageLRU() mm/compaction: do page isolation first in compaction mm/swap.c: serialize memcg changes in pagevec_lru_move_fn mm/lru: replace pgdat lru_lock with lruvec lock Alexander Duyck <alexander.h.duyck@linux.intel.com>: mm/lru: introduce relock_page_lruvec() Hugh Dickins <hughd@google.com>: mm/lru: revise the comments of lru_lock Documentation/admin-guide/cgroup-v1/memcg_test.rst | 15 - Documentation/admin-guide/cgroup-v1/memory.rst | 23 - Documentation/trace/events-kmem.rst | 2 Documentation/vm/unevictable-lru.rst | 22 - include/linux/memcontrol.h | 110 +++++++ include/linux/mm_types.h | 2 include/linux/mmzone.h | 6 include/linux/page-flags.h | 1 include/linux/swap.h | 4 mm/compaction.c | 98 ++++--- mm/filemap.c | 4 mm/huge_memory.c | 109 ++++--- mm/memcontrol.c | 84 +++++- mm/mlock.c | 93 ++---- mm/mmzone.c | 1 mm/page_alloc.c | 1 mm/page_idle.c | 4 mm/rmap.c | 12 mm/swap.c | 292 ++++++++------------- mm/vmscan.c | 239 ++++++++--------- mm/workingset.c | 2 21 files changed, 644 insertions(+), 480 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-12-15 20:32 incoming Andrew Morton @ 2020-12-15 21:00 ` Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 1 sibling, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - more MM work: a memcg scalability improvememt > > 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. I'm not seeing patch 10/19 at all. And patch 19/19 is corrupted and has an attachment with a '^P' character in it. I could fix it up, but with the missing patch in the middle I'm not going to even try. 'b4' is also very unhappy about that patch 19/19. I don't know what went wrong, but I'll ignore this send - please re-send the series at your leisure, ok? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-12-15 20:32 incoming Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds @ 2020-12-15 22:48 ` Linus Torvalds 2020-12-15 22:49 ` incoming Linus Torvalds 1 sibling, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - more MM work: a memcg scalability improvememt > > 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3. With your re-send, I get all patches, but they don't actually apply cleanly. Is that base correct? I get error: patch failed: mm/huge_memory.c:2750 error: mm/huge_memory.c: patch does not apply Patch failed at 0004 mm/thp: narrow lru locking for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's definitely true: the patch fragment has @@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page __dec_lruvec_page_state(head, NR_FILE_THPS); } - __split_huge_page(page, list, end, flags); + __split_huge_page(page, list, end); ret = 0; } else { if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) { but that __dec_lruvec_page_state() conversion was done by your previous commit series. So I have the feeling that what you actually mean by "base" isn't actually really the base for that series at all.. I will try to apply it on top of my merge of your previous series instead. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-12-15 22:48 ` incoming Linus Torvalds @ 2020-12-15 22:49 ` Linus Torvalds 2020-12-15 22:55 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw) To: Andrew Morton; +Cc: Linux-MM, mm-commits On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > I will try to apply it on top of my merge of your previous series instead. Yes, then it applies cleanly. So apparently we just have different concepts of what really constitutes a "base" for applying your series. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-12-15 22:49 ` incoming Linus Torvalds @ 2020-12-15 22:55 ` Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: Linux-MM, mm-commits On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds > <torvalds@linux-foundation.org> wrote: > > > > I will try to apply it on top of my merge of your previous series instead. > > Yes, then it applies cleanly. So apparently we just have different > concepts of what really constitutes a "base" for applying your series. > oop, sorry, yes, the "based on" thing was wrong because I had two series in flight simultaneously. I've never tried that before.. ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-12-15 3:02 Andrew Morton 2020-12-15 3:25 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-12-15 3:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a few random little subsystems - almost all of the MM patches which are staged ahead of linux-next material. I'll trickle to post-linux-next work in as the dependents get merged up. 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442. Subsystems affected by this patch series: kthread kbuild ide ntfs ocfs2 arch mm/slab-generic mm/slab mm/slub mm/dax mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/pagemap mm/mremap mm/hmm mm/vmalloc mm/documentation mm/kasan mm/pagealloc mm/memory-failure mm/hugetlb mm/vmscan mm/z3fold mm/compaction mm/oom-kill mm/migration mm/cma mm/page-poison mm/userfaultfd mm/zswap mm/zsmalloc mm/uaccess mm/zram mm/cleanups Subsystem: kthread Rob Clark <robdclark@chromium.org>: kthread: add kthread_work tracepoints Petr Mladek <pmladek@suse.com>: kthread_worker: document CPU hotplug handling Subsystem: kbuild Petr Vorel <petr.vorel@gmail.com>: uapi: move constants from <linux/kernel.h> to <linux/const.h> Subsystem: ide Sebastian Andrzej Siewior <bigeasy@linutronix.de>: ide/falcon: remove in_interrupt() usage ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister() Subsystem: ntfs Alex Shi <alex.shi@linux.alibaba.com>: fs/ntfs: remove unused varibles fs/ntfs: remove unused variable attr_len Subsystem: ocfs2 Tom Rix <trix@redhat.com>: fs/ocfs2/cluster/tcp.c: remove unneeded break Mauricio Faria de Oliveira <mfo@canonical.com>: ocfs2: ratelimit the 'max lookup times reached' notice Subsystem: arch Colin Ian King <colin.king@canonical.com>: arch/Kconfig: fix spelling mistakes Subsystem: mm/slab-generic Hui Su <sh_def@163.com>: mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab() Bartosz Golaszewski <bgolaszewski@baylibre.com>: Patch series "slab: provide and use krealloc_array()", v3: mm: slab: clarify krealloc()'s behavior with __GFP_ZERO mm: slab: provide krealloc_array() ALSA: pcm: use krealloc_array() vhost: vringh: use krealloc_array() pinctrl: use krealloc_array() edac: ghes: use krealloc_array() drm: atomic: use krealloc_array() hwtracing: intel: use krealloc_array() dma-buf: use krealloc_array() Vlastimil Babka <vbabka@suse.cz>: mm, slab, slub: clear the slab_cache field when freeing page Subsystem: mm/slab Alexander Popov <alex.popov@linux.com>: mm/slab: rerform init_on_free earlier Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: mm, slub: use kmem_cache_debug_flags() in deactivate_slab() Bharata B Rao <bharata@linux.ibm.com>: mm/slub: let number of online CPUs determine the slub page order Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: device-dax/kmem: use struct_size() Subsystem: mm/debug Zhenhua Huang <zhenhuah@codeaurora.org>: mm: fix page_owner initializing issue for arm32 Liam Mark <lmark@codeaurora.org>: mm/page_owner: record timestamp and pid Subsystem: mm/pagecache Kent Overstreet <kent.overstreet@gmail.com>: Patch series "generic_file_buffered_read() improvements", v2: mm/filemap/c: break generic_file_buffered_read up into multiple functions mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig Alex Shi <alex.shi@linux.alibaba.com>: mm/truncate: add parameter explanation for invalidate_mapping_pagevec Hailong Liu <carver4lio@163.com>: mm/filemap.c: remove else after a return Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3: mm/gup_benchmark: rename to mm/gup_test selftests/vm: use a common gup_test.h selftests/vm: rename run_vmtests --> run_vmtests.sh selftests/vm: minor cleanup: Makefile and gup_test.c selftests/vm: only some gup_test items are really benchmarks selftests/vm: gup_test: introduce the dump_pages() sub-test selftests/vm: run_vmtests.sh: update and clean up gup_test invocation selftests/vm: hmm-tests: remove the libhugetlbfs dependency selftests/vm: 2x speedup for run_vmtests.sh Barry Song <song.bao.hua@hisilicon.com>: mm/gup_test.c: mark gup_test_init as __init function mm/gup_test: GUP_TEST depends on DEBUG_FS Jason Gunthorpe <jgg@nvidia.com>: Patch series "Add a seqcount between gup_fast and copy_page_range()", v4: mm/gup: reorganize internal_get_user_pages_fast() mm/gup: prevent gup_fast from racing with COW during fork mm/gup: remove the vma allocation from gup_longterm_locked() mm/gup: combine put_compound_head() and unpin_user_page() Subsystem: mm/swap Ralph Campbell <rcampbell@nvidia.com>: mm: handle zone device pages in release_pages() Miaohe Lin <linmiaohe@huawei.com>: mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation() mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0 mm/swapfile.c: remove unnecessary out label in __swap_duplicate() mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE Jeff Layton <jlayton@kernel.org>: mm: remove pagevec_lookup_range_nr_tag() Subsystem: mm/shmem Hui Su <sh_def@163.com>: mm/shmem.c: make shmem_mapping() inline Randy Dunlap <rdunlap@infradead.org>: tmpfs: fix Documentation nits Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: add file_thp, shmem_thp to memory.stat Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: remove unused mod_memcg_obj_state() Miaohe Lin <linmiaohe@huawei.com>: mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded() Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix return of child memcg objcg for root memcg mm: memcg/slab: fix use after free in obj_cgroup_charge Shakeel Butt <shakeelb@google.com>: mm/rmap: always do TTU_IGNORE_ACCESS Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: update page struct member in comments Roman Gushchin <guro@fb.com>: mm: memcg: fix obsolete code comments Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1: mm: memcg: deprecate the non-hierarchical mode docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy Hui Su <sh_def@163.com>: mm/page_counter: use page_counter_read in page_counter_set_max Lukas Bulwahn <lukas.bulwahn@gmail.com>: mm: memcg: remove obsolete memcg_has_children() Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: sssign boolean values to a bool variable Alex Shi <alex.shi@linux.alibaba.com>: mm/memcg: remove incorrect comment Shakeel Butt <shakeelb@google.com>: Patch series "memcg: add pagetable comsumption to memory.stat", v2: mm: move lruvec stats update functions to vmstat.h mm: memcontrol: account pagetables per node Subsystem: mm/pagemap Dan Williams <dan.j.williams@intel.com>: xen/unpopulated-alloc: consolidate pgmap manipulation Kalesh Singh <kaleshsingh@google.com>: Patch series "Speed up mremap on large regions", v4: kselftests: vm: add mremap tests mm: speedup mremap on 1GB or larger regions arm64: mremap speedup - enable HAVE_MOVE_PUD x86: mremap speedup - Enable HAVE_MOVE_PUD John Hubbard <jhubbard@nvidia.com>: mm: cleanup: remove unused tsk arg from __access_remote_vm Alex Shi <alex.shi@linux.alibaba.com>: mm/mapping_dirty_helpers: enhance the kernel-doc markups mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte Axel Rasmussen <axelrasmussen@google.com>: mm: mmap_lock: add tracepoints around lock acquisition "Matthew Wilcox (Oracle)" <willy@infradead.org>: sparc: fix handling of page table constructor failure mm: move free_unref_page to mm/internal.h Subsystem: mm/mremap Dmitry Safonov <dima@arista.com>: Patch series "mremap: move_vma() fixes": mm/mremap: account memory on do_munmap() failure mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm() mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio vm_ops: rename .split() callback to .may_split() mremap: check if it's possible to split original vma mm: forbid splitting special mappings Subsystem: mm/hmm Daniel Vetter <daniel.vetter@ffwll.ch>: mm: track mmu notifiers in fs_reclaim_acquire/release mm: extract might_alloc() debug check locking/selftests: add testcases for fs_reclaim Subsystem: mm/vmalloc Andrew Morton <akpm@linux-foundation.org>: mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: use free_vm_area() if an allocation fails mm/vmalloc: rework the drain logic Alex Shi <alex.shi@linux.alibaba.com>: mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse Baolin Wang <baolin.wang@linux.alibaba.com>: mm/vmalloc.c: remove unnecessary return statement Waiman Long <longman@redhat.com>: mm/vmalloc: Fix unlock order in s_stop() Subsystem: mm/documentation Alex Shi <alex.shi@linux.alibaba.com>: docs/vm: remove unused 3 items explanation for /proc/vmstat Subsystem: mm/kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: mm/vmalloc.c: fix kasan shadow poisoning size Walter Wu <walter-zh.wu@mediatek.com>: Patch series "kasan: add workqueue stack for generic KASAN", v5: workqueue: kasan: record workqueue stack kasan: print workqueue stack lib/test_kasan.c: add workqueue test case kasan: update documentation for generic kasan Marco Elver <elver@google.com>: lkdtm: disable KASAN for rodata.o Subsystem: mm/pagealloc Mike Rapoport <rppt@linux.ibm.com>: Patch series "arch, mm: deprecate DISCONTIGMEM", v2: alpha: switch from DISCONTIGMEM to SPARSEMEM ia64: remove custom __early_pfn_to_nid() ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements ia64: discontig: paging_init(): remove local max_pfn calculation ia64: split virtual map initialization out of paging_init() ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM ia64: make SPARSEMEM default and disable DISCONTIGMEM arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL arm, arm64: move free_unused_memmap() to generic mm arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM m68k: deprecate DISCONTIGMEM Patch series "arch, mm: improve robustness of direct map manipulation", v7: mm: introduce debug_pagealloc_{map,unmap}_pages() helpers PM: hibernate: make direct map manipulations more explicit arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC arch, mm: make kernel_page_present() always available Vlastimil Babka <vbabka@suse.cz>: Patch series "disable pcplists during memory offline", v3: mm, page_alloc: clean up pageset high and batch update mm, page_alloc: calculate pageset high and batch once per zone mm, page_alloc: remove setup_pageset() mm, page_alloc: simplify pageset_update() mm, page_alloc: cache pageset high and batch in struct zone mm, page_alloc: move draining pcplists to page isolation users mm, page_alloc: disable pcplists during memory offline Miaohe Lin <linmiaohe@huawei.com>: include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/page-flags: fix comment mm/page_alloc: add __free_pages() documentation Zou Wei <zou_wei@huawei.com>: mm/page_alloc: mark some symbols with static keyword David Hildenbrand <david@redhat.com>: mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1 Lin Feng <linf@wangsu.com>: init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set Lorenzo Stoakes <lstoakes@gmail.com>: mm: page_alloc: refactor setup_per_zone_lowmem_reserve() Muchun Song <songmuchun@bytedance.com>: mm/page_alloc: speed up the iteration of max_order Subsystem: mm/memory-failure Oscar Salvador <osalvador@suse.de>: Patch series "HWpoison: further fixes and cleanups", v5: mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page mm,hwpoison: take free pages off the buddy freelists mm,hwpoison: drop unneeded pcplist draining Patch series "HWPoison: Refactor get page interface", v2: mm,hwpoison: refactor get_any_page mm,hwpoison: disable pcplists before grabbing a refcount mm,hwpoison: remove drain_all_pages from shake_page mm,memory_failure: always pin the page in madvise_inject_error mm,hwpoison: return -EBUSY when migration fails Subsystem: mm/hugetlb Hui Su <sh_def@163.com>: mm/hugetlb.c: just use put_page_testzero() instead of page_count() Ralph Campbell <rcampbell@nvidia.com>: include/linux/huge_mm.h: remove extern keyword Alex Shi <alex.shi@linux.alibaba.com>: khugepaged: add parameter explanations for kernel-doc markup Liu Xiang <liu.xiang@zlingsmart.com>: mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages() Oscar Salvador <osalvador@suse.de>: mm,hugetlb: remove unneeded initialization Dan Carpenter <dan.carpenter@oracle.com>: hugetlb: fix an error code in hugetlb_reserve_pages() Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: mm: don't wake kswapd prematurely when watermark boosting is disabled Lukas Bulwahn <lukas.bulwahn@gmail.com>: mm/vmscan: drop unneeded assignment in kswapd() "logic.yu" <hymmsx.yu@gmail.com>: mm/vmscan.c: remove the filename in the top of file comment Muchun Song <songmuchun@bytedance.com>: mm/page_isolation: do not isolate the max order page Subsystem: mm/z3fold Vitaly Wool <vitaly.wool@konsulko.com>: Patch series "z3fold: stability / rt fixes": z3fold: simplify freeing slots z3fold: stricter locking and more careful reclaim z3fold: remove preempt disabled sections for RT Subsystem: mm/compaction Yanfei Xu <yanfei.xu@windriver.com>: mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone() Hui Su <sh_def@163.com>: mm/compaction: move compaction_suitable's comment to right place mm/compaction: make defer_compaction and compaction_deferred static Subsystem: mm/oom-kill Hui Su <sh_def@163.com>: mm/oom_kill: change comment and rename is_dump_unreclaim_slabs() Subsystem: mm/migration Long Li <lonuxli.64@gmail.com>: mm/migrate.c: fix comment spelling Ralph Campbell <rcampbell@nvidia.com>: mm/migrate.c: optimize migrate_vma_pages() mmu notifier "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: support THPs in zero_user_segments Yang Shi <shy828301@gmail.com>: Patch series "mm: misc migrate cleanup and improvement", v3: mm: truncate_complete_page() does not exist any more mm: migrate: simplify the logic for handling permanent failure mm: migrate: skip shared exec THP for NUMA balancing mm: migrate: clean up migrate_prep{_local} mm: migrate: return -ENOSYS if THP migration is unsupported Stephen Zhang <starzhangzsd@gmail.com>: mm: migrate: remove unused parameter in migrate_vma_insert_page() Subsystem: mm/cma Lecopzer Chen <lecopzer.chen@mediatek.com>: mm/cma.c: remove redundant cma_mutex lock Charan Teja Reddy <charante@codeaurora.org>: mm: cma: improve pr_debug log in cma_release() Subsystem: mm/page-poison Vlastimil Babka <vbabka@suse.cz>: Patch series "cleanup page poisoning", v3: mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters mm, page_poison: use static key more efficiently kernel/power: allow hibernation with page_poison sanity checking mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO Subsystem: mm/userfaultfd Lokesh Gidra <lokeshgidra@google.com>: Patch series "Control over userfaultfd kernel-fault handling", v6: userfaultfd: add UFFD_USER_MODE_ONLY userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: selftests: make __{s,u}64 format specifiers portable Peter Xu <peterx@redhat.com>: Patch series "userfaultfd: selftests: Small fixes": userfaultfd/selftests: always dump something in modes userfaultfd/selftests: fix retval check for userfaultfd_open() userfaultfd/selftests: hint the test runner on required privilege Subsystem: mm/zswap Joe Perches <joe@perches.com>: mm/zswap: make struct kernel_param_ops definitions const YueHaibing <yuehaibing@huawei.com>: mm/zswap: fix passing zero to 'PTR_ERR' warning Barry Song <song.bao.hua@hisilicon.com>: mm/zswap: move to use crypto_acomp API for hardware acceleration Subsystem: mm/zsmalloc Miaohe Lin <linmiaohe@huawei.com>: mm/zsmalloc.c: rework the list_add code in insert_zspage() Subsystem: mm/uaccess Colin Ian King <colin.king@canonical.com>: mm/process_vm_access: remove redundant initialization of iov_r Subsystem: mm/zram Minchan Kim <minchan@kernel.org>: zram: support page writeback zram: add stat to gather incompressible pages since zram set up Rui Salvaterra <rsalvaterra@gmail.com>: zram: break the strict dependency from lzo Subsystem: mm/cleanups Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: mm: fix kernel-doc markups Joe Perches <joe@perches.com>: Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2: mm: use sysfs_emit for struct kobject * uses mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening mm:backing-dev: use sysfs_emit in macro defining functions mm: shmem: convert shmem_enabled_show to use sysfs_emit_at mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at "Gustavo A. R. Silva" <gustavoars@kernel.org>: mm: fix fall-through warnings for Clang Alexey Dobriyan <adobriyan@gmail.com>: mm: cleanup kstrto*() usage /mmap_lock.h | 107 ++ a/Documentation/admin-guide/blockdev/zram.rst | 6 a/Documentation/admin-guide/cgroup-v1/memcg_test.rst | 8 a/Documentation/admin-guide/cgroup-v1/memory.rst | 42 a/Documentation/admin-guide/cgroup-v2.rst | 11 a/Documentation/admin-guide/mm/transhuge.rst | 15 a/Documentation/admin-guide/sysctl/vm.rst | 15 a/Documentation/core-api/memory-allocation.rst | 4 a/Documentation/core-api/pin_user_pages.rst | 8 a/Documentation/dev-tools/kasan.rst | 5 a/Documentation/filesystems/tmpfs.rst | 8 a/Documentation/vm/memory-model.rst | 3 a/Documentation/vm/page_owner.rst | 12 a/arch/Kconfig | 21 a/arch/alpha/Kconfig | 8 a/arch/alpha/include/asm/mmzone.h | 14 a/arch/alpha/include/asm/page.h | 7 a/arch/alpha/include/asm/pgtable.h | 12 a/arch/alpha/include/asm/sparsemem.h | 18 a/arch/alpha/kernel/setup.c | 1 a/arch/arc/Kconfig | 3 a/arch/arc/include/asm/page.h | 20 a/arch/arc/mm/init.c | 29 a/arch/arm/Kconfig | 12 a/arch/arm/kernel/vdso.c | 9 a/arch/arm/mach-bcm/Kconfig | 1 a/arch/arm/mach-davinci/Kconfig | 1 a/arch/arm/mach-exynos/Kconfig | 1 a/arch/arm/mach-highbank/Kconfig | 1 a/arch/arm/mach-omap2/Kconfig | 1 a/arch/arm/mach-s5pv210/Kconfig | 1 a/arch/arm/mach-tango/Kconfig | 1 a/arch/arm/mm/init.c | 78 - a/arch/arm64/Kconfig | 9 a/arch/arm64/include/asm/cacheflush.h | 1 a/arch/arm64/include/asm/pgtable.h | 1 a/arch/arm64/kernel/vdso.c | 41 a/arch/arm64/mm/init.c | 68 - a/arch/arm64/mm/pageattr.c | 12 a/arch/ia64/Kconfig | 11 a/arch/ia64/include/asm/meminit.h | 2 a/arch/ia64/mm/contig.c | 88 -- a/arch/ia64/mm/discontig.c | 44 - a/arch/ia64/mm/init.c | 14 a/arch/ia64/mm/numa.c | 30 a/arch/m68k/Kconfig.cpu | 31 a/arch/m68k/include/asm/page.h | 2 a/arch/m68k/include/asm/page_mm.h | 7 a/arch/m68k/include/asm/virtconvert.h | 7 a/arch/m68k/mm/init.c | 10 a/arch/mips/vdso/genvdso.c | 4 a/arch/nds32/mm/mm-nds32.c | 6 a/arch/powerpc/Kconfig | 5 a/arch/riscv/Kconfig | 4 a/arch/riscv/include/asm/pgtable.h | 2 a/arch/riscv/include/asm/set_memory.h | 1 a/arch/riscv/mm/pageattr.c | 31 a/arch/s390/Kconfig | 4 a/arch/s390/configs/debug_defconfig | 2 a/arch/s390/configs/defconfig | 2 a/arch/s390/kernel/vdso.c | 11 a/arch/sparc/Kconfig | 4 a/arch/sparc/mm/init_64.c | 2 a/arch/x86/Kconfig | 5 a/arch/x86/entry/vdso/vma.c | 17 a/arch/x86/include/asm/set_memory.h | 1 a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2 a/arch/x86/kernel/tboot.c | 1 a/arch/x86/mm/pat/set_memory.c | 6 a/drivers/base/node.c | 2 a/drivers/block/zram/Kconfig | 42 a/drivers/block/zram/zcomp.c | 2 a/drivers/block/zram/zram_drv.c | 29 a/drivers/block/zram/zram_drv.h | 1 a/drivers/dax/device.c | 4 a/drivers/dax/kmem.c | 2 a/drivers/dma-buf/sync_file.c | 3 a/drivers/edac/ghes_edac.c | 4 a/drivers/firmware/efi/efi.c | 1 a/drivers/gpu/drm/drm_atomic.c | 3 a/drivers/hwtracing/intel_th/msu.c | 2 a/drivers/ide/falconide.c | 2 a/drivers/ide/ide-probe.c | 3 a/drivers/misc/lkdtm/Makefile | 1 a/drivers/pinctrl/pinctrl-utils.c | 2 a/drivers/vhost/vringh.c | 3 a/drivers/virtio/virtio_balloon.c | 6 a/drivers/xen/unpopulated-alloc.c | 14 a/fs/aio.c | 5 a/fs/ntfs/file.c | 5 a/fs/ntfs/inode.c | 2 a/fs/ntfs/logfile.c | 3 a/fs/ocfs2/cluster/tcp.c | 1 a/fs/ocfs2/namei.c | 4 a/fs/proc/kcore.c | 2 a/fs/proc/meminfo.c | 2 a/fs/userfaultfd.c | 20 a/include/linux/cgroup-defs.h | 15 a/include/linux/compaction.h | 12 a/include/linux/fs.h | 2 a/include/linux/gfp.h | 2 a/include/linux/highmem.h | 19 a/include/linux/huge_mm.h | 93 -- a/include/linux/memcontrol.h | 148 --- a/include/linux/migrate.h | 4 a/include/linux/mm.h | 118 +- a/include/linux/mm_types.h | 8 a/include/linux/mmap_lock.h | 94 ++ a/include/linux/mmzone.h | 50 - a/include/linux/page-flags.h | 6 a/include/linux/page_ext.h | 8 a/include/linux/pagevec.h | 3 a/include/linux/poison.h | 4 a/include/linux/rmap.h | 1 a/include/linux/sched/mm.h | 16 a/include/linux/set_memory.h | 5 a/include/linux/shmem_fs.h | 6 a/include/linux/slab.h | 18 a/include/linux/vmalloc.h | 8 a/include/linux/vmstat.h | 104 ++ a/include/trace/events/sched.h | 84 + a/include/uapi/linux/const.h | 5 a/include/uapi/linux/ethtool.h | 2 a/include/uapi/linux/kernel.h | 9 a/include/uapi/linux/lightnvm.h | 2 a/include/uapi/linux/mroute6.h | 2 a/include/uapi/linux/netfilter/x_tables.h | 2 a/include/uapi/linux/netlink.h | 2 a/include/uapi/linux/sysctl.h | 2 a/include/uapi/linux/userfaultfd.h | 9 a/init/main.c | 6 a/ipc/shm.c | 8 a/kernel/cgroup/cgroup.c | 12 a/kernel/fork.c | 3 a/kernel/kthread.c | 29 a/kernel/power/hibernate.c | 2 a/kernel/power/power.h | 2 a/kernel/power/snapshot.c | 52 + a/kernel/ptrace.c | 2 a/kernel/workqueue.c | 3 a/lib/locking-selftest.c | 47 + a/lib/test_kasan_module.c | 29 a/mm/Kconfig | 25 a/mm/Kconfig.debug | 28 a/mm/Makefile | 4 a/mm/backing-dev.c | 8 a/mm/cma.c | 6 a/mm/compaction.c | 29 a/mm/filemap.c | 823 ++++++++++--------- a/mm/gup.c | 329 ++----- a/mm/gup_benchmark.c | 210 ---- a/mm/gup_test.c | 299 ++++++ a/mm/gup_test.h | 40 a/mm/highmem.c | 52 + a/mm/huge_memory.c | 86 + a/mm/hugetlb.c | 28 a/mm/init-mm.c | 1 a/mm/internal.h | 5 a/mm/kasan/generic.c | 3 a/mm/kasan/report.c | 4 a/mm/khugepaged.c | 58 - a/mm/ksm.c | 50 - a/mm/madvise.c | 14 a/mm/mapping_dirty_helpers.c | 6 a/mm/memblock.c | 80 + a/mm/memcontrol.c | 170 +-- a/mm/memory-failure.c | 322 +++---- a/mm/memory.c | 24 a/mm/memory_hotplug.c | 44 - a/mm/mempolicy.c | 8 a/mm/migrate.c | 183 ++-- a/mm/mm_init.c | 1 a/mm/mmap.c | 22 a/mm/mmap_lock.c | 230 +++++ a/mm/mmu_notifier.c | 7 a/mm/mmzone.c | 14 a/mm/mremap.c | 282 ++++-- a/mm/nommu.c | 8 a/mm/oom_kill.c | 14 a/mm/page_alloc.c | 517 ++++++----- a/mm/page_counter.c | 4 a/mm/page_ext.c | 10 a/mm/page_isolation.c | 18 a/mm/page_owner.c | 17 a/mm/page_poison.c | 56 - a/mm/page_vma_mapped.c | 9 a/mm/process_vm_access.c | 2 a/mm/rmap.c | 9 a/mm/shmem.c | 39 a/mm/slab.c | 10 a/mm/slab.h | 9 a/mm/slab_common.c | 10 a/mm/slob.c | 6 a/mm/slub.c | 156 +-- a/mm/swap.c | 12 a/mm/swap_state.c | 7 a/mm/swapfile.c | 14 a/mm/truncate.c | 18 a/mm/vmalloc.c | 105 +- a/mm/vmscan.c | 21 a/mm/vmstat.c | 6 a/mm/workingset.c | 8 a/mm/z3fold.c | 215 ++-- a/mm/zsmalloc.c | 11 a/mm/zswap.c | 193 +++- a/sound/core/pcm_lib.c | 4 a/tools/include/linux/poison.h | 6 a/tools/testing/selftests/vm/.gitignore | 4 a/tools/testing/selftests/vm/Makefile | 41 a/tools/testing/selftests/vm/check_config.sh | 31 a/tools/testing/selftests/vm/config | 2 a/tools/testing/selftests/vm/gup_benchmark.c | 143 --- a/tools/testing/selftests/vm/gup_test.c | 258 +++++ a/tools/testing/selftests/vm/hmm-tests.c | 10 a/tools/testing/selftests/vm/mremap_test.c | 344 +++++++ a/tools/testing/selftests/vm/run_vmtests | 51 - a/tools/testing/selftests/vm/userfaultfd.c | 94 -- 217 files changed, 4817 insertions(+), 3369 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-12-15 3:02 incoming Andrew Morton @ 2020-12-15 3:25 ` Linus Torvalds 2020-12-15 3:30 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2020-12-15 3:25 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442. I haven't actually processed the patches yet, but I have a question for Konstantin wrt b4. All the patches except for _one_ get a nice little green check-mark next to them when I use 'git am' on this series. The one that did not was [patch 192/200]. I have no idea why - and it doesn't matter a lot to me, it just stood out as being different. I'm assuming Andrew has started doing patch attestation, and that patch failed. But if so, maybe Konstantin wants to know what went wrong. Konstantin? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-12-15 3:25 ` incoming Linus Torvalds @ 2020-12-15 3:30 ` Linus Torvalds 2020-12-15 14:04 ` incoming Konstantin Ryabitsev 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2020-12-15 3:30 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > All the patches except for _one_ get a nice little green check-mark > next to them when I use 'git am' on this series. > > The one that did not was [patch 192/200]. > > I have no idea why Hmm. It looks like that patch is the only one in the series with the ">From" marker in the commit message, from the silly "clarify that this isn't the first line in a new message in mbox format". And "b4 am" has turned the single ">" into two, making the stupid marker worse, and actually corrupting the end result. Coincidence? Or cause? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-12-15 3:30 ` incoming Linus Torvalds @ 2020-12-15 14:04 ` Konstantin Ryabitsev 0 siblings, 0 replies; 389+ messages in thread From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote: > > All the patches except for _one_ get a nice little green check-mark > > next to them when I use 'git am' on this series. > > > > The one that did not was [patch 192/200]. > > > > I have no idea why > > Hmm. It looks like that patch is the only one in the series with the > ">From" marker in the commit message, from the silly "clarify that > this isn't the first line in a new message in mbox format". > > And "b4 am" has turned the single ">" into two, making the stupid > marker worse, and actually corrupting the end result. It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted .mbox files, while Python's mailbox.mbox consumes mboxo only. The main distinction between the two is precisely that mboxrd will convert ">From " into ">>From " in an attempt to avoid corruption during escape/unescape (it didn't end up fixing the problem 100% and mostly introduced incompatibilities like this one). I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the end of the week. Thanks for the report. -K ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-12-11 21:35 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c. Subsystems affected by this patch series: mm/pagecache proc selftests kbuild mm/kasan mm/hugetlb Subsystem: mm/pagecache Andrew Morton <akpm@linux-foundation.org>: revert "mm/filemap: add static for function __add_to_page_cache_locked" Subsystem: proc Miles Chen <miles.chen@mediatek.com>: proc: use untagged_addr() for pagemap_read addresses Subsystem: selftests Arnd Bergmann <arnd@arndb.de>: selftest/fpu: avoid clang warning Subsystem: kbuild Arnd Bergmann <arnd@arndb.de>: kbuild: avoid static_assert for genksyms initramfs: fix clang build failure elfcore: fix building with clang Subsystem: mm/kasan Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>: kasan: fix object remaining in offline per-cpu quarantine Subsystem: mm/hugetlb Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/hugetlb: clear compound_nr before freeing gigantic pages fs/proc/task_mmu.c | 8 ++++++-- include/linux/build_bug.h | 5 +++++ include/linux/elfcore.h | 22 ++++++++++++++++++++++ init/initramfs.c | 2 +- kernel/Makefile | 1 - kernel/elfcore.c | 26 -------------------------- lib/Makefile | 3 ++- mm/filemap.c | 2 +- mm/hugetlb.c | 1 + mm/kasan/quarantine.c | 39 +++++++++++++++++++++++++++++++++++++++ 10 files changed, 77 insertions(+), 32 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-12-06 6:14 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-12-06 6:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59. Subsystems affected by this patch series: lib coredump mm/memcg mm/zsmalloc mm/swap mailmap mm/selftests mm/pagecache mm/hugetlb mm/pagemap Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: zlib: export S390 symbols for zlib modules Subsystem: coredump Menglong Dong <dong.menglong@zte.com.cn>: coredump: fix core_pattern parse error Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix obj_cgroup_charge() return value handling Yang Shi <shy828301@gmail.com>: mm: list_lru: set shrinker map bit when child nr_items is not zero Subsystem: mm/zsmalloc Minchan Kim <minchan@kernel.org>: mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING Subsystem: mm/swap Qian Cai <qcai@redhat.com>: mm/swapfile: do not sleep with a spin lock held Subsystem: mailmap Uwe Kleine-König <u.kleine-koenig@pengutronix.de>: mailmap: add two more addresses of Uwe Kleine-König Subsystem: mm/selftests Xingxing Su <suxingxing@loongson.cn>: tools/testing/selftests/vm: fix build error Axel Rasmussen <axelrasmussen@google.com>: userfaultfd: selftests: fix SIGSEGV if huge mmap fails Subsystem: mm/pagecache Alex Shi <alex.shi@linux.alibaba.com>: mm/filemap: add static for function __add_to_page_cache_locked Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: hugetlb_cgroup: fix offline of hugetlb cgroup with reservations Subsystem: mm/pagemap Liu Zixian <liuzixian4@huawei.com>: mm/mmap.c: fix mmap return value when vma is merged after call_mmap() .mailmap | 2 + arch/arm/configs/omap2plus_defconfig | 1 fs/coredump.c | 3 + include/linux/zsmalloc.h | 1 lib/zlib_dfltcc/dfltcc_inflate.c | 3 + mm/Kconfig | 13 ------- mm/filemap.c | 2 - mm/hugetlb_cgroup.c | 8 +--- mm/list_lru.c | 10 ++--- mm/mmap.c | 26 ++++++-------- mm/slab.h | 40 +++++++++++++--------- mm/swapfile.c | 4 +- mm/zsmalloc.c | 54 ------------------------------- tools/testing/selftests/vm/Makefile | 4 ++ tools/testing/selftests/vm/userfaultfd.c | 25 +++++++++----- 15 files changed, 75 insertions(+), 121 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-11-22 6:16 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-11-22 6:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95. Subsystems affected by this patch series: mm/madvise kbuild mm/pagemap mm/readahead mm/memcg mm/userfaultfd vfs-akpm mm/madvise Subsystem: mm/madvise Eric Dumazet <edumazet@google.com>: mm/madvise: fix memory leak from process_madvise Subsystem: kbuild Nick Desaulniers <ndesaulniers@google.com>: compiler-clang: remove version check for BPF Tracing Subsystem: mm/pagemap Dan Williams <dan.j.williams@intel.com>: mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports Subsystem: mm/readahead "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix readahead_page_batch for retry entries Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix root memcg vmstats Subsystem: mm/userfaultfd Gerald Schaefer <gerald.schaefer@linux.ibm.com>: mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault() Subsystem: vfs-akpm Yicong Yang <yangyicong@hisilicon.com>: libfs: fix error cast of negative value in simple_attr_write() Subsystem: mm/madvise "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: fix madvise WILLNEED performance problem arch/ia64/include/asm/sparsemem.h | 6 ++++++ arch/powerpc/include/asm/mmzone.h | 5 +++++ arch/powerpc/include/asm/sparsemem.h | 5 ++--- arch/powerpc/mm/mem.c | 1 + arch/x86/include/asm/sparsemem.h | 10 ++++++++++ arch/x86/mm/numa.c | 2 ++ drivers/dax/Kconfig | 1 - fs/libfs.c | 6 ++++-- include/linux/compiler-clang.h | 2 ++ include/linux/memory_hotplug.h | 14 -------------- include/linux/numa.h | 30 +++++++++++++++++++++++++++++- include/linux/pagemap.h | 2 ++ mm/huge_memory.c | 9 ++++----- mm/madvise.c | 4 +--- mm/memcontrol.c | 9 +++++++-- mm/memory_hotplug.c | 18 ------------------ 16 files changed, 75 insertions(+), 49 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-11-14 6:51 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-11-14 6:51 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81. Subsystems affected by this patch series: mm/migration mm/vmscan mailmap mm/slub mm/gup kbuild reboot kernel/watchdog mm/memcg mm/hugetlbfs panic ocfs2 Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm/compaction: count pages and stop correctly during page isolation mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate Subsystem: mm/vmscan Nicholas Piggin <npiggin@gmail.com>: mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit Subsystem: mailmap Dmitry Baryshkov <dbaryshkov@gmail.com>: mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov Subsystem: mm/slub Laurent Dufour <ldufour@linux.ibm.com>: mm/slub: fix panic in slab_alloc_node() Subsystem: mm/gup Jason Gunthorpe <jgg@nvidia.com>: mm/gup: use unpin_user_pages() in __gup_longterm_locked() Subsystem: kbuild Arvind Sankar <nivedita@alum.mit.edu>: compiler.h: fix barrier_data() on clang Subsystem: reboot Matteo Croce <mcroce@microsoft.com>: Patch series "fix parsing of reboot= cmdline", v3: Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint" reboot: fix overflow parsing reboot cpu number Subsystem: kernel/watchdog Santosh Sivaraj <santosh@fossix.org>: kernel/watchdog: fix watchdog_allowed_mask not used warning Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix missing wakeup polling thread Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: fix anon huge page migration race Subsystem: panic Christophe Leroy <christophe.leroy@csgroup.eu>: panic: don't dump stack twice on warn Subsystem: ocfs2 Wengang Wang <wen.gang.wang@oracle.com>: ocfs2: initialize ip_next_orphan .mailmap | 5 +- fs/ocfs2/super.c | 1 include/asm-generic/barrier.h | 1 include/linux/compiler-clang.h | 6 -- include/linux/compiler-gcc.h | 19 -------- include/linux/compiler.h | 18 +++++++- include/linux/memcontrol.h | 11 ++++- kernel/panic.c | 3 - kernel/reboot.c | 28 ++++++------ kernel/watchdog.c | 4 - mm/compaction.c | 12 +++-- mm/gup.c | 14 ++++-- mm/hugetlb.c | 90 ++--------------------------------------- mm/memory-failure.c | 36 +++++++--------- mm/migrate.c | 46 +++++++++++--------- mm/rmap.c | 5 -- mm/slub.c | 2 mm/vmscan.c | 5 +- 18 files changed, 119 insertions(+), 187 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-11-02 1:06 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-11-02 1:06 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891. Subsystems affected by this patch series: mm/memremap mm/memcg mm/slab-generic mm/kasan mm/mempolicy signals lib mm/pagecache kthread mm/oom-kill mm/pagemap epoll core-kernel Subsystem: mm/memremap Ralph Campbell <rcampbell@nvidia.com>: mm/mremap_pages: fix static key devmap_managed_key updates Subsystem: mm/memcg Mike Kravetz <mike.kravetz@oracle.com>: hugetlb_cgroup: fix reservation accounting zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>: mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg Roman Gushchin <guro@fb.com>: mm: memcg: link page counters to root if use_hierarchy is false Subsystem: mm/slab-generic Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: adopt KUNIT tests to SW_TAGS mode Subsystem: mm/mempolicy Shijie Luo <luoshijie1@huawei.com>: mm: mempolicy: fix potential pte_unmap_unlock pte error Subsystem: signals Oleg Nesterov <oleg@redhat.com>: ptrace: fix task_join_group_stop() for the case when current is traced Subsystem: lib Vasily Gorbik <gor@linux.ibm.com>: lib/crc32test: remove extra local_irq_disable/enable Subsystem: mm/pagecache Jason Yan <yanaijie@huawei.com>: mm/truncate.c: make __invalidate_mapping_pages() static Subsystem: kthread Zqiang <qiang.zhang@windriver.com>: kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled Subsystem: mm/oom-kill Charles Haithcock <chaithco@redhat.com>: mm, oom: keep oom_adj under or at upper limit when printing Subsystem: mm/pagemap Jason Gunthorpe <jgg@nvidia.com>: mm: always have io_remap_pfn_range() set pgprot_decrypted() Subsystem: epoll Soheil Hassas Yeganeh <soheil@google.com>: epoll: check ep_events_available() upon timeout epoll: add a selftest for epoll timeout race Subsystem: core-kernel Lukas Bulwahn <lukas.bulwahn@gmail.com>: kernel/hung_task.c: make type annotations consistent fs/eventpoll.c | 16 + fs/proc/base.c | 2 include/linux/mm.h | 9 include/linux/pgtable.h | 4 kernel/hung_task.c | 3 kernel/kthread.c | 3 kernel/signal.c | 19 - lib/crc32test.c | 4 lib/test_kasan.c | 149 +++++++--- mm/hugetlb.c | 20 - mm/memcontrol.c | 25 + mm/mempolicy.c | 6 mm/memremap.c | 39 +- mm/truncate.c | 2 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 95 ++++++ 15 files changed, 290 insertions(+), 106 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-10-17 23:13 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53. Subsystems affected by this patch series: ia64 mm/memcg mm/migration mm/pagemap mm/gup mm/madvise mm/vmalloc misc Subsystem: ia64 Krzysztof Kozlowski <krzk@kernel.org>: ia64: fix build error with !COREDUMP Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm, memcg: rework remote charging API to support nesting Patch series "mm: kmem: kernel memory accounting in an interrupt context": mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current() mm: kmem: remove redundant checks from get_obj_cgroup_from_current() mm: kmem: prepare remote memcg charging infra for interrupt contexts mm: kmem: enable kernel memcg accounting from interrupt contexts Subsystem: mm/migration Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/memory-failure: remove a wrapper for alloc_migration_target() mm/memory_hotplug: remove a wrapper for alloc_migration_target() Miaohe Lin <linmiaohe@huawei.com>: mm/migrate: avoid possible unnecessary process right check in kernel_move_pages() Subsystem: mm/pagemap "Liam R. Howlett" <Liam.Howlett@Oracle.com>: mm/mmap: add inline vma_next() for readability of mmap code mm/mmap: add inline munmap_vma_range() for code readability Subsystem: mm/gup Jann Horn <jannh@google.com>: mm/gup_benchmark: take the mmap lock around GUP binfmt_elf: take the mmap lock around find_extend_vma() mm/gup: assert that the mmap lock is held in __get_user_pages() John Hubbard <jhubbard@nvidia.com>: Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2: mm/gup_benchmark: rename to mm/gup_test selftests/vm: use a common gup_test.h selftests/vm: rename run_vmtests --> run_vmtests.sh selftests/vm: minor cleanup: Makefile and gup_test.c selftests/vm: only some gup_test items are really benchmarks selftests/vm: gup_test: introduce the dump_pages() sub-test selftests/vm: run_vmtests.sh: update and clean up gup_test invocation selftests/vm: hmm-tests: remove the libhugetlbfs dependency selftests/vm: 10x speedup for hmm-tests Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v9: mm/madvise: pass mm to do_madvise pid: move pidfd_get_pid() to pid.c mm/madvise: introduce process_madvise() syscall: an external memory hinting API Subsystem: mm/vmalloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "remove alloc_vm_area", v4: mm: update the documentation for vfree Christoph Hellwig <hch@lst.de>: mm: add a VM_MAP_PUT_PAGES flag for vmap mm: add a vmap_pfn function mm: allow a NULL fn callback in apply_to_page_range zsmalloc: switch from alloc_vm_area to get_vm_area drm/i915: use vmap in shmem_pin_map drm/i915: stop using kmap in i915_gem_object_map drm/i915: use vmap in i915_gem_object_map xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv x86/xen: open code alloc_vm_area in arch_gnttab_valloc mm: remove alloc_vm_area Patch series "two small vmalloc cleanups": mm: cleanup the gfp_mask handling in __vmalloc_area_node mm: remove the filename in the top of file comment in vmalloc.c Subsystem: misc Tian Tao <tiantao6@hisilicon.com>: mm: remove duplicate include statement in mmu.c Documentation/core-api/pin_user_pages.rst | 8 arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/mm/mmu.c | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 2 arch/ia64/kernel/Makefile | 2 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 1 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 1 arch/parisc/kernel/syscalls/syscall.tbl | 1 arch/powerpc/kernel/syscalls/syscall.tbl | 1 arch/s390/configs/debug_defconfig | 2 arch/s390/configs/defconfig | 2 arch/s390/kernel/syscalls/syscall.tbl | 1 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 1 arch/x86/entry/syscalls/syscall_32.tbl | 1 arch/x86/entry/syscalls/syscall_64.tbl | 1 arch/x86/xen/grant-table.c | 27 +- arch/xtensa/kernel/syscalls/syscall.tbl | 1 drivers/gpu/drm/i915/Kconfig | 1 drivers/gpu/drm/i915/gem/i915_gem_pages.c | 136 ++++------ drivers/gpu/drm/i915/gt/shmem_utils.c | 78 +----- drivers/xen/xenbus/xenbus_client.c | 30 +- fs/binfmt_elf.c | 3 fs/buffer.c | 6 fs/io_uring.c | 2 fs/notify/fanotify/fanotify.c | 5 fs/notify/inotify/inotify_fsnotify.c | 5 include/linux/memcontrol.h | 12 include/linux/mm.h | 2 include/linux/pid.h | 1 include/linux/sched/mm.h | 43 +-- include/linux/syscalls.h | 2 include/linux/vmalloc.h | 7 include/uapi/asm-generic/unistd.h | 4 kernel/exit.c | 19 - kernel/pid.c | 19 + kernel/sys_ni.c | 1 mm/Kconfig | 24 + mm/Makefile | 2 mm/gup.c | 2 mm/gup_benchmark.c | 225 ------------------ mm/gup_test.c | 295 +++++++++++++++++++++-- mm/gup_test.h | 40 ++- mm/madvise.c | 125 ++++++++-- mm/memcontrol.c | 83 ++++-- mm/memory-failure.c | 18 - mm/memory.c | 16 - mm/memory_hotplug.c | 46 +-- mm/migrate.c | 71 +++-- mm/mmap.c | 74 ++++- mm/nommu.c | 7 mm/percpu.c | 3 mm/slab.h | 3 mm/vmalloc.c | 147 +++++------ mm/zsmalloc.c | 10 tools/testing/selftests/vm/.gitignore | 3 tools/testing/selftests/vm/Makefile | 40 ++- tools/testing/selftests/vm/check_config.sh | 31 ++ tools/testing/selftests/vm/config | 2 tools/testing/selftests/vm/gup_benchmark.c | 143 ----------- tools/testing/selftests/vm/gup_test.c | 260 ++++++++++++++++++-- tools/testing/selftests/vm/hmm-tests.c | 12 tools/testing/selftests/vm/run_vmtests | 334 -------------------------- tools/testing/selftests/vm/run_vmtests.sh | 350 +++++++++++++++++++++++++++- 70 files changed, 1580 insertions(+), 1224 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-10-16 2:40 Andrew Morton 2020-10-16 3:03 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-10-16 2:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - most of the rest of mm/ - various other subsystems 156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d. Subsystems affected by this patch series: mm/dax mm/debug mm/thp mm/readahead mm/page-poison mm/util mm/memory-hotplug mm/zram mm/cleanups misc core-kernel get_maintainer MAINTAINERS lib bitops checkpatch binfmt ramfs autofs nilfs rapidio panic relay kgdb ubsan romfs fault-injection Subsystem: mm/dax Dan Williams <dan.j.williams@intel.com>: device-dax/kmem: fix resource release Subsystem: mm/debug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/debug_vm_pgtable fixes", v4: powerpc/mm: add DEBUG_VM WARN for pmd_clear powerpc/mm: move setting pte specific flags to pfn_pte mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support. mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry mm/debug_vm_pgtable/locks: move non page table modifying test together mm/debug_vm_pgtable/locks: take correct page table lock mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64 mm/debug_vm_pgtable: avoid none pte in pte_clear_test mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped. Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Fix read-only THP for non-tmpfs filesystems": XArray: add xa_get_order XArray: add xas_split mm/filemap: fix storing to a THP shadow entry Patch series "Remove assumptions of THP size": mm/filemap: fix page cache removal for arbitrary sized THPs mm/memory: remove page fault assumption of compound page size mm/page_owner: change split_page_owner to take a count "Kirill A. Shutemov" <kirill@shutemov.name>: mm/huge_memory: fix total_mapcount assumption of page size mm/huge_memory: fix split assumption of page size "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size mm/huge_memory: fix can_split_huge_page assumption of THP size mm/rmap: fix assumptions of THP size mm/truncate: fix truncation for pages of arbitrary size mm/page-writeback: support tail pages in wait_for_stable_page mm/vmscan: allow arbitrary sized pages to be paged out fs: add a filesystem flag for THPs fs: do not update nr_thps for mappings which support THPs Huang Ying <ying.huang@intel.com>: mm: fix a race during THP splitting Subsystem: mm/readahead "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Readahead patches for 5.9/5.10": mm/readahead: add DEFINE_READAHEAD mm/readahead: make page_cache_ra_unbounded take a readahead_control mm/readahead: make do_page_cache_ra take a readahead_control David Howells <dhowells@redhat.com>: mm/readahead: make ondemand_readahead take a readahead_control mm/readahead: pass readahead_control to force_page_cache_ra "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/readahead: add page_cache_sync_ra and page_cache_async_ra David Howells <dhowells@redhat.com>: mm/filemap: fold ra_submit into do_sync_mmap_readahead mm/readahead: pass a file_ra_state into force_page_cache_ra Subsystem: mm/page-poison Naoya Horiguchi <naoya.horiguchi@nec.com>: Patch series "HWPOISON: soft offline rework", v7: mm,hwpoison: cleanup unused PageHuge() check mm, hwpoison: remove recalculating hpage mm,hwpoison-inject: don't pin for hwpoison_filter Oscar Salvador <osalvador@suse.de>: mm,hwpoison: unexport get_hwpoison_page and make it static mm,hwpoison: refactor madvise_inject_error mm,hwpoison: kill put_hwpoison_page mm,hwpoison: unify THP handling for hard and soft offline mm,hwpoison: rework soft offline for free pages mm,hwpoison: rework soft offline for in-use pages mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page mm,hwpoison: return 0 if the page is already poisoned in soft-offline Naoya Horiguchi <naoya.horiguchi@nec.com>: mm,hwpoison: introduce MF_MSG_UNSPLIT_THP mm,hwpoison: double-check page count in __get_any_page() Oscar Salvador <osalvador@suse.de>: mm,hwpoison: try to narrow window race for free pages Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_poison.c: replace bool variable with static key Miaohe Lin <linmiaohe@huawei.com>: mm/vmstat.c: use helper macro abs() Subsystem: mm/util Bartosz Golaszewski <bgolaszewski@baylibre.com>: mm/util.c: update the kerneldoc for kstrdup_const() Jann Horn <jannh@google.com>: mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2: mm/memory_hotplug: inline __offline_pages() into offline_pages() mm/memory_hotplug: enforce section granularity when onlining/offlining mm/memory_hotplug: simplify page offlining mm/page_alloc: simplify __offline_isolated_pages() mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages() mm/page_isolation: simplify return value of start_isolate_page_range() mm/memory_hotplug: simplify page onlining mm/page_alloc: drop stale pageblock comment in memmap_init_zone*() mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone() mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory Patch series "selective merging of system ram resources", v4: kernel/resource: make release_mem_region_adjustable() never fail kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG mm/memory_hotplug: prepare passing flags to add_memory() and friends mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources virtio-mem: try to merge system ram resources xen/balloon: try to merge system ram resources hv_balloon: try to merge system ram resources kernel/resource: make iomem_resource implicit in release_mem_region_adjustable() Laurent Dufour <ldufour@linux.ibm.com>: mm: don't panic when links can't be created in sysfs David Hildenbrand <david@redhat.com>: Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2: mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag mm/page_alloc: place pages to tail in __putback_isolated_page() mm/page_alloc: move pages to tail in move_to_free_list() mm/page_alloc: place pages to tail in __free_pages_core() mm/memory_hotplug: update comment regarding zone shuffling Subsystem: mm/zram Douglas Anderson <dianders@chromium.org>: zram: failing to decompress is WARN_ON worthy Subsystem: mm/cleanups YueHaibing <yuehaibing@huawei.com>: mm/slab.h: remove duplicate include Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_reporting.c: drop stale list head check in page_reporting_cycle Ira Weiny <ira.weiny@intel.com>: mm/highmem.c: clean up endif comments Yu Zhao <yuzhao@google.com>: mm: use self-explanatory macros rather than "2" Miaohe Lin <linmiaohe@huawei.com>: mm: fix some broken comments Chen Tao <chentao3@hotmail.com>: mm: fix some comments formatting Xiaofei Tan <tanxiaofei@huawei.com>: mm/workingset.c: fix some doc warnings Miaohe Lin <linmiaohe@huawei.com>: mm: use helper function put_write_access() Mike Rapoport <rppt@linux.ibm.com>: include/linux/mmzone.h: remove unused early_pfn_valid() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: rename page_order() to buddy_order() Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: fs: configfs: delete repeated words in comments Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: split out min()/max() et al. helpers Subsystem: core-kernel Liao Pingfang <liao.pingfang@zte.com.cn>: kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map() Randy Dunlap <rdunlap@infradead.org>: kernel/: fix repeated words in comments kernel: acct.c: fix some kernel-doc nits Subsystem: get_maintainer Joe Perches <joe@perches.com>: get_maintainer: add test for file in VCS Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: get_maintainer: exclude MAINTAINERS file(s) from --git-fallback Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>: MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: bitmap: delete duplicated words lib: libcrc32c: delete duplicated words lib: decompress_bunzip2: delete duplicated words lib: dynamic_queue_limits: delete duplicated words + fix typo lib: earlycpio: delete duplicated words lib: radix-tree: delete duplicated words lib: syscall: delete duplicated words lib: test_sysctl: delete duplicated words lib/mpi/mpi-bit.c: fix spello of "functions" Stephen Boyd <swboyd@chromium.org>: lib/idr.c: document calling context for IDA APIs mustn't use locks lib/idr.c: document that ida_simple_{get,remove}() are deprecated Christophe JAILLET <christophe.jaillet@wanadoo.fr>: lib/scatterlist.c: avoid a double memset Miaohe Lin <linmiaohe@huawei.com>: lib/percpu_counter.c: use helper macro abs() Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/list.h: add a macro to test if entry is pointing to the head Dan Carpenter <dan.carpenter@oracle.com>: lib/test_hmm.c: fix an error code in dmirror_allocate_chunk() Tobias Jordan <kernel@cdqe.de>: lib/crc32.c: fix trivial typo in preprocessor condition Subsystem: bitops Wei Yang <richard.weiyang@linux.alibaba.com>: bitops: simplify get_count_order_long() bitops: use the same mechanism for get_count_order[_long] Subsystem: checkpatch Jerome Forissier <jerome@forissier.org>: checkpatch: add --kconfig-prefix Joe Perches <joe@perches.com>: checkpatch: move repeated word test checkpatch: add test for comma use that should be semicolon Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add phy_ops Nicolas Boichat <drinkcat@chromium.org>: checkpatch: warn if trace_printk and friends are called Rikard Falkeborn <rikard.falkeborn@gmail.com>: const_structs.checkpatch: add pinctrl_ops and pinmux_ops Joe Perches <joe@perches.com>: checkpatch: warn on self-assignments checkpatch: allow not using -f with files that are in git Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: extend author Signed-off-by check for split From: header Joe Perches <joe@perches.com>: checkpatch: emit a warning on embedded filenames Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: fix multi-statement macro checks for while blocks. Łukasz Stelmach <l.stelmach@samsung.com>: checkpatch: fix false positive on empty block comment lines Dwaipayan Ray <dwaipayanray1@gmail.com>: checkpatch: add new warnings to author signoff checks. Subsystem: binfmt Chris Kennelly <ckennelly@google.com>: Patch series "Selecting Load Addresses According to p_align", v3: fs/binfmt_elf: use PT_LOAD p_align values for suitable start address tools/testing/selftests: add self-test for verifying load alignment Jann Horn <jannh@google.com>: Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5: binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU coredump: let dump_emit() bail out on short writes coredump: refactor page range dumping into common helper coredump: rework elf/elf_fdpic vma_dump_size() into common helper binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot mm/gup: take mmap_lock in get_dump_page() mm: remove the now-unnecessary mmget_still_valid() hack Subsystem: ramfs Matthew Wilcox (Oracle) <willy@infradead.org>: ramfs: fix nommu mmap with gaps in the page cache Subsystem: autofs Matthew Wilcox <willy@infradead.org>: autofs: harden ioctl table Subsystem: nilfs Wang Hai <wanghai38@huawei.com>: nilfs2: fix some kernel-doc warnings for nilfs2 Subsystem: rapidio Souptick Joarder <jrdr.linux@gmail.com>: rapidio: fix error handling path Jing Xiangfeng <jingxiangfeng@huawei.com>: rapidio: fix the missed put_device() for rio_mport_add_riodev Subsystem: panic Alexey Kardashevskiy <aik@ozlabs.ru>: panic: dump registers on panic_on_warn Subsystem: relay Sudip Mukherjee <sudipm.mukherjee@gmail.com>: kernel/relay.c: drop unneeded initialization Subsystem: kgdb Ritesh Harjani <riteshh@linux.ibm.com>: scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command scripts/gdb/tasks: add headers and improve spacing format Subsystem: ubsan Elena Petrova <lenaptr@google.com>: sched.h: drop in_ubsan field when UBSAN is in trap mode George Popescu <georgepope@android.com>: ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang Subsystem: romfs Libing Zhou <libing.zhou@nokia-sbell.com>: ROMFS: support inode blocks calculation Subsystem: fault-injection Albert van der Linde <alinde@google.com>: Patch series "add fault injection to user memory access", v3: lib, include/linux: add usercopy failure capability lib, uaccess: add failure injection to usercopy functions .mailmap | 1 Documentation/admin-guide/kernel-parameters.txt | 1 Documentation/core-api/xarray.rst | 14 Documentation/fault-injection/fault-injection.rst | 7 MAINTAINERS | 6 arch/ia64/mm/init.c | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 29 + arch/powerpc/include/asm/nohash/pgtable.h | 5 arch/powerpc/mm/pgtable.c | 5 arch/powerpc/platforms/powernv/memtrace.c | 2 arch/powerpc/platforms/pseries/hotplug-memory.c | 2 drivers/acpi/acpi_memhotplug.c | 3 drivers/base/memory.c | 3 drivers/base/node.c | 33 +- drivers/block/zram/zram_drv.c | 2 drivers/dax/kmem.c | 50 ++- drivers/hv/hv_balloon.c | 4 drivers/infiniband/core/uverbs_main.c | 3 drivers/rapidio/devices/rio_mport_cdev.c | 18 - drivers/s390/char/sclp_cmd.c | 2 drivers/vfio/pci/vfio_pci.c | 38 +- drivers/virtio/virtio_mem.c | 5 drivers/xen/balloon.c | 4 fs/autofs/dev-ioctl.c | 8 fs/binfmt_elf.c | 267 +++------------- fs/binfmt_elf_fdpic.c | 176 ++-------- fs/configfs/dir.c | 2 fs/configfs/file.c | 2 fs/coredump.c | 238 +++++++++++++- fs/ext4/verity.c | 4 fs/f2fs/verity.c | 4 fs/inode.c | 2 fs/nilfs2/bmap.c | 2 fs/nilfs2/cpfile.c | 6 fs/nilfs2/page.c | 1 fs/nilfs2/sufile.c | 4 fs/proc/task_mmu.c | 18 - fs/ramfs/file-nommu.c | 2 fs/romfs/super.c | 1 fs/userfaultfd.c | 28 - include/linux/bitops.h | 13 include/linux/blkdev.h | 1 include/linux/bvec.h | 6 include/linux/coredump.h | 13 include/linux/fault-inject-usercopy.h | 22 + include/linux/fs.h | 28 - include/linux/idr.h | 13 include/linux/ioport.h | 15 include/linux/jiffies.h | 3 include/linux/kernel.h | 150 --------- include/linux/list.h | 29 + include/linux/memory_hotplug.h | 42 +- include/linux/minmax.h | 153 +++++++++ include/linux/mm.h | 5 include/linux/mmzone.h | 17 - include/linux/node.h | 16 include/linux/nodemask.h | 2 include/linux/page-flags.h | 6 include/linux/page_owner.h | 6 include/linux/pagemap.h | 111 ++++++ include/linux/sched.h | 2 include/linux/sched/mm.h | 25 - include/linux/uaccess.h | 12 include/linux/vmstat.h | 2 include/linux/xarray.h | 22 + include/ras/ras_event.h | 3 kernel/acct.c | 10 kernel/cgroup/cpuset.c | 2 kernel/dma/direct.c | 2 kernel/fork.c | 4 kernel/futex.c | 2 kernel/irq/timings.c | 2 kernel/jump_label.c | 2 kernel/kcsan/encoding.h | 2 kernel/kexec_core.c | 2 kernel/kexec_file.c | 2 kernel/kthread.c | 2 kernel/livepatch/state.c | 2 kernel/panic.c | 12 kernel/pid_namespace.c | 2 kernel/power/snapshot.c | 2 kernel/range.c | 3 kernel/relay.c | 2 kernel/resource.c | 114 +++++-- kernel/smp.c | 2 kernel/sys.c | 2 kernel/user_namespace.c | 2 lib/Kconfig.debug | 7 lib/Kconfig.ubsan | 14 lib/Makefile | 1 lib/bitmap.c | 2 lib/crc32.c | 2 lib/decompress_bunzip2.c | 2 lib/dynamic_queue_limits.c | 4 lib/earlycpio.c | 2 lib/fault-inject-usercopy.c | 39 ++ lib/find_bit.c | 1 lib/hexdump.c | 1 lib/idr.c | 9 lib/iov_iter.c | 5 lib/libcrc32c.c | 2 lib/math/rational.c | 2 lib/math/reciprocal_div.c | 1 lib/mpi/mpi-bit.c | 2 lib/percpu_counter.c | 2 lib/radix-tree.c | 2 lib/scatterlist.c | 2 lib/strncpy_from_user.c | 3 lib/syscall.c | 2 lib/test_hmm.c | 2 lib/test_sysctl.c | 2 lib/test_xarray.c | 65 ++++ lib/usercopy.c | 5 lib/xarray.c | 208 ++++++++++++ mm/Kconfig | 2 mm/compaction.c | 6 mm/debug_vm_pgtable.c | 267 ++++++++-------- mm/filemap.c | 58 ++- mm/gup.c | 73 ++-- mm/highmem.c | 4 mm/huge_memory.c | 47 +- mm/hwpoison-inject.c | 18 - mm/internal.h | 47 +- mm/khugepaged.c | 2 mm/madvise.c | 52 --- mm/memory-failure.c | 357 ++++++++++------------ mm/memory.c | 7 mm/memory_hotplug.c | 223 +++++-------- mm/memremap.c | 3 mm/migrate.c | 11 mm/mmap.c | 7 mm/mmu_notifier.c | 2 mm/page-writeback.c | 1 mm/page_alloc.c | 289 +++++++++++------ mm/page_isolation.c | 16 mm/page_owner.c | 10 mm/page_poison.c | 20 - mm/page_reporting.c | 4 mm/readahead.c | 174 ++++------ mm/rmap.c | 10 mm/shmem.c | 2 mm/shuffle.c | 2 mm/slab.c | 2 mm/slab.h | 1 mm/slub.c | 2 mm/sparse.c | 2 mm/swap_state.c | 2 mm/truncate.c | 6 mm/util.c | 3 mm/vmscan.c | 5 mm/vmstat.c | 8 mm/workingset.c | 2 scripts/Makefile.ubsan | 10 scripts/checkpatch.pl | 238 ++++++++++---- scripts/const_structs.checkpatch | 3 scripts/gdb/linux/proc.py | 15 scripts/gdb/linux/tasks.py | 9 scripts/get_maintainer.pl | 9 tools/testing/selftests/exec/.gitignore | 1 tools/testing/selftests/exec/Makefile | 9 tools/testing/selftests/exec/load_address.c | 68 ++++ 161 files changed, 2532 insertions(+), 1864 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-10-16 2:40 incoming Andrew Morton @ 2020-10-16 3:03 ` Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-16 3:03 UTC (permalink / raw) To: Linus Torvalds, mm-commits, linux-mm And... I forgot to set in-reply-to :( Shall resend, omitting linux-mm. ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-10-11 6:15 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-11 6:15 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d. Subsystems affected by this patch series: MAINTAINERS mm/pagemap mm/swap mm/hugetlb Subsystem: MAINTAINERS Kees Cook <keescook@chromium.org>: MAINTAINERS: change hardening mailing list Antoine Tenart <atenart@kernel.org>: MAINTAINERS: Antoine Tenart's email address Subsystem: mm/pagemap Miaohe Lin <linmiaohe@huawei.com>: mm: mmap: Fix general protection fault in unlink_file_vma() Subsystem: mm/swap Minchan Kim <minchan@kernel.org>: mm: validate inode in mapping_set_error() Subsystem: mm/hugetlb Vijay Balakrishna <vijayb@linux.microsoft.com>: mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged .mailmap | 4 +++- MAINTAINERS | 8 ++++---- include/linux/khugepaged.h | 5 +++++ include/linux/pagemap.h | 3 ++- mm/khugepaged.c | 13 +++++++++++-- mm/mmap.c | 6 +++++- mm/page_alloc.c | 3 +++ 7 files changed, 33 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-10-03 5:20 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-10-03 5:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e. Subsystems affected by this patch series: mm/slub mm/cma scripts Subsystem: mm/slub Eric Farman <farman@linux.ibm.com>: mm, slub: restore initial kmem_cache flags Subsystem: mm/cma Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs Subsystem: scripts Eric Biggers <ebiggers@google.com>: scripts/spelling.txt: fix malformed entry mm/page_alloc.c | 19 ++++++++++++++++--- mm/slub.c | 6 +----- scripts/spelling.txt | 2 +- 3 files changed, 18 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-09-26 4:17 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-09-26 4:17 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6. Subsystems affected by this patch series: mm/thp mm/memcg mm/gup mm/migration lib x86 mm/memory-hotplug Subsystem: mm/thp Gao Xiang <hsiangkao@redhat.com>: mm, THP, swap: fix allocating cluster for swapfile by mistake Subsystem: mm/memcg Muchun Song <songmuchun@bytedance.com>: mm: memcontrol: fix missing suffix of workingset_restore Subsystem: mm/gup Vasily Gorbik <gor@linux.ibm.com>: mm/gup: fix gup_fast with dynamic page table folding Subsystem: mm/migration Zi Yan <ziy@nvidia.com>: mm/migrate: correct thp migration stats Subsystem: lib Nick Desaulniers <ndesaulniers@google.com>: lib/string.c: implement stpcpy Jason Yan <yanaijie@huawei.com>: lib/memregion.c: include memregion.h Subsystem: x86 Mikulas Patocka <mpatocka@redhat.com>: arch/x86/lib/usercopy_64.c: fix __copy_user_flushcache() cache writeback Subsystem: mm/memory-hotplug Laurent Dufour <ldufour@linux.ibm.com>: Patch series "mm: fix memory to node bad links in sysfs", v3: mm: replace memmap_context by meminit_context mm: don't rely on system state to detect hot-plug operations Documentation/admin-guide/cgroup-v2.rst | 25 ++++++--- arch/ia64/mm/init.c | 6 +- arch/s390/include/asm/pgtable.h | 42 +++++++++++---- arch/x86/lib/usercopy_64.c | 2 drivers/base/node.c | 85 ++++++++++++++++++++------------ include/linux/mm.h | 2 include/linux/mmzone.h | 11 +++- include/linux/node.h | 11 ++-- include/linux/pgtable.h | 10 +++ lib/memregion.c | 1 lib/string.c | 24 +++++++++ mm/gup.c | 18 +++--- mm/memcontrol.c | 4 - mm/memory_hotplug.c | 5 + mm/migrate.c | 7 +- mm/page_alloc.c | 10 +-- mm/swapfile.c | 2 17 files changed, 181 insertions(+), 84 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-09-19 4:19 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-09-19 4:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b. Subsystems affected by this patch series: mailmap mm/hotfixes mm/thp mm/memory-hotplug misc kcsan Subsystem: mailmap Kees Cook <keescook@chromium.org>: mailmap: add older email addresses for Kees Cook Subsystem: mm/hotfixes Hugh Dickins <hughd@google.com>: Patch series "mm: fixes to past from future testing": ksm: reinstate memcg charge on copied pages mm: migration of hugetlbfs page skip memcg shmem: shmem_writepage() split unlikely i915 THP mm: fix check_move_unevictable_pages() on THP mlock: fix unevictable_pgs event counts on THP Byron Stanoszek <gandalf@winds.org>: tmpfs: restore functionality of nr_inodes=0 Muchun Song <songmuchun@bytedance.com>: kprobes: fix kill kprobe which has been marked as gone Subsystem: mm/thp Ralph Campbell <rcampbell@nvidia.com>: mm/thp: fix __split_huge_pmd_locked() for migration PMD Christophe Leroy <christophe.leroy@csgroup.eu>: selftests/vm: fix display of page size in map_hugetlb Subsystem: mm/memory-hotplug Pavel Tatashin <pasha.tatashin@soleen.com>: mm/memory_hotplug: drain per-cpu pages again during memory offline Subsystem: misc Tobias Klauser <tklauser@distanz.ch>: ftrace: let ftrace_enable_sysctl take a kernel pointer buffer stackleak: let stack_erasing_sysctl take a kernel pointer buffer fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype Subsystem: kcsan Changbin Du <changbin.du@gmail.com>: kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments' .mailmap | 4 ++ fs/fs-writeback.c | 2 - include/linux/ftrace.h | 3 -- include/linux/stackleak.h | 2 - kernel/kprobes.c | 9 +++++- kernel/stackleak.c | 2 - kernel/trace/ftrace.c | 3 -- lib/Kconfig.debug | 4 -- mm/huge_memory.c | 42 ++++++++++++++++--------------- mm/ksm.c | 4 ++ mm/memory_hotplug.c | 14 ++++++++++ mm/migrate.c | 3 +- mm/mlock.c | 24 +++++++++++------ mm/page_isolation.c | 8 +++++ mm/shmem.c | 20 +++++++++++--- mm/swap.c | 6 ++-- mm/vmscan.c | 10 +++++-- tools/testing/selftests/vm/map_hugetlb.c | 2 - 18 files changed, 111 insertions(+), 51 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-09-04 23:34 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-09-04 23:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6. Subsystems affected by this patch series: mm/memcg mm/slub MAINTAINERS mm/pagemap ipc fork checkpatch mm/madvise mm/migration mm/hugetlb lib Subsystem: mm/memcg Michal Hocko <mhocko@suse.com>: memcg: fix use-after-free in uncharge_batch Xunlei Pang <xlpang@linux.alibaba.com>: mm: memcg: fix memcg reclaim soft lockup Subsystem: mm/slub Eugeniu Rosca <erosca@de.adit-jv.com>: mm: slub: fix conversion of freelist_corrupted() Subsystem: MAINTAINERS Robert Richter <rric@kernel.org>: MAINTAINERS: update Cavium/Marvell entries Nick Desaulniers <ndesaulniers@google.com>: MAINTAINERS: add LLVM maintainers Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: IA64: mark Status as Odd Fixes only Subsystem: mm/pagemap Joerg Roedel <jroedel@suse.de>: mm: track page table modifications in __apply_to_page_range() Subsystem: ipc Tobias Klauser <tklauser@distanz.ch>: ipc: adjust proc_ipc_sem_dointvec definition to match prototype Subsystem: fork Tobias Klauser <tklauser@distanz.ch>: fork: adjust sysctl_max_threads definition to match prototype Subsystem: checkpatch Mrinal Pandey <mrinalmni@gmail.com>: checkpatch: fix the usage of capture group ( ... ) Subsystem: mm/madvise Yang Shi <shy828301@gmail.com>: mm: madvise: fix vma user-after-free Subsystem: mm/migration Alistair Popple <alistair@popple.id.au>: mm/migrate: fixup setting UFFD_WP flag mm/rmap: fixup copying of soft dirty and uffd ptes Ralph Campbell <rcampbell@nvidia.com>: Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()": mm/migrate: remove unnecessary is_zone_device_page() check mm/migrate: preserve soft dirty in remove_migration_pte() Subsystem: mm/hugetlb Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb: try preferred node first when alloc gigantic page from cma Muchun Song <songmuchun@bytedance.com>: mm/hugetlb: fix a race between hugetlb sysctl handlers David Howells <dhowells@redhat.com>: mm/khugepaged.c: fix khugepaged's request size in collapse_file Subsystem: lib Jason Gunthorpe <jgg@nvidia.com>: include/linux/log2.h: add missing () around n in roundup_pow_of_two() MAINTAINERS | 32 ++++++++++++++++---------------- include/linux/log2.h | 2 +- ipc/ipc_sysctl.c | 2 +- kernel/fork.c | 2 +- mm/hugetlb.c | 49 +++++++++++++++++++++++++++++++++++++------------ mm/khugepaged.c | 2 +- mm/madvise.c | 2 +- mm/memcontrol.c | 6 ++++++ mm/memory.c | 37 ++++++++++++++++++++++++------------- mm/migrate.c | 31 +++++++++++++++++++------------ mm/rmap.c | 9 +++++++-- mm/slub.c | 12 ++++++------ mm/vmscan.c | 8 ++++++++ scripts/checkpatch.pl | 4 ++-- 14 files changed, 130 insertions(+), 68 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-08-21 0:41 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-08-21 0:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da. Subsystems affected by this patch series: misc mm/hugetlb mm/vmalloc mm/misc romfs relay uprobes squashfs mm/cma mm/pagealloc Subsystem: misc Nick Desaulniers <ndesaulniers@google.com>: mailmap: add Andi Kleen Subsystem: mm/hugetlb Xu Wang <vulab@iscas.ac.cn>: hugetlb_cgroup: convert comma to semicolon Hugh Dickins <hughd@google.com>: khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter() Subsystem: mm/vmalloc "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/vunmap: add cond_resched() in vunmap_pmd_range Subsystem: mm/misc Leon Romanovsky <leonro@nvidia.com>: mm/rodata_test.c: fix missing function declaration Subsystem: romfs Jann Horn <jannh@google.com>: romfs: fix uninitialized memory leak in romfs_dev_read() Subsystem: relay Wei Yongjun <weiyongjun1@huawei.com>: kernel/relay.c: fix memleak on destroy relay channel Subsystem: uprobes Hugh Dickins <hughd@google.com>: uprobes: __replace_page() avoid BUG in munlock_vma_page() Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: avoid bio_alloc() failure with 1Mbyte blocks Subsystem: mm/cma Doug Berger <opendmb@gmail.com>: mm: include CMA pages in lowmem_reserve at boot Subsystem: mm/pagealloc Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: fix core hung in free_pcppages_bulk() .mailmap | 1 + fs/romfs/storage.c | 4 +--- fs/squashfs/block.c | 6 +++++- kernel/events/uprobes.c | 2 +- kernel/relay.c | 1 + mm/hugetlb_cgroup.c | 4 ++-- mm/khugepaged.c | 2 +- mm/page_alloc.c | 7 ++++++- mm/rodata_test.c | 1 + mm/vmalloc.c | 2 ++ 10 files changed, 21 insertions(+), 9 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-08-15 0:29 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-08-15 0:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66. Subsystems affected by this patch series: mm/hotfixes lz4 exec mailmap mm/thp autofs mm/madvise sysctl mm/kmemleak mm/misc lib Subsystem: mm/hotfixes Mike Rapoport <rppt@linux.ibm.com>: asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one() Baoquan He <bhe@redhat.com>: Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone" Subsystem: lz4 Nick Terrell <terrelln@fb.com>: lz4: fix kernel decompression speed Subsystem: exec Kees Cook <keescook@chromium.org>: Patch series "Fix S_ISDIR execve() errno": exec: restore EACCES of S_ISDIR execve() selftests/exec: add file type errno tests Subsystem: mailmap Greg Kurz <groug@kaod.org>: mailmap: add entry for Greg Kurz Subsystem: mm/thp "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "THP prep patches": mm: store compound_nr as well as compound_order mm: move page-flags include to top of file mm: add thp_order mm: add thp_size mm: replace hpage_nr_pages with thp_nr_pages mm: add thp_head mm: introduce offset_in_thp Subsystem: autofs Randy Dunlap <rdunlap@infradead.org>: fs: autofs: delete repeated words in comments Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v8: mm/madvise: pass task and mm to do_madvise pid: move pidfd_get_pid() to pid.c mm/madvise: introduce process_madvise() syscall: an external memory hinting API mm/madvise: check fatal signal pending of target process Subsystem: sysctl Xiaoming Ni <nixiaoming@huawei.com>: all arch: remove system call sys_sysctl Subsystem: mm/kmemleak Qian Cai <cai@lca.pw>: mm/kmemleak: silence KCSAN splats in checksum Subsystem: mm/misc Qian Cai <cai@lca.pw>: mm/frontswap: mark various intentional data races mm/page_io: mark various intentional data races mm/swap_state: mark various intentional data races Kirill A. Shutemov <kirill@shutemov.name>: mm/filemap.c: fix a data race in filemap_fault() Qian Cai <cai@lca.pw>: mm/swapfile: fix and annotate various data races mm/page_counter: fix various data races at memsw mm/memcontrol: fix a data race in scan count mm/list_lru: fix a data race in list_lru_count_one mm/mempool: fix a data race in mempool_free() mm/rmap: annotate a data race at tlb_flush_batched mm/swap.c: annotate data races for lru_rotate_pvecs mm: annotate a data race in page_zonenum() Romain Naour <romain.naour@gmail.com>: include/asm-generic/vmlinux.lds.h: align ro_after_init Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>: sh: clkfwk: remove r8/r16/r32 sh: use generic strncpy() Subsystem: lib Krzysztof Kozlowski <krzk@kernel.org>: Patch series "iomap: Constify ioreadX() iomem argument", v3: iomap: constify ioreadX() iomem argument (as in generic implementation) rtl818x: constify ioreadX() iomem argument (as in generic implementation) ntb: intel: constify ioreadX() iomem argument (as in generic implementation) virtio: pci: constify ioreadX() iomem argument (as in generic implementation) .mailmap | 1 arch/alpha/include/asm/core_apecs.h | 6 arch/alpha/include/asm/core_cia.h | 6 arch/alpha/include/asm/core_lca.h | 6 arch/alpha/include/asm/core_marvel.h | 4 arch/alpha/include/asm/core_mcpcia.h | 6 arch/alpha/include/asm/core_t2.h | 2 arch/alpha/include/asm/io.h | 12 - arch/alpha/include/asm/io_trivial.h | 16 - arch/alpha/include/asm/jensen.h | 2 arch/alpha/include/asm/machvec.h | 6 arch/alpha/kernel/core_marvel.c | 2 arch/alpha/kernel/io.c | 12 - arch/alpha/kernel/syscalls/syscall.tbl | 3 arch/arm/configs/am200epdkit_defconfig | 1 arch/arm/tools/syscall.tbl | 3 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 6 arch/ia64/kernel/syscalls/syscall.tbl | 3 arch/m68k/kernel/syscalls/syscall.tbl | 3 arch/microblaze/kernel/syscalls/syscall.tbl | 3 arch/mips/configs/cu1000-neo_defconfig | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 3 arch/mips/kernel/syscalls/syscall_n64.tbl | 3 arch/mips/kernel/syscalls/syscall_o32.tbl | 3 arch/parisc/include/asm/io.h | 4 arch/parisc/kernel/syscalls/syscall.tbl | 3 arch/parisc/lib/iomap.c | 72 +++--- arch/powerpc/kernel/iomap.c | 28 +- arch/powerpc/kernel/syscalls/syscall.tbl | 3 arch/s390/kernel/syscalls/syscall.tbl | 3 arch/sh/configs/dreamcast_defconfig | 1 arch/sh/configs/espt_defconfig | 1 arch/sh/configs/hp6xx_defconfig | 1 arch/sh/configs/landisk_defconfig | 1 arch/sh/configs/lboxre2_defconfig | 1 arch/sh/configs/microdev_defconfig | 1 arch/sh/configs/migor_defconfig | 1 arch/sh/configs/r7780mp_defconfig | 1 arch/sh/configs/r7785rp_defconfig | 1 arch/sh/configs/rts7751r2d1_defconfig | 1 arch/sh/configs/rts7751r2dplus_defconfig | 1 arch/sh/configs/se7206_defconfig | 1 arch/sh/configs/se7343_defconfig | 1 arch/sh/configs/se7619_defconfig | 1 arch/sh/configs/se7705_defconfig | 1 arch/sh/configs/se7750_defconfig | 1 arch/sh/configs/se7751_defconfig | 1 arch/sh/configs/secureedge5410_defconfig | 1 arch/sh/configs/sh03_defconfig | 1 arch/sh/configs/sh7710voipgw_defconfig | 1 arch/sh/configs/sh7757lcr_defconfig | 1 arch/sh/configs/sh7763rdp_defconfig | 1 arch/sh/configs/shmin_defconfig | 1 arch/sh/configs/titan_defconfig | 1 arch/sh/include/asm/string_32.h | 26 -- arch/sh/kernel/iomap.c | 22 - arch/sh/kernel/syscalls/syscall.tbl | 3 arch/sparc/kernel/syscalls/syscall.tbl | 3 arch/x86/entry/syscalls/syscall_32.tbl | 3 arch/x86/entry/syscalls/syscall_64.tbl | 4 arch/xtensa/kernel/syscalls/syscall.tbl | 3 drivers/mailbox/bcm-pdc-mailbox.c | 2 drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h | 6 drivers/ntb/hw/intel/ntb_hw_gen1.c | 2 drivers/ntb/hw/intel/ntb_hw_gen3.h | 2 drivers/ntb/hw/intel/ntb_hw_intel.h | 2 drivers/nvdimm/btt.c | 4 drivers/nvdimm/pmem.c | 6 drivers/sh/clk/cpg.c | 25 -- drivers/virtio/virtio_pci_modern.c | 6 fs/autofs/dev-ioctl.c | 4 fs/io_uring.c | 2 fs/namei.c | 4 include/asm-generic/iomap.h | 28 +- include/asm-generic/pgalloc.h | 2 include/asm-generic/vmlinux.lds.h | 1 include/linux/compat.h | 5 include/linux/huge_mm.h | 58 ++++- include/linux/io-64-nonatomic-hi-lo.h | 4 include/linux/io-64-nonatomic-lo-hi.h | 4 include/linux/memcontrol.h | 2 include/linux/mm.h | 16 - include/linux/mm_inline.h | 6 include/linux/mm_types.h | 1 include/linux/pagemap.h | 6 include/linux/pid.h | 1 include/linux/syscalls.h | 4 include/linux/sysctl.h | 6 include/uapi/asm-generic/unistd.h | 4 kernel/Makefile | 2 kernel/exit.c | 17 - kernel/pid.c | 17 + kernel/sys_ni.c | 3 kernel/sysctl_binary.c | 171 -------------- lib/iomap.c | 30 +- lib/lz4/lz4_compress.c | 4 lib/lz4/lz4_decompress.c | 18 - lib/lz4/lz4defs.h | 10 lib/lz4/lz4hc_compress.c | 2 mm/compaction.c | 2 mm/filemap.c | 22 + mm/frontswap.c | 8 mm/gup.c | 2 mm/internal.h | 4 mm/kmemleak.c | 2 mm/list_lru.c | 2 mm/madvise.c | 190 ++++++++++++++-- mm/memcontrol.c | 10 mm/memory.c | 4 mm/memory_hotplug.c | 7 mm/mempolicy.c | 2 mm/mempool.c | 2 mm/migrate.c | 18 - mm/mlock.c | 9 mm/page_alloc.c | 5 mm/page_counter.c | 13 - mm/page_io.c | 12 - mm/page_vma_mapped.c | 6 mm/rmap.c | 10 mm/swap.c | 21 - mm/swap_state.c | 10 mm/swapfile.c | 33 +- mm/vmscan.c | 6 mm/vmstat.c | 12 - mm/workingset.c | 6 tools/perf/arch/powerpc/entry/syscalls/syscall.tbl | 2 tools/perf/arch/s390/entry/syscalls/syscall.tbl | 2 tools/perf/arch/x86/entry/syscalls/syscall_64.tbl | 2 tools/testing/selftests/exec/.gitignore | 1 tools/testing/selftests/exec/Makefile | 5 tools/testing/selftests/exec/non-regular.c | 196 +++++++++++++++++ 132 files changed, 815 insertions(+), 614 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-08-12 1:29 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-08-12 1:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - Most of the rest of MM - various other subsystems 165 patches, based on 00e4db51259a5f936fec1424b884f029479d3981. Subsystems affected by this patch series: mm/memcg mm/hugetlb mm/vmscan mm/proc mm/compaction mm/mempolicy mm/oom-kill mm/hugetlbfs mm/migration mm/thp mm/cma mm/util mm/memory-hotplug mm/cleanups mm/uaccess alpha misc sparse bitmap lib lz4 bitops checkpatch autofs minix nilfs ufs fat signals kmod coredump exec kdump rapidio panic kcov kgdb ipc mm/migration mm/gup mm/pagemap Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: Patch series "mm: memcg accounting of percpu memory", v3: percpu: return number of released bytes from pcpu_free_area() mm: memcg/percpu: account percpu memory to memory cgroups mm: memcg/percpu: per-memcg percpu memory statistics mm: memcg: charge memcg percpu memory to the parent cgroup kselftests: cgroup: add perpcu memory accounting test Subsystem: mm/hugetlb Muchun Song <songmuchun@bytedance.com>: mm/hugetlb: add mempolicy check in the reservation routine Subsystem: mm/vmscan Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "workingset protection/detection on the anonymous LRU list", v7: mm/vmscan: make active/inactive ratio as 1:1 for anon lru mm/vmscan: protect the workingset on anonymous LRU mm/workingset: prepare the workingset detection infrastructure for anon LRU mm/swapcache: support to handle the shadow entries mm/swap: implement workingset detection for anonymous LRU mm/vmscan: restore active/inactive ratio for anonymous LRU Subsystem: mm/proc Michal Koutný <mkoutny@suse.com>: /proc/PID/smaps: consistent whitespace output format Subsystem: mm/compaction Nitin Gupta <nigupta@nvidia.com>: mm: proactive compaction mm: fix compile error due to COMPACTION_HPAGE_ORDER mm: use unsigned types for fragmentation score Alex Shi <alex.shi@linux.alibaba.com>: mm/compaction: correct the comments of compact_defer_shift Subsystem: mm/mempolicy Krzysztof Kozlowski <krzk@kernel.org>: mm: mempolicy: fix kerneldoc of numa_map_to_online_node() Wenchao Hao <haowenchao22@gmail.com>: mm/mempolicy.c: check parameters first in kernel_get_mempolicy Yanfei Xu <yanfei.xu@windriver.com>: include/linux/mempolicy.h: fix typo Subsystem: mm/oom-kill Yafang Shao <laoar.shao@gmail.com>: mm, oom: make the calculation of oom badness more accurate Michal Hocko <mhocko@suse.com>: doc, mm: sync up oom_score_adj documentation doc, mm: clarify /proc/<pid>/oom_score value range Yafang Shao <laoar.shao@gmail.com>: mm, oom: show process exiting information in __oom_kill_process() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: prevent filesystem stacking of hugetlbfs hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: Patch series "mm/migrate: optimize migrate_vma_setup() for holes": mm/migrate: optimize migrate_vma_setup() for holes mm/migrate: add migrate-shared test for migrate_vma_*() Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: remove debug_cow switch Anshuman Khandual <anshuman.khandual@arm.com>: mm/vmstat: add events for THP migration without split Subsystem: mm/cma Jianqun Xu <jay.xu@rock-chips.com>: mm/cma.c: fix NULL pointer dereference when cma could not be activated Barry Song <song.bao.hua@hisilicon.com>: Patch series "mm: fix the names of general cma and hugetlb cma", v2: mm: cma: fix the name of CMA areas mm: hugetlb: fix the name of hugetlb CMA Mike Kravetz <mike.kravetz@oracle.com>: cma: don't quit at first error when activating reserved areas Subsystem: mm/util Waiman Long <longman@redhat.com>: include/linux/sched/mm.h: optimize current_gfp_context() Krzysztof Kozlowski <krzk@kernel.org>: mm: mmu_notifier: fix and extend kerneldoc Subsystem: mm/memory-hotplug Daniel Jordan <daniel.m.jordan@oracle.com>: x86/mm: use max memory block size on bare metal Jia He <justin.he@arm.com>: mm/memory_hotplug: introduce default dummy memory_add_physaddr_to_nid() mm/memory_hotplug: fix unpaired mem_hotplug_begin/done Charan Teja Reddy <charante@codeaurora.org>: mm, memory_hotplug: update pcp lists everytime onlining a memory block Subsystem: mm/cleanups Randy Dunlap <rdunlap@infradead.org>: mm: drop duplicated words in <linux/pgtable.h> mm: drop duplicated words in <linux/mm.h> include/linux/highmem.h: fix duplicated words in a comment include/linux/frontswap.h: drop duplicated word in a comment include/linux/memcontrol.h: drop duplicate word and fix spello Arvind Sankar <nivedita@alum.mit.edu>: sh/mm: drop unused MAX_PHYSADDR_BITS sparc: drop unused MAX_PHYSADDR_BITS Randy Dunlap <rdunlap@infradead.org>: mm/compaction.c: delete duplicated word mm/filemap.c: delete duplicated word mm/hmm.c: delete duplicated word mm/hugetlb.c: delete duplicated words mm/memcontrol.c: delete duplicated words mm/memory.c: delete duplicated words mm/migrate.c: delete duplicated word mm/nommu.c: delete duplicated words mm/page_alloc.c: delete or fix duplicated words mm/shmem.c: delete duplicated word mm/slab_common.c: delete duplicated word mm/usercopy.c: delete duplicated word mm/vmscan.c: delete or fix duplicated words mm/zpool.c: delete duplicated word and fix grammar mm/zsmalloc.c: fix duplicated words Subsystem: mm/uaccess Christoph Hellwig <hch@lst.de>: Patch series "clean up address limit helpers", v2: syscalls: use uaccess_kernel in addr_limit_user_check nds32: use uaccess_kernel in show_regs riscv: include <asm/pgtable.h> in <asm/uaccess.h> uaccess: remove segment_eq uaccess: add force_uaccess_{begin,end} helpers exec: use force_uaccess_begin during exec and exit Subsystem: alpha Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: alpha: fix annotation of io{read,write}{16,32}be() Subsystem: misc Randy Dunlap <rdunlap@infradead.org>: include/linux/compiler-clang.h: drop duplicated word in a comment include/linux/exportfs.h: drop duplicated word in a comment include/linux/async_tx.h: drop duplicated word in a comment include/linux/xz.h: drop duplicated word Christoph Hellwig <hch@lst.de>: kernel: add a kernel_wait helper Feng Tang <feng.tang@intel.com>: ./Makefile: add debug option to enable function aligned on 32 bytes Arvind Sankar <nivedita@alum.mit.edu>: kernel.h: remove duplicate include of asm/div64.h "Alexander A. Klimov" <grandmaster@al2klimov.de>: include/: replace HTTP links with HTTPS ones Matthew Wilcox <willy@infradead.org>: include/linux/poison.h: remove obsolete comment Subsystem: sparse Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: sparse: group the defines by functionality Subsystem: bitmap Stefano Brivio <sbrivio@redhat.com>: Patch series "lib: Fix bitmap_cut() for overlaps, add test": lib/bitmap.c: fix bitmap_cut() for partial overlapping case lib/test_bitmap.c: add test for bitmap_cut() Subsystem: lib Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: lib/generic-radix-tree.c: remove unneeded __rcu Geert Uytterhoeven <geert@linux-m68k.org>: lib/test_bitops: do the full test during module init Wei Yongjun <weiyongjun1@huawei.com>: lib/test_lockup.c: make symbol 'test_works' static Tiezhu Yang <yangtiezhu@loongson.cn>: lib/Kconfig.debug: make TEST_LOCKUP depend on module lib/test_lockup.c: fix return value of test_lockup_init() "Alexander A. Klimov" <grandmaster@al2klimov.de>: lib/: replace HTTP links with HTTPS ones "Kars Mulder" <kerneldev@karsmulder.nl>: kstrto*: correct documentation references to simple_strto*() kstrto*: do not describe simple_strto*() as obsolete/replaced Subsystem: lz4 Nick Terrell <terrelln@fb.com>: lz4: fix kernel decompression speed Subsystem: bitops Rikard Falkeborn <rikard.falkeborn@gmail.com>: lib/test_bits.c: add tests of GENMASK Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: add test for possible misuse of IS_ENABLED() without CONFIG_ checkpatch: add --fix option for ASSIGN_IN_IF Quentin Monnet <quentin@isovalent.com>: checkpatch: fix CONST_STRUCT when const_structs.checkpatch is missing Joe Perches <joe@perches.com>: checkpatch: add test for repeated words checkpatch: remove missing switch/case break test Subsystem: autofs Randy Dunlap <rdunlap@infradead.org>: autofs: fix doubled word Subsystem: minix Eric Biggers <ebiggers@google.com>: Patch series "fs/minix: fix syzbot bugs and set s_maxbytes": fs/minix: check return value of sb_getblk() fs/minix: don't allow getting deleted inodes fs/minix: reject too-large maximum file size fs/minix: set s_maxbytes correctly fs/minix: fix block limit check for V1 filesystems fs/minix: remove expected error message in block_to_path() Subsystem: nilfs Eric Biggers <ebiggers@google.com>: Patch series "nilfs2 updates": nilfs2: only call unlock_new_inode() if I_NEW Joe Perches <joe@perches.com>: nilfs2: convert __nilfs_msg to integrate the level and format nilfs2: use a more common logging style Subsystem: ufs Colin Ian King <colin.king@canonical.com>: fs/ufs: avoid potential u32 multiplication overflow Subsystem: fat Yubo Feng <fengyubo3@huawei.com>: fatfs: switch write_lock to read_lock in fat_ioctl_get_attributes "Alexander A. Klimov" <grandmaster@al2klimov.de>: VFAT/FAT/MSDOS FILESYSTEM: replace HTTP links with HTTPS ones OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: fix fat_ra_init() for data clusters == 0 Subsystem: signals Helge Deller <deller@gmx.de>: fs/signalfd.c: fix inconsistent return codes for signalfd4 Subsystem: kmod Tiezhu Yang <yangtiezhu@loongson.cn>: Patch series "kmod/umh: a few fixes": selftests: kmod: use variable NAME in kmod_test_0001() kmod: remove redundant "be an" in the comment test_kmod: avoid potential double free in trigger_config_run_type() Subsystem: coredump Lepton Wu <ytht.net@gmail.com>: coredump: add %f for executable filename Subsystem: exec Kees Cook <keescook@chromium.org>: Patch series "Relocate execve() sanity checks", v2: exec: change uselib(2) IS_SREG() failure to EACCES exec: move S_ISREG() check earlier exec: move path_noexec() check earlier Subsystem: kdump Vijay Balakrishna <vijayb@linux.microsoft.com>: kdump: append kernel build-id string to VMCOREINFO Subsystem: rapidio "Gustavo A. R. Silva" <gustavoars@kernel.org>: drivers/rapidio/devices/rio_mport_cdev.c: use struct_size() helper drivers/rapidio/rio-scan.c: use struct_size() helper rapidio/rio_mport_cdev: use array_size() helper in copy_{from,to}_user() Subsystem: panic Tiezhu Yang <yangtiezhu@loongson.cn>: kernel/panic.c: make oops_may_print() return bool lib/Kconfig.debug: fix typo in the help text of CONFIG_PANIC_TIMEOUT Yue Hu <huyue2@yulong.com>: panic: make print_oops_end_marker() static Subsystem: kcov Marco Elver <elver@google.com>: kcov: unconditionally add -fno-stack-protector to compiler options Wei Yongjun <weiyongjun1@huawei.com>: kcov: make some symbols static Subsystem: kgdb Nick Desaulniers <ndesaulniers@google.com>: scripts/gdb: fix python 3.8 SyntaxWarning Subsystem: ipc Alexey Dobriyan <adobriyan@gmail.com>: ipc: uninline functions Liao Pingfang <liao.pingfang@zte.com.cn>: ipc/shm.c: remove the superfluous break Subsystem: mm/migration Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "clean-up the migration target allocation functions", v5: mm/page_isolation: prefer the node of the source page mm/migrate: move migration helper from .h to .c mm/hugetlb: unify migration callbacks mm/migrate: clear __GFP_RECLAIM to make the migration callback consistent with regular THP allocations mm/migrate: introduce a standard migration target allocation function mm/mempolicy: use a standard migration target allocation callback mm/page_alloc: remove a wrapper for alloc_migration_target() Subsystem: mm/gup Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/gup: restrict CMA region by using allocation scope API mm/hugetlb: make hugetlb migration callback CMA aware mm/gup: use a standard migration target allocation callback Subsystem: mm/pagemap Peter Xu <peterx@redhat.com>: Patch series "mm: Page fault accounting cleanups", v5: mm: do page fault accounting in handle_mm_fault mm/alpha: use general page fault accounting mm/arc: use general page fault accounting mm/arm: use general page fault accounting mm/arm64: use general page fault accounting mm/csky: use general page fault accounting mm/hexagon: use general page fault accounting mm/ia64: use general page fault accounting mm/m68k: use general page fault accounting mm/microblaze: use general page fault accounting mm/mips: use general page fault accounting mm/nds32: use general page fault accounting mm/nios2: use general page fault accounting mm/openrisc: use general page fault accounting mm/parisc: use general page fault accounting mm/powerpc: use general page fault accounting mm/riscv: use general page fault accounting mm/s390: use general page fault accounting mm/sh: use general page fault accounting mm/sparc32: use general page fault accounting mm/sparc64: use general page fault accounting mm/x86: use general page fault accounting mm/xtensa: use general page fault accounting mm: clean up the last pieces of page fault accountings mm/gup: remove task_struct pointer for all gup code Documentation/admin-guide/cgroup-v2.rst | 4 Documentation/admin-guide/sysctl/kernel.rst | 3 Documentation/admin-guide/sysctl/vm.rst | 15 + Documentation/filesystems/proc.rst | 11 - Documentation/vm/page_migration.rst | 27 +++ Makefile | 4 arch/alpha/include/asm/io.h | 8 arch/alpha/include/asm/uaccess.h | 2 arch/alpha/mm/fault.c | 10 - arch/arc/include/asm/segment.h | 3 arch/arc/kernel/process.c | 2 arch/arc/mm/fault.c | 20 -- arch/arm/include/asm/uaccess.h | 4 arch/arm/kernel/signal.c | 2 arch/arm/mm/fault.c | 27 --- arch/arm64/include/asm/uaccess.h | 2 arch/arm64/kernel/sdei.c | 2 arch/arm64/mm/fault.c | 31 --- arch/arm64/mm/numa.c | 10 - arch/csky/include/asm/segment.h | 2 arch/csky/mm/fault.c | 15 - arch/h8300/include/asm/segment.h | 2 arch/hexagon/mm/vm_fault.c | 11 - arch/ia64/include/asm/uaccess.h | 2 arch/ia64/mm/fault.c | 11 - arch/ia64/mm/numa.c | 2 arch/m68k/include/asm/segment.h | 2 arch/m68k/include/asm/tlbflush.h | 6 arch/m68k/mm/fault.c | 16 - arch/microblaze/include/asm/uaccess.h | 2 arch/microblaze/mm/fault.c | 11 - arch/mips/include/asm/uaccess.h | 2 arch/mips/kernel/unaligned.c | 27 +-- arch/mips/mm/fault.c | 16 - arch/nds32/include/asm/uaccess.h | 2 arch/nds32/kernel/process.c | 2 arch/nds32/mm/alignment.c | 7 arch/nds32/mm/fault.c | 21 -- arch/nios2/include/asm/uaccess.h | 2 arch/nios2/mm/fault.c | 16 - arch/openrisc/include/asm/uaccess.h | 2 arch/openrisc/mm/fault.c | 11 - arch/parisc/include/asm/uaccess.h | 2 arch/parisc/mm/fault.c | 10 - arch/powerpc/include/asm/uaccess.h | 3 arch/powerpc/mm/copro_fault.c | 7 arch/powerpc/mm/fault.c | 13 - arch/riscv/include/asm/uaccess.h | 6 arch/riscv/mm/fault.c | 18 -- arch/s390/include/asm/uaccess.h | 2 arch/s390/kvm/interrupt.c | 2 arch/s390/kvm/kvm-s390.c | 2 arch/s390/kvm/priv.c | 8 arch/s390/mm/fault.c | 18 -- arch/s390/mm/gmap.c | 4 arch/sh/include/asm/segment.h | 3 arch/sh/include/asm/sparsemem.h | 4 arch/sh/kernel/traps_32.c | 12 - arch/sh/mm/fault.c | 13 - arch/sh/mm/init.c | 9 - arch/sparc/include/asm/sparsemem.h | 1 arch/sparc/include/asm/uaccess_32.h | 2 arch/sparc/include/asm/uaccess_64.h | 2 arch/sparc/mm/fault_32.c | 15 - arch/sparc/mm/fault_64.c | 13 - arch/um/kernel/trap.c | 6 arch/x86/include/asm/uaccess.h | 2 arch/x86/mm/fault.c | 19 -- arch/x86/mm/init_64.c | 9 + arch/x86/mm/numa.c | 1 arch/xtensa/include/asm/uaccess.h | 2 arch/xtensa/mm/fault.c | 17 - drivers/firmware/arm_sdei.c | 5 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 2 drivers/infiniband/core/umem_odp.c | 2 drivers/iommu/amd/iommu_v2.c | 2 drivers/iommu/intel/svm.c | 3 drivers/rapidio/devices/rio_mport_cdev.c | 7 drivers/rapidio/rio-scan.c | 8 drivers/vfio/vfio_iommu_type1.c | 4 fs/coredump.c | 17 + fs/exec.c | 38 ++-- fs/fat/Kconfig | 2 fs/fat/fatent.c | 3 fs/fat/file.c | 4 fs/hugetlbfs/inode.c | 6 fs/minix/inode.c | 48 ++++- fs/minix/itree_common.c | 8 fs/minix/itree_v1.c | 16 - fs/minix/itree_v2.c | 15 - fs/minix/minix.h | 1 fs/namei.c | 10 - fs/nilfs2/alloc.c | 38 ++-- fs/nilfs2/btree.c | 42 ++-- fs/nilfs2/cpfile.c | 10 - fs/nilfs2/dat.c | 14 - fs/nilfs2/direct.c | 14 - fs/nilfs2/gcinode.c | 2 fs/nilfs2/ifile.c | 4 fs/nilfs2/inode.c | 32 +-- fs/nilfs2/ioctl.c | 37 ++-- fs/nilfs2/mdt.c | 2 fs/nilfs2/namei.c | 6 fs/nilfs2/nilfs.h | 18 +- fs/nilfs2/page.c | 11 - fs/nilfs2/recovery.c | 32 +-- fs/nilfs2/segbuf.c | 2 fs/nilfs2/segment.c | 38 ++-- fs/nilfs2/sufile.c | 29 +-- fs/nilfs2/super.c | 73 ++++---- fs/nilfs2/sysfs.c | 29 +-- fs/nilfs2/the_nilfs.c | 85 ++++----- fs/open.c | 6 fs/proc/base.c | 11 + fs/proc/task_mmu.c | 4 fs/signalfd.c | 10 - fs/ufs/super.c | 2 include/asm-generic/uaccess.h | 4 include/clocksource/timer-ti-dm.h | 2 include/linux/async_tx.h | 2 include/linux/btree.h | 2 include/linux/compaction.h | 6 include/linux/compiler-clang.h | 2 include/linux/compiler_types.h | 44 ++--- include/linux/crash_core.h | 6 include/linux/delay.h | 2 include/linux/dma/k3-psil.h | 2 include/linux/dma/k3-udma-glue.h | 2 include/linux/dma/ti-cppi5.h | 2 include/linux/exportfs.h | 2 include/linux/frontswap.h | 2 include/linux/fs.h | 10 + include/linux/generic-radix-tree.h | 2 include/linux/highmem.h | 2 include/linux/huge_mm.h | 7 include/linux/hugetlb.h | 53 ++++-- include/linux/irqchip/irq-omap-intc.h | 2 include/linux/jhash.h | 2 include/linux/kernel.h | 12 - include/linux/leds-ti-lmu-common.h | 2 include/linux/memcontrol.h | 12 + include/linux/mempolicy.h | 18 +- include/linux/migrate.h | 42 +--- include/linux/mm.h | 20 +- include/linux/mmzone.h | 17 + include/linux/oom.h | 4 include/linux/pgtable.h | 12 - include/linux/platform_data/davinci-cpufreq.h | 2 include/linux/platform_data/davinci_asp.h | 2 include/linux/platform_data/elm.h | 2 include/linux/platform_data/gpio-davinci.h | 2 include/linux/platform_data/gpmc-omap.h | 2 include/linux/platform_data/mtd-davinci-aemif.h | 2 include/linux/platform_data/omap-twl4030.h | 2 include/linux/platform_data/uio_pruss.h | 2 include/linux/platform_data/usb-omap.h | 2 include/linux/poison.h | 4 include/linux/sched/mm.h | 8 include/linux/sched/task.h | 1 include/linux/soc/ti/k3-ringacc.h | 2 include/linux/soc/ti/knav_qmss.h | 2 include/linux/soc/ti/ti-msgmgr.h | 2 include/linux/swap.h | 25 ++ include/linux/syscalls.h | 2 include/linux/uaccess.h | 20 ++ include/linux/vm_event_item.h | 3 include/linux/wkup_m3_ipc.h | 2 include/linux/xxhash.h | 2 include/linux/xz.h | 4 include/linux/zlib.h | 2 include/soc/arc/aux.h | 2 include/trace/events/migrate.h | 17 + include/uapi/linux/auto_dev-ioctl.h | 2 include/uapi/linux/elf.h | 2 include/uapi/linux/map_to_7segment.h | 2 include/uapi/linux/types.h | 2 include/uapi/linux/usb/ch9.h | 2 ipc/sem.c | 3 ipc/shm.c | 4 kernel/Makefile | 2 kernel/crash_core.c | 50 +++++ kernel/events/callchain.c | 5 kernel/events/core.c | 5 kernel/events/uprobes.c | 8 kernel/exit.c | 18 +- kernel/futex.c | 2 kernel/kcov.c | 6 kernel/kmod.c | 5 kernel/kthread.c | 5 kernel/panic.c | 4 kernel/stacktrace.c | 5 kernel/sysctl.c | 11 + kernel/umh.c | 29 --- lib/Kconfig.debug | 27 ++- lib/Makefile | 1 lib/bitmap.c | 4 lib/crc64.c | 2 lib/decompress_bunzip2.c | 2 lib/decompress_unlzma.c | 6 lib/kstrtox.c | 20 -- lib/lz4/lz4_compress.c | 4 lib/lz4/lz4_decompress.c | 18 +- lib/lz4/lz4defs.h | 10 + lib/lz4/lz4hc_compress.c | 2 lib/math/rational.c | 2 lib/rbtree.c | 2 lib/test_bitmap.c | 58 ++++++ lib/test_bitops.c | 18 +- lib/test_bits.c | 75 ++++++++ lib/test_kmod.c | 2 lib/test_lockup.c | 6 lib/ts_bm.c | 2 lib/xxhash.c | 2 lib/xz/xz_crc32.c | 2 lib/xz/xz_dec_bcj.c | 2 lib/xz/xz_dec_lzma2.c | 2 lib/xz/xz_lzma2.h | 2 lib/xz/xz_stream.h | 2 mm/cma.c | 40 +--- mm/cma.h | 4 mm/compaction.c | 207 +++++++++++++++++++++-- mm/filemap.c | 2 mm/gup.c | 195 ++++++---------------- mm/hmm.c | 5 mm/huge_memory.c | 23 -- mm/hugetlb.c | 93 ++++------ mm/internal.h | 9 - mm/khugepaged.c | 2 mm/ksm.c | 3 mm/maccess.c | 22 +- mm/memcontrol.c | 42 +++- mm/memory-failure.c | 7 mm/memory.c | 107 +++++++++--- mm/memory_hotplug.c | 30 ++- mm/mempolicy.c | 49 +---- mm/migrate.c | 151 ++++++++++++++--- mm/mmu_notifier.c | 9 - mm/nommu.c | 4 mm/oom_kill.c | 24 +- mm/page_alloc.c | 14 + mm/page_isolation.c | 21 -- mm/percpu-internal.h | 55 ++++++ mm/percpu-km.c | 5 mm/percpu-stats.c | 36 ++-- mm/percpu-vm.c | 5 mm/percpu.c | 208 +++++++++++++++++++++--- mm/process_vm_access.c | 2 mm/rmap.c | 2 mm/shmem.c | 5 mm/slab_common.c | 2 mm/swap.c | 13 - mm/swap_state.c | 80 +++++++-- mm/swapfile.c | 4 mm/usercopy.c | 2 mm/userfaultfd.c | 2 mm/vmscan.c | 36 ++-- mm/vmstat.c | 32 +++ mm/workingset.c | 23 +- mm/zpool.c | 8 mm/zsmalloc.c | 2 scripts/checkpatch.pl | 116 +++++++++---- scripts/gdb/linux/rbtree.py | 4 security/tomoyo/domain.c | 2 tools/testing/selftests/cgroup/test_kmem.c | 70 +++++++- tools/testing/selftests/kmod/kmod.sh | 4 tools/testing/selftests/vm/hmm-tests.c | 35 ++++ virt/kvm/async_pf.c | 2 virt/kvm/kvm_main.c | 2 268 files changed, 2481 insertions(+), 1551 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-08-07 6:16 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-08-07 6:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - A few MM hotfixes - kthread, tools, scripts, ntfs and ocfs2 - Some of MM 163 patches, based on d6efb3ac3e6c19ab722b28bdb9252bae0b9676b6. Subsystems affected by this patch series: mm/pagemap mm/hofixes mm/pagealloc kthread tools scripts ntfs ocfs2 mm/slab-generic mm/slab mm/slub mm/kcsan mm/debug mm/pagecache mm/gup mm/swap mm/shmem mm/memcg mm/pagemap mm/mremap mm/mincore mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/hugetlb mm/vmscan Subsystem: mm/pagemap Yang Shi <yang.shi@linux.alibaba.com>: mm/memory.c: avoid access flag update TLB flush for retried page fault Subsystem: mm/hofixes Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: fix migrate_pgmap_owner w/o CONFIG_MMU_NOTIFIER Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/shuffle: don't move pages between zones and don't read garbage memmaps Subsystem: kthread Peter Zijlstra <peterz@infradead.org>: mm: fix kthread_use_mm() vs TLB invalidate Ilias Stamatis <stamatis.iliass@gmail.com>: kthread: remove incorrect comment in kthread_create_on_cpu() Subsystem: tools "Alexander A. Klimov" <grandmaster@al2klimov.de>: tools/: replace HTTP links with HTTPS ones Gaurav Singh <gaurav1086@gmail.com>: tools/testing/selftests/cgroup/cgroup_util.c: cg_read_strcmp: fix null pointer dereference Subsystem: scripts Jialu Xu <xujialu@vimux.org>: scripts/tags.sh: collect compiled source precisely Nikolay Borisov <nborisov@suse.com>: scripts/bloat-o-meter: Support comparing library archives Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: scripts/decode_stacktrace.sh: skip missing symbols scripts/decode_stacktrace.sh: guess basepath if not specified scripts/decode_stacktrace.sh: guess path to modules scripts/decode_stacktrace.sh: guess path to vmlinux by release name Joe Perches <joe@perches.com>: const_structs.checkpatch: add regulator_ops Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ntfs Luca Stefani <luca.stefani.ge1@gmail.com>: ntfs: fix ntfs_test_inode and ntfs_init_locked_inode function type Subsystem: ocfs2 Gang He <ghe@suse.com>: ocfs2: fix remounting needed after setfacl command Randy Dunlap <rdunlap@infradead.org>: ocfs2: suballoc.h: delete a duplicated word Junxiao Bi <junxiao.bi@oracle.com>: ocfs2: change slot number type s16 to u16 "Alexander A. Klimov" <grandmaster@al2klimov.de>: ocfs2: replace HTTP links with HTTPS ones Pavel Machek <pavel@ucw.cz>: ocfs2: fix unbalanced locking Subsystem: mm/slab-generic Waiman Long <longman@redhat.com>: mm, treewide: rename kzfree() to kfree_sensitive() William Kucharski <william.kucharski@oracle.com>: mm: ksize() should silently accept a NULL pointer Subsystem: mm/slab Kees Cook <keescook@chromium.org>: Patch series "mm: Expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB": mm/slab: expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB mm/slab: add naive detection of double free Long Li <lonuxli.64@gmail.com>: mm, slab: check GFP_SLAB_BUG_MASK before alloc_pages in kmalloc_order Xiao Yang <yangx.jy@cn.fujitsu.com>: mm/slab.c: update outdated kmem_list3 in a comment Subsystem: mm/slub Vlastimil Babka <vbabka@suse.cz>: Patch series "slub_debug fixes and improvements": mm, slub: extend slub_debug syntax for multiple blocks mm, slub: make some slub_debug related attributes read-only mm, slub: remove runtime allocation order changes mm, slub: make remaining slub_debug related attributes read-only mm, slub: make reclaim_account attribute read-only mm, slub: introduce static key for slub_debug() mm, slub: introduce kmem_cache_debug_flags() mm, slub: extend checks guarded by slub_debug static key mm, slab/slub: move and improve cache_from_obj() mm, slab/slub: improve error reporting and overhead of cache_from_obj() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/slub.c: drop lockdep_assert_held() from put_map() Subsystem: mm/kcsan Marco Elver <elver@google.com>: mm, kcsan: instrument SLAB/SLUB free with "ASSERT_EXCLUSIVE_ACCESS" Subsystem: mm/debug Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug_vm_pgtable: Add some more tests", v5: mm/debug_vm_pgtable: add tests validating arch helpers for core MM features mm/debug_vm_pgtable: add tests validating advanced arch page table helpers mm/debug_vm_pgtable: add debug prints for individual tests Documentation/mm: add descriptions for arch page table helpers "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Improvements for dump_page()", v2: mm/debug: handle page->mapping better in dump_page mm/debug: dump compound page information on a second line mm/debug: print head flags in dump_page mm/debug: switch dump_page to get_kernel_nofault mm/debug: print the inode number in dump_page mm/debug: print hashed address of struct page John Hubbard <jhubbard@nvidia.com>: mm, dump_page: do not crash with bad compound_mapcount() Subsystem: mm/pagecache Yang Shi <yang.shi@linux.alibaba.com>: mm: filemap: clear idle flag for writes mm: filemap: add missing FGP_ flags in kerneldoc comment for pagecache_get_page Subsystem: mm/gup Tang Yizhou <tangyizhou@huawei.com>: mm/gup.c: fix the comment of return value for populate_vma_page_range() Subsystem: mm/swap Zhen Lei <thunder.leizhen@huawei.com>: Patch series "clean up some functions in mm/swap_slots.c": mm/swap_slots.c: simplify alloc_swap_slot_cache() mm/swap_slots.c: simplify enable_swap_slots_cache() mm/swap_slots.c: remove redundant check for swap_slot_cache_initialized Krzysztof Kozlowski <krzk@kernel.org>: mm: swap: fix kerneldoc of swap_vma_readahead() Xianting Tian <xianting_tian@126.com>: mm/page_io.c: use blk_io_schedule() for avoiding task hung in sync io Subsystem: mm/shmem Chris Down <chris@chrisdown.name>: Patch series "tmpfs: inode: Reduce risk of inum overflow", v7: tmpfs: per-superblock i_ino support tmpfs: support 64-bit inums per-sb Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: kmem: make memcg_kmem_enabled() irreversible Patch series "The new cgroup slab memory controller", v7: mm: memcg: factor out memcg- and lruvec-level changes out of __mod_lruvec_state() mm: memcg: prepare for byte-sized vmstat items mm: memcg: convert vmstat slab counters to bytes mm: slub: implement SLUB version of obj_to_index() Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: decouple reference counting from page accounting Roman Gushchin <guro@fb.com>: mm: memcg/slab: obj_cgroup API mm: memcg/slab: allocate obj_cgroups for non-root slab pages mm: memcg/slab: save obj_cgroup for non-root slab objects mm: memcg/slab: charge individual slab objects instead of pages mm: memcg/slab: deprecate memory.kmem.slabinfo mm: memcg/slab: move memcg_kmem_bypass() to memcontrol.h mm: memcg/slab: use a single set of kmem_caches for all accounted allocations mm: memcg/slab: simplify memcg cache creation mm: memcg/slab: remove memcg_kmem_get_cache() mm: memcg/slab: deprecate slab_root_caches mm: memcg/slab: remove redundant check in memcg_accumulate_slabinfo() mm: memcg/slab: use a single set of kmem_caches for all allocations kselftests: cgroup: add kernel memory accounting tests tools/cgroup: add memcg_slabinfo.py tool Shakeel Butt <shakeelb@google.com>: mm: memcontrol: account kernel stack per node Roman Gushchin <guro@fb.com>: mm: memcg/slab: remove unused argument by charge_slab_page() mm: slab: rename (un)charge_slab_page() to (un)account_slab_page() mm: kmem: switch to static_branch_likely() in memcg_kmem_enabled() mm: memcontrol: avoid workload stalls when lowering memory.high Chris Down <chris@chrisdown.name>: Patch series "mm, memcg: reclaim harder before high throttling", v2: mm, memcg: reclaim more aggressively before high allocator throttling mm, memcg: unify reclaim retry limits with page allocator Yafang Shao <laoar.shao@gmail.com>: Patch series "mm, memcg: memory.{low,min} reclaim fix & cleanup", v4: mm, memcg: avoid stale protection values when cgroup is above protection Chris Down <chris@chrisdown.name>: mm, memcg: decouple e{low,min} state mutations from protection checks Yafang Shao <laoar.shao@gmail.com>: memcg, oom: check memcg margin for parallel oom Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: restore proper dirty throttling when memory.high changes mm: memcontrol: don't count limit-setting reclaim as memory pressure Michal Koutný <mkoutny@suse.com>: mm/page_counter.c: fix protection usage propagation Subsystem: mm/pagemap Ralph Campbell <rcampbell@nvidia.com>: mm: remove redundant check non_swap_entry() Alex Zhang <zhangalex@google.com>: mm/memory.c: make remap_pfn_range() reject unaligned addr Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: cleanup usage of <asm/pgalloc.h>": mm: remove unneeded includes of <asm/pgalloc.h> opeinrisc: switch to generic version of pte allocation xtensa: switch to generic version of pte allocation asm-generic: pgalloc: provide generic pmd_alloc_one() and pmd_free_one() asm-generic: pgalloc: provide generic pud_alloc_one() and pud_free_one() asm-generic: pgalloc: provide generic pgd_free() mm: move lib/ioremap.c to mm/ Joerg Roedel <jroedel@suse.de>: mm: move p?d_alloc_track to separate header file Zhen Lei <thunder.leizhen@huawei.com>: mm/mmap: optimize a branch judgment in ksys_mmap_pgoff() Feng Tang <feng.tang@intel.com>: Patch series "make vm_committed_as_batch aware of vm overcommit policy", v6: proc/meminfo: avoid open coded reading of vm_committed_as mm/util.c: make vm_memory_committed() more accurate percpu_counter: add percpu_counter_sync() mm: adjust vm_committed_as_batch according to vm overcommit policy Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "arm64: Enable vmemmap mapping from device memory", v4: mm/sparsemem: enable vmem_altmap support in vmemmap_populate_basepages() mm/sparsemem: enable vmem_altmap support in vmemmap_alloc_block_buf() arm64/mm: enable vmem_altmap support for vmemmap mappings Miaohe Lin <linmiaohe@huawei.com>: mm: mmap: merge vma after call_mmap() if possible Peter Collingbourne <pcc@google.com>: mm: remove unnecessary wrapper function do_mmap_pgoff() Subsystem: mm/mremap Wei Yang <richard.weiyang@linux.alibaba.com>: Patch series "mm/mremap: cleanup move_page_tables() a little", v5: mm/mremap: it is sure to have enough space when extent meets requirement mm/mremap: calculate extent in one place mm/mremap: start addresses are properly aligned Subsystem: mm/mincore Ricardo Cañuelo <ricardo.canuelo@collabora.com>: selftests: add mincore() tests Subsystem: mm/sparsemem Wei Yang <richard.weiyang@linux.alibaba.com>: mm/sparse: never partially remove memmap for early section mm/sparse: only sub-section aligned range would be populated Mike Rapoport <rppt@linux.ibm.com>: mm/sparse: cleanup the code surrounding memory_present() Subsystem: mm/vmalloc "Matthew Wilcox (Oracle)" <willy@infradead.org>: vmalloc: convert to XArray "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: simplify merge_or_add_vmap_area() mm/vmalloc: simplify augment_tree_propagate_check() mm/vmalloc: switch to "propagate()" callback mm/vmalloc: update the header about KVA rework Mike Rapoport <rppt@linux.ibm.com>: mm: vmalloc: remove redundant assignment in unmap_kernel_range_noflush() "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc.c: remove BUG() from the find_va_links() Subsystem: mm/kasan Marco Elver <elver@google.com>: kasan: improve and simplify Kconfig.kasan kasan: update required compiler versions in documentation Walter Wu <walter-zh.wu@mediatek.com>: Patch series "kasan: memorize and print call_rcu stack", v8: rcu: kasan: record and print call_rcu() call stack kasan: record and print the free track kasan: add tests for call_rcu stack recording kasan: update documentation for generic kasan Vincenzo Frascino <vincenzo.frascino@arm.com>: kasan: remove kasan_unpoison_stack_above_sp_to() Walter Wu <walter-zh.wu@mediatek.com>: lib/test_kasan.c: fix KASAN unit tests for tag-based KASAN Andrey Konovalov <andreyknvl@google.com>: Patch series "kasan: support stack instrumentation for tag-based mode", v2: kasan: don't tag stacks allocated with pagealloc efi: provide empty efi_enter_virtual_mode implementation kasan, arm64: don't instrument functions that enable kasan kasan: allow enabling stack tagging for tag-based mode kasan: adjust kasan_stack_oob for tag-based mode Subsystem: mm/pagealloc Vlastimil Babka <vbabka@suse.cz>: mm, page_alloc: use unlikely() in task_capc() Jaewon Kim <jaewon31.kim@samsung.com>: page_alloc: consider highatomic reserve in watermark fast Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: skip ->waternark_boost for atomic order-0 allocations David Hildenbrand <david@redhat.com>: mm: remove vm_total_pages mm/page_alloc: remove nr_free_pagecache_pages() mm/memory_hotplug: document why shuffle_zone() is relevant mm/shuffle: remove dynamic reconfiguration Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_alloc.c: replace the definition of NR_MIGRATETYPE_BITS with PB_migratetype_bits mm/page_alloc.c: extract the common part in pfn_to_bitidx() mm/page_alloc.c: simplify pageblock bitmap access mm/page_alloc.c: remove unnecessary end_bitidx for [set|get]_pfnblock_flags_mask() Qian Cai <cai@lca.pw>: mm/page_alloc: silence a KASAN false positive Wei Yang <richard.weiyang@linux.alibaba.com>: mm/page_alloc: fallbacks at most has 3 elements Muchun Song <songmuchun@bytedance.com>: mm/page_alloc.c: skip setting nodemask when we are in interrupt Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/page_alloc: fix memalloc_nocma_{save/restore} APIs Subsystem: mm/hugetlb "Alexander A. Klimov" <grandmaster@al2klimov.de>: mm: thp: replace HTTP links with HTTPS ones Peter Xu <peterx@redhat.com>: mm/hugetlb: fix calculation of adjust_range_if_pmd_sharing_possible Hugh Dickins <hughd@google.com>: khugepaged: collapse_pte_mapped_thp() flush the right range khugepaged: collapse_pte_mapped_thp() protect the pmd lock khugepaged: retract_page_tables() remember to test exit khugepaged: khugepaged_test_exit() check mmget_still_valid() Subsystem: mm/vmscan dylan-meiners <spacct.spacct@gmail.com>: mm/vmscan.c: fix typo Shakeel Butt <shakeelb@google.com>: mm: vmscan: consistent update to pgrefill Documentation/admin-guide/kernel-parameters.txt | 2 Documentation/dev-tools/kasan.rst | 10 Documentation/filesystems/dlmfs.rst | 2 Documentation/filesystems/ocfs2.rst | 2 Documentation/filesystems/tmpfs.rst | 18 Documentation/vm/arch_pgtable_helpers.rst | 258 +++++ Documentation/vm/memory-model.rst | 9 Documentation/vm/slub.rst | 51 - arch/alpha/include/asm/pgalloc.h | 21 arch/alpha/include/asm/tlbflush.h | 1 arch/alpha/kernel/core_irongate.c | 1 arch/alpha/kernel/core_marvel.c | 1 arch/alpha/kernel/core_titan.c | 1 arch/alpha/kernel/machvec_impl.h | 2 arch/alpha/kernel/smp.c | 1 arch/alpha/mm/numa.c | 1 arch/arc/mm/fault.c | 1 arch/arc/mm/init.c | 1 arch/arm/include/asm/pgalloc.h | 12 arch/arm/include/asm/tlb.h | 1 arch/arm/kernel/machine_kexec.c | 1 arch/arm/kernel/smp.c | 1 arch/arm/kernel/suspend.c | 1 arch/arm/mach-omap2/omap-mpuss-lowpower.c | 1 arch/arm/mm/hugetlbpage.c | 1 arch/arm/mm/init.c | 9 arch/arm/mm/mmu.c | 1 arch/arm64/include/asm/pgalloc.h | 39 arch/arm64/kernel/setup.c | 2 arch/arm64/kernel/smp.c | 1 arch/arm64/mm/hugetlbpage.c | 1 arch/arm64/mm/init.c | 6 arch/arm64/mm/ioremap.c | 1 arch/arm64/mm/mmu.c | 63 - arch/csky/include/asm/pgalloc.h | 7 arch/csky/kernel/smp.c | 1 arch/hexagon/include/asm/pgalloc.h | 7 arch/ia64/include/asm/pgalloc.h | 24 arch/ia64/include/asm/tlb.h | 1 arch/ia64/kernel/process.c | 1 arch/ia64/kernel/smp.c | 1 arch/ia64/kernel/smpboot.c | 1 arch/ia64/mm/contig.c | 1 arch/ia64/mm/discontig.c | 4 arch/ia64/mm/hugetlbpage.c | 1 arch/ia64/mm/tlb.c | 1 arch/m68k/include/asm/mmu_context.h | 2 arch/m68k/include/asm/sun3_pgalloc.h | 7 arch/m68k/kernel/dma.c | 2 arch/m68k/kernel/traps.c | 3 arch/m68k/mm/cache.c | 2 arch/m68k/mm/fault.c | 1 arch/m68k/mm/kmap.c | 2 arch/m68k/mm/mcfmmu.c | 1 arch/m68k/mm/memory.c | 1 arch/m68k/sun3x/dvma.c | 2 arch/microblaze/include/asm/pgalloc.h | 6 arch/microblaze/include/asm/tlbflush.h | 1 arch/microblaze/kernel/process.c | 1 arch/microblaze/kernel/signal.c | 1 arch/microblaze/mm/init.c | 3 arch/mips/include/asm/pgalloc.h | 19 arch/mips/kernel/setup.c | 8 arch/mips/loongson64/numa.c | 1 arch/mips/sgi-ip27/ip27-memory.c | 2 arch/mips/sgi-ip32/ip32-memory.c | 1 arch/nds32/mm/mm-nds32.c | 2 arch/nios2/include/asm/pgalloc.h | 7 arch/openrisc/include/asm/pgalloc.h | 33 arch/openrisc/include/asm/tlbflush.h | 1 arch/openrisc/kernel/or32_ksyms.c | 1 arch/parisc/include/asm/mmu_context.h | 1 arch/parisc/include/asm/pgalloc.h | 12 arch/parisc/kernel/cache.c | 1 arch/parisc/kernel/pci-dma.c | 1 arch/parisc/kernel/process.c | 1 arch/parisc/kernel/signal.c | 1 arch/parisc/kernel/smp.c | 1 arch/parisc/mm/hugetlbpage.c | 1 arch/parisc/mm/init.c | 5 arch/parisc/mm/ioremap.c | 2 arch/powerpc/include/asm/tlb.h | 1 arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/hash_pgtable.c | 1 arch/powerpc/mm/book3s64/hash_tlb.c | 1 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1 arch/powerpc/mm/init_32.c | 1 arch/powerpc/mm/init_64.c | 4 arch/powerpc/mm/kasan/8xx.c | 1 arch/powerpc/mm/kasan/book3s_32.c | 1 arch/powerpc/mm/mem.c | 3 arch/powerpc/mm/nohash/40x.c | 1 arch/powerpc/mm/nohash/8xx.c | 1 arch/powerpc/mm/nohash/fsl_booke.c | 1 arch/powerpc/mm/nohash/kaslr_booke.c | 1 arch/powerpc/mm/nohash/tlb.c | 1 arch/powerpc/mm/numa.c | 1 arch/powerpc/mm/pgtable.c | 1 arch/powerpc/mm/pgtable_64.c | 1 arch/powerpc/mm/ptdump/hashpagetable.c | 2 arch/powerpc/mm/ptdump/ptdump.c | 1 arch/powerpc/platforms/pseries/cmm.c | 1 arch/riscv/include/asm/pgalloc.h | 18 arch/riscv/mm/fault.c | 1 arch/riscv/mm/init.c | 3 arch/s390/crypto/prng.c | 4 arch/s390/include/asm/tlb.h | 1 arch/s390/include/asm/tlbflush.h | 1 arch/s390/kernel/machine_kexec.c | 1 arch/s390/kernel/ptrace.c | 1 arch/s390/kvm/diag.c | 1 arch/s390/kvm/priv.c | 1 arch/s390/kvm/pv.c | 1 arch/s390/mm/cmm.c | 1 arch/s390/mm/init.c | 1 arch/s390/mm/mmap.c | 1 arch/s390/mm/pgtable.c | 1 arch/sh/include/asm/pgalloc.h | 4 arch/sh/kernel/idle.c | 1 arch/sh/kernel/machine_kexec.c | 1 arch/sh/mm/cache-sh3.c | 1 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/hugetlbpage.c | 1 arch/sh/mm/init.c | 7 arch/sh/mm/ioremap_fixed.c | 1 arch/sh/mm/numa.c | 3 arch/sh/mm/tlb-sh3.c | 1 arch/sparc/include/asm/ide.h | 1 arch/sparc/include/asm/tlb_64.h | 1 arch/sparc/kernel/leon_smp.c | 1 arch/sparc/kernel/process_32.c | 1 arch/sparc/kernel/signal_32.c | 1 arch/sparc/kernel/smp_32.c | 1 arch/sparc/kernel/smp_64.c | 1 arch/sparc/kernel/sun4m_irq.c | 1 arch/sparc/mm/highmem.c | 1 arch/sparc/mm/init_64.c | 1 arch/sparc/mm/io-unit.c | 1 arch/sparc/mm/iommu.c | 1 arch/sparc/mm/tlb.c | 1 arch/um/include/asm/pgalloc.h | 9 arch/um/include/asm/pgtable-3level.h | 3 arch/um/kernel/mem.c | 17 arch/x86/ia32/ia32_aout.c | 1 arch/x86/include/asm/mmu_context.h | 1 arch/x86/include/asm/pgalloc.h | 42 arch/x86/kernel/alternative.c | 1 arch/x86/kernel/apic/apic.c | 1 arch/x86/kernel/mpparse.c | 1 arch/x86/kernel/traps.c | 1 arch/x86/mm/fault.c | 1 arch/x86/mm/hugetlbpage.c | 1 arch/x86/mm/init_32.c | 2 arch/x86/mm/init_64.c | 12 arch/x86/mm/kaslr.c | 1 arch/x86/mm/pgtable_32.c | 1 arch/x86/mm/pti.c | 1 arch/x86/platform/uv/bios_uv.c | 1 arch/x86/power/hibernate.c | 2 arch/xtensa/include/asm/pgalloc.h | 46 arch/xtensa/kernel/xtensa_ksyms.c | 1 arch/xtensa/mm/cache.c | 1 arch/xtensa/mm/fault.c | 1 crypto/adiantum.c | 2 crypto/ahash.c | 4 crypto/api.c | 2 crypto/asymmetric_keys/verify_pefile.c | 4 crypto/deflate.c | 2 crypto/drbg.c | 10 crypto/ecc.c | 8 crypto/ecdh.c | 2 crypto/gcm.c | 2 crypto/gf128mul.c | 4 crypto/jitterentropy-kcapi.c | 2 crypto/rng.c | 2 crypto/rsa-pkcs1pad.c | 6 crypto/seqiv.c | 2 crypto/shash.c | 2 crypto/skcipher.c | 2 crypto/testmgr.c | 6 crypto/zstd.c | 2 drivers/base/node.c | 10 drivers/block/xen-blkback/common.h | 1 drivers/crypto/allwinner/sun8i-ce/sun8i-ce-cipher.c | 2 drivers/crypto/allwinner/sun8i-ss/sun8i-ss-cipher.c | 2 drivers/crypto/amlogic/amlogic-gxl-cipher.c | 4 drivers/crypto/atmel-ecc.c | 2 drivers/crypto/caam/caampkc.c | 28 drivers/crypto/cavium/cpt/cptvf_main.c | 6 drivers/crypto/cavium/cpt/cptvf_reqmanager.c | 12 drivers/crypto/cavium/nitrox/nitrox_lib.c | 4 drivers/crypto/cavium/zip/zip_crypto.c | 6 drivers/crypto/ccp/ccp-crypto-rsa.c | 6 drivers/crypto/ccree/cc_aead.c | 4 drivers/crypto/ccree/cc_buffer_mgr.c | 4 drivers/crypto/ccree/cc_cipher.c | 6 drivers/crypto/ccree/cc_hash.c | 8 drivers/crypto/ccree/cc_request_mgr.c | 2 drivers/crypto/marvell/cesa/hash.c | 2 drivers/crypto/marvell/octeontx/otx_cptvf_main.c | 6 drivers/crypto/marvell/octeontx/otx_cptvf_reqmgr.h | 2 drivers/crypto/nx/nx.c | 4 drivers/crypto/virtio/virtio_crypto_algs.c | 12 drivers/crypto/virtio/virtio_crypto_core.c | 2 drivers/iommu/ipmmu-vmsa.c | 1 drivers/md/dm-crypt.c | 32 drivers/md/dm-integrity.c | 6 drivers/misc/ibmvmc.c | 6 drivers/net/ethernet/hisilicon/hns3/hns3pf/hclge_mbx.c | 2 drivers/net/ethernet/intel/ixgbe/ixgbe_ipsec.c | 6 drivers/net/ppp/ppp_mppe.c | 6 drivers/net/wireguard/noise.c | 4 drivers/net/wireguard/peer.c | 2 drivers/net/wireless/intel/iwlwifi/pcie/rx.c | 2 drivers/net/wireless/intel/iwlwifi/pcie/tx-gen2.c | 6 drivers/net/wireless/intel/iwlwifi/pcie/tx.c | 6 drivers/net/wireless/intersil/orinoco/wext.c | 4 drivers/s390/crypto/ap_bus.h | 4 drivers/staging/ks7010/ks_hostif.c | 2 drivers/staging/rtl8723bs/core/rtw_security.c | 2 drivers/staging/wlan-ng/p80211netdev.c | 2 drivers/target/iscsi/iscsi_target_auth.c | 2 drivers/xen/balloon.c | 1 drivers/xen/privcmd.c | 1 fs/Kconfig | 21 fs/aio.c | 6 fs/binfmt_elf_fdpic.c | 1 fs/cifs/cifsencrypt.c | 2 fs/cifs/connect.c | 10 fs/cifs/dfs_cache.c | 2 fs/cifs/misc.c | 8 fs/crypto/inline_crypt.c | 5 fs/crypto/keyring.c | 6 fs/crypto/keysetup_v1.c | 4 fs/ecryptfs/keystore.c | 4 fs/ecryptfs/messaging.c | 2 fs/hugetlbfs/inode.c | 2 fs/ntfs/dir.c | 2 fs/ntfs/inode.c | 27 fs/ntfs/inode.h | 4 fs/ntfs/mft.c | 4 fs/ocfs2/Kconfig | 6 fs/ocfs2/acl.c | 2 fs/ocfs2/blockcheck.c | 2 fs/ocfs2/dlmglue.c | 8 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/suballoc.c | 4 fs/ocfs2/suballoc.h | 2 fs/ocfs2/super.c | 4 fs/proc/meminfo.c | 10 include/asm-generic/pgalloc.h | 80 + include/asm-generic/tlb.h | 1 include/crypto/aead.h | 2 include/crypto/akcipher.h | 2 include/crypto/gf128mul.h | 2 include/crypto/hash.h | 2 include/crypto/internal/acompress.h | 2 include/crypto/kpp.h | 2 include/crypto/skcipher.h | 2 include/linux/efi.h | 4 include/linux/fs.h | 17 include/linux/huge_mm.h | 2 include/linux/kasan.h | 4 include/linux/memcontrol.h | 209 +++- include/linux/mm.h | 86 - include/linux/mm_types.h | 5 include/linux/mman.h | 4 include/linux/mmu_notifier.h | 13 include/linux/mmzone.h | 54 - include/linux/pageblock-flags.h | 30 include/linux/percpu_counter.h | 4 include/linux/sched/mm.h | 8 include/linux/shmem_fs.h | 3 include/linux/slab.h | 11 include/linux/slab_def.h | 9 include/linux/slub_def.h | 31 include/linux/swap.h | 2 include/linux/vmstat.h | 14 init/Kconfig | 9 init/main.c | 2 ipc/shm.c | 2 kernel/fork.c | 54 - kernel/kthread.c | 8 kernel/power/snapshot.c | 2 kernel/rcu/tree.c | 2 kernel/scs.c | 2 kernel/sysctl.c | 2 lib/Kconfig.kasan | 39 lib/Makefile | 1 lib/ioremap.c | 287 ----- lib/mpi/mpiutil.c | 6 lib/percpu_counter.c | 19 lib/test_kasan.c | 87 + mm/Kconfig | 6 mm/Makefile | 2 mm/debug.c | 103 +- mm/debug_vm_pgtable.c | 666 +++++++++++++ mm/filemap.c | 9 mm/gup.c | 3 mm/huge_memory.c | 14 mm/hugetlb.c | 25 mm/ioremap.c | 289 +++++ mm/kasan/common.c | 41 mm/kasan/generic.c | 43 mm/kasan/generic_report.c | 1 mm/kasan/kasan.h | 25 mm/kasan/quarantine.c | 1 mm/kasan/report.c | 54 - mm/kasan/tags.c | 37 mm/khugepaged.c | 75 - mm/memcontrol.c | 832 ++++++++++------- mm/memory.c | 15 mm/memory_hotplug.c | 11 mm/migrate.c | 6 mm/mm_init.c | 20 mm/mmap.c | 45 mm/mremap.c | 19 mm/nommu.c | 6 mm/oom_kill.c | 2 mm/page-writeback.c | 6 mm/page_alloc.c | 226 ++-- mm/page_counter.c | 6 mm/page_io.c | 2 mm/pgalloc-track.h | 51 + mm/shmem.c | 133 ++ mm/shuffle.c | 46 mm/shuffle.h | 17 mm/slab.c | 129 +- mm/slab.h | 755 ++++++--------- mm/slab_common.c | 829 ++-------------- mm/slob.c | 12 mm/slub.c | 680 ++++--------- mm/sparse-vmemmap.c | 62 - mm/sparse.c | 31 mm/swap_slots.c | 45 mm/swap_state.c | 2 mm/util.c | 52 + mm/vmalloc.c | 176 +-- mm/vmscan.c | 39 mm/vmstat.c | 38 mm/workingset.c | 6 net/atm/mpoa_caches.c | 4 net/bluetooth/ecdh_helper.c | 6 net/bluetooth/smp.c | 24 net/core/sock.c | 2 net/ipv4/tcp_fastopen.c | 2 net/mac80211/aead_api.c | 4 net/mac80211/aes_gmac.c | 2 net/mac80211/key.c | 2 net/mac802154/llsec.c | 20 net/sctp/auth.c | 2 net/sunrpc/auth_gss/gss_krb5_crypto.c | 4 net/sunrpc/auth_gss/gss_krb5_keys.c | 6 net/sunrpc/auth_gss/gss_krb5_mech.c | 2 net/tipc/crypto.c | 10 net/wireless/core.c | 2 net/wireless/ibss.c | 4 net/wireless/lib80211_crypt_tkip.c | 2 net/wireless/lib80211_crypt_wep.c | 2 net/wireless/nl80211.c | 24 net/wireless/sme.c | 6 net/wireless/util.c | 2 net/wireless/wext-sme.c | 2 scripts/Makefile.kasan | 3 scripts/bloat-o-meter | 2 scripts/coccinelle/free/devm_free.cocci | 4 scripts/coccinelle/free/ifnullfree.cocci | 4 scripts/coccinelle/free/kfree.cocci | 6 scripts/coccinelle/free/kfreeaddr.cocci | 2 scripts/const_structs.checkpatch | 1 scripts/decode_stacktrace.sh | 85 + scripts/spelling.txt | 19 scripts/tags.sh | 18 security/apparmor/domain.c | 4 security/apparmor/include/file.h | 2 security/apparmor/policy.c | 24 security/apparmor/policy_ns.c | 6 security/apparmor/policy_unpack.c | 14 security/keys/big_key.c | 6 security/keys/dh.c | 14 security/keys/encrypted-keys/encrypted.c | 14 security/keys/trusted-keys/trusted_tpm1.c | 34 security/keys/user_defined.c | 6 tools/cgroup/memcg_slabinfo.py | 226 ++++ tools/include/linux/jhash.h | 2 tools/lib/rbtree.c | 2 tools/lib/traceevent/event-parse.h | 2 tools/testing/ktest/examples/README | 2 tools/testing/ktest/examples/crosstests.conf | 2 tools/testing/selftests/Makefile | 1 tools/testing/selftests/cgroup/.gitignore | 1 tools/testing/selftests/cgroup/Makefile | 2 tools/testing/selftests/cgroup/cgroup_util.c | 2 tools/testing/selftests/cgroup/test_kmem.c | 382 +++++++ tools/testing/selftests/mincore/.gitignore | 2 tools/testing/selftests/mincore/Makefile | 6 tools/testing/selftests/mincore/mincore_selftest.c | 361 +++++++ 397 files changed, 5547 insertions(+), 4072 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-07-24 4:14 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-07-24 4:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 patches, based on f37e99aca03f63aa3f2bd13ceaf769455d12c4b0. Subsystems affected by this patch series: mm/pagemap mm/shmem mm/hotfixes mm/memcg mm/hugetlb mailmap squashfs scripts io-mapping MAINTAINERS gdb Subsystem: mm/pagemap Yang Shi <yang.shi@linux.alibaba.com>: mm/memory.c: avoid access flag update TLB flush for retried page fault "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: mm/mmap.c: close race between munmap() and expand_upwards()/downwards() Subsystem: mm/shmem Chengguang Xu <cgxu519@mykernel.net>: vfs/xattr: mm/shmem: kernfs: release simple xattr entry in a right way Subsystem: mm/hotfixes Tom Rix <trix@redhat.com>: mm: initialize return of vm_insert_pages Bhupesh Sharma <bhsharma@redhat.com>: mm/memcontrol: fix OOPS inside mem_cgroup_get_nr_swap_pages() Subsystem: mm/memcg Hugh Dickins <hughd@google.com>: mm/memcg: fix refcount error while moving and swapping Muchun Song <songmuchun@bytedance.com>: mm: memcg/slab: fix memory leak at non-root kmem_cache destroy Subsystem: mm/hugetlb Barry Song <song.bao.hua@hisilicon.com>: mm/hugetlb: avoid hardcoding while checking if cma is enabled "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: khugepaged: fix null-pointer dereference due to race Subsystem: mailmap Mike Rapoport <rppt@linux.ibm.com>: mailmap: add entry for Mike Rapoport Subsystem: squashfs Phillip Lougher <phillip@squashfs.org.uk>: squashfs: fix length field overlap check in metadata reading Subsystem: scripts Pi-Hsun Shih <pihsun@chromium.org>: scripts/decode_stacktrace: strip basepath from all paths Subsystem: io-mapping "Michael J. Ruhl" <michael.j.ruhl@intel.com>: io-mapping: indicate mapping failure Subsystem: MAINTAINERS Andrey Konovalov <andreyknvl@google.com>: MAINTAINERS: add KCOV section Subsystem: gdb Stefano Garzarella <sgarzare@redhat.com>: scripts/gdb: fix lx-symbols 'gdb.error' while loading modules .mailmap | 3 +++ MAINTAINERS | 11 +++++++++++ fs/squashfs/block.c | 2 +- include/linux/io-mapping.h | 5 ++++- include/linux/xattr.h | 3 ++- mm/hugetlb.c | 15 ++++++++++----- mm/khugepaged.c | 3 +++ mm/memcontrol.c | 13 ++++++++++--- mm/memory.c | 9 +++++++-- mm/mmap.c | 16 ++++++++++++++-- mm/shmem.c | 2 +- mm/slab_common.c | 35 ++++++++++++++++++++++++++++------- scripts/decode_stacktrace.sh | 4 ++-- scripts/gdb/linux/symbols.py | 2 +- 14 files changed, 97 insertions(+), 26 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-07-03 22:14 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822. Subsystems affected by this patch series: mm/hugetlb samples mm/cma mm/vmalloc mm/pagealloc Subsystem: mm/hugetlb Mike Kravetz <mike.kravetz@oracle.com>: mm/hugetlb.c: fix pages per hugetlb calculation Subsystem: samples Kees Cook <keescook@chromium.org>: samples/vfs: avoid warning in statx override Subsystem: mm/cma Barry Song <song.bao.hua@hisilicon.com>: mm/cma.c: use exact_nid true to fix possible per-numa cma leak Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: vmalloc: fix the owner argument for the new __vmalloc_node_range callers Subsystem: mm/pagealloc Joel Savitz <jsavitz@redhat.com>: mm/page_alloc: fix documentation error arch/arm64/kernel/probes/kprobes.c | 2 +- arch/x86/hyperv/hv_init.c | 3 ++- kernel/module.c | 2 +- mm/cma.c | 4 ++-- mm/hugetlb.c | 2 +- mm/page_alloc.c | 2 +- samples/vfs/test-statx.c | 2 ++ 7 files changed, 10 insertions(+), 7 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-26 3:28 Andrew Morton 2020-06-26 6:51 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-06-26 3:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. Subsystems affected by this patch series: hotfixes mm/pagealloc kexec ocfs2 lib misc mm/slab mm/slab mm/slub mm/swap mm/pagemap mm/vmalloc mm/memcg mm/gup mm/thp mm/vmscan x86 mm/memory-hotplug MAINTAINERS Subsystem: hotfixes Stafford Horne <shorne@gmail.com>: openrisc: fix boot oops when DEBUG_VM is enabled Michal Hocko <mhocko@suse.com>: mm: do_swap_page(): fix up the error code Subsystem: mm/pagealloc Vlastimil Babka <vbabka@suse.cz>: mm, compaction: make capture control handling safe wrt interrupts Subsystem: kexec Lianbo Jiang <lijiang@redhat.com>: kexec: do not verify the signature without the lockdown or mandatory signature Subsystem: ocfs2 Junxiao Bi <junxiao.bi@oracle.com>: Patch series "ocfs2: fix nfsd over ocfs2 issues", v2: ocfs2: avoid inode removal while nfsd is accessing it ocfs2: load global_inode_alloc ocfs2: fix panic on nfs server over ocfs2 ocfs2: fix value of OCFS2_INVALID_SLOT Subsystem: lib Randy Dunlap <rdunlap@infradead.org>: lib: fix test_hmm.c reference after free Subsystem: misc Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: fix unsigned less than zero warnings Subsystem: mm/slab Waiman Long <longman@redhat.com>: mm, slab: fix sign conversion problem in memcg_uncharge_slab() Subsystem: mm/slab Waiman Long <longman@redhat.com>: mm/slab: use memzero_explicit() in kzfree() Subsystem: mm/slub Sebastian Andrzej Siewior <bigeasy@linutronix.de>: slub: cure list_slab_objects() from double fix Subsystem: mm/swap Hugh Dickins <hughd@google.com>: mm: fix swap cache node allocation mask Subsystem: mm/pagemap Arjun Roy <arjunroy@google.com>: mm/memory.c: properly pte_offset_map_lock/unlock in vm_insert_pages() Christophe Leroy <christophe.leroy@csgroup.eu>: mm/debug_vm_pgtable: fix build failure with powerpc 8xx Stephen Rothwell <sfr@canb.auug.org.au>: make asm-generic/cacheflush.h more standalone Nathan Chancellor <natechancellor@gmail.com>: media: omap3isp: remove cacheflush.h Subsystem: mm/vmalloc Masanari Iida <standby24x7@gmail.com>: mm/vmalloc.c: fix a warning while make xmldocs Subsystem: mm/memcg Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: handle div0 crash race condition in memory.low Muchun Song <songmuchun@bytedance.com>: mm/memcontrol.c: add missed css_put() Chris Down <chris@chrisdown.name>: mm/memcontrol.c: prevent missed memory.low load tears Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: docs: mm/gup: minor documentation update Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: doc: THP CoW fault no longer allocate THP Subsystem: mm/vmscan Johannes Weiner <hannes@cmpxchg.org>: Patch series "fix for "mm: balance LRU lists based on relative thrashing" patchset": mm: workingset: age nonresident information alongside anonymous pages Joonsoo Kim <iamjoonsoo.kim@lge.com>: mm/swap: fix for "mm: workingset: age nonresident information alongside anonymous pages" mm/memory: fix IO cost for anonymous page Subsystem: x86 Christoph Hellwig <hch@lst.de>: Patch series "fix a hyperv W^X violation and remove vmalloc_exec": x86/hyperv: allocate the hypercall page with only read and execute bits arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page mm: remove vmalloc_exec Subsystem: mm/memory-hotplug Ben Widawsky <ben.widawsky@intel.com>: mm/memory_hotplug.c: fix false softlockup during pfn range removal Subsystem: MAINTAINERS Luc Van Oostenryck <luc.vanoostenryck@gmail.com>: MAINTAINERS: update info for sparse Documentation/admin-guide/cgroup-v2.rst | 4 +- Documentation/admin-guide/mm/transhuge.rst | 3 - Documentation/core-api/pin_user_pages.rst | 2 - MAINTAINERS | 4 +- arch/arm64/kernel/probes/kprobes.c | 12 +------ arch/openrisc/kernel/dma.c | 5 +++ arch/x86/hyperv/hv_init.c | 4 +- arch/x86/include/asm/pgtable_types.h | 2 + drivers/media/platform/omap3isp/isp.c | 2 - drivers/media/platform/omap3isp/ispvideo.c | 1 fs/ocfs2/dlmglue.c | 17 ++++++++++ fs/ocfs2/ocfs2.h | 1 fs/ocfs2/ocfs2_fs.h | 4 +- fs/ocfs2/suballoc.c | 9 +++-- include/asm-generic/cacheflush.h | 5 +++ include/linux/bits.h | 3 + include/linux/mmzone.h | 4 +- include/linux/swap.h | 1 include/linux/vmalloc.h | 1 kernel/kexec_file.c | 36 ++++------------------ kernel/module.c | 4 +- lib/test_hmm.c | 3 - mm/compaction.c | 17 ++++++++-- mm/debug_vm_pgtable.c | 4 +- mm/memcontrol.c | 18 ++++++++--- mm/memory.c | 33 +++++++++++++------- mm/memory_hotplug.c | 13 ++++++-- mm/nommu.c | 17 ---------- mm/slab.h | 4 +- mm/slab_common.c | 2 - mm/slub.c | 19 ++--------- mm/swap.c | 3 - mm/swap_state.c | 4 +- mm/vmalloc.c | 21 ------------- mm/vmscan.c | 3 + mm/workingset.c | 46 +++++++++++++++++------------ 36 files changed, 168 insertions(+), 163 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-26 3:28 incoming Andrew Morton @ 2020-06-26 6:51 ` Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 0 siblings, 2 replies; 389+ messages in thread From: Linus Torvalds @ 2020-06-26 6:51 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. You didn't cc lkml, so now none of the nice 'b4' automation seems to work for this series.. Yes, this cover-letter went to linux-mm (which is on lore), but the individual patches didn't. Konstantin, maybe mm-commits could be on lore too and then they'd have been caught that way? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-26 6:51 ` incoming Linus Torvalds @ 2020-06-26 7:31 ` Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 1 sibling, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2020-06-26 7:31 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Jun 25, 2020 at 11:51 PM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > You didn't cc lkml, so now none of the nice 'b4' automation seems to > work for this series.. Note that I've picked them up the old-fashioned way, so don't re-send them. So more of a note for "please, next time..." Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-26 6:51 ` incoming Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds @ 2020-06-26 17:39 ` Konstantin Ryabitsev 2020-06-26 17:40 ` incoming Konstantin Ryabitsev 1 sibling, 1 reply; 389+ messages in thread From: Konstantin Ryabitsev @ 2020-06-26 17:39 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Thu, Jun 25, 2020 at 11:51:06PM -0700, Linus Torvalds wrote: > On Thu, Jun 25, 2020 at 8:28 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > 32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a. > > You didn't cc lkml, so now none of the nice 'b4' automation seems to > work for this series.. > > Yes, this cover-letter went to linux-mm (which is on lore), but the > individual patches didn't. > > Konstantin, maybe mm-commits could be on lore too and then they'd have > been caught that way? Yes, I already have a request from Kees for linux-mm addition, so that should show up in archives before long. -K ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-26 17:39 ` incoming Konstantin Ryabitsev @ 2020-06-26 17:40 ` Konstantin Ryabitsev 0 siblings, 0 replies; 389+ messages in thread From: Konstantin Ryabitsev @ 2020-06-26 17:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Fri, 26 Jun 2020 at 13:39, Konstantin Ryabitsev <konstantin@linuxfoundation.org> wrote: > > Konstantin, maybe mm-commits could be on lore too and then they'd have > > been caught that way? > > Yes, I already have a request from Kees for linux-mm addition, so that > should show up in archives before long. correction: mm-commits, that is -K ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-12 0:30 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-06-12 0:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A few fixes and stragglers. 5 patches, based on 623f6dc593eaf98b91916836785278eddddaacf8. Subsystems affected by this patch series: mm/memory-failure ocfs2 lib/lzo misc Subsystem: mm/memory-failure Naoya Horiguchi <nao.horiguchi@gmail.com>: Patch series "hwpoison: fixes signaling on memory error": mm/memory-failure: prioritize prctl(PR_MCE_KILL) over vm.memory_failure_early_kill mm/memory-failure: send SIGBUS(BUS_MCEERR_AR) only to current thread Subsystem: ocfs2 Tom Seewald <tseewald@gmail.com>: ocfs2: fix build failure when TCP/IP is disabled Subsystem: lib/lzo Dave Rodgman <dave.rodgman@arm.com>: lib/lzo: fix ambiguous encoding bug in lzo-rle Subsystem: misc Christoph Hellwig <hch@lst.de>: amdgpu: a NULL ->mm does not mean a thread is a kthread Documentation/lzo.txt | 8 ++++- drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 - fs/ocfs2/Kconfig | 2 - lib/lzo/lzo1x_compress.c | 13 ++++++++ mm/memory-failure.c | 43 +++++++++++++++++------------ 5 files changed, 47 insertions(+), 21 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-11 1:40 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-06-11 1:40 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - various hotfixes and minor things - hch's use_mm/unuse_mm clearnups - new syscall process_madvise(): perform madvise() on a process other than self 25 patches, based on 6f630784cc0d92fb58ea326e2bc01aa056279ecb. Subsystems affected by this patch series: mm/hugetlb scripts kcov lib nilfs checkpatch lib mm/debug ocfs2 lib misc mm/madvise Subsystem: mm/hugetlb Dan Carpenter <dan.carpenter@oracle.com>: khugepaged: selftests: fix timeout condition in wait_for_scan() Subsystem: scripts SeongJae Park <sjpark@amazon.de>: scripts/spelling: add a few more typos Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: kcov: check kcov_softirq in kcov_remote_stop() Subsystem: lib Joe Perches <joe@perches.com>: lib/lz4/lz4_decompress.c: document deliberate use of `&' Subsystem: nilfs Ryusuke Konishi <konishi.ryusuke@gmail.com>: nilfs2: fix null pointer dereference at nilfs_segctor_do_construct() Subsystem: checkpatch Tim Froidcoeur <tim.froidcoeur@tessares.net>: checkpatch: correct check for kernel parameters doc Subsystem: lib Alexander Gordeev <agordeev@linux.ibm.com>: lib: fix bitmap_parse() on 64-bit big endian archs Subsystem: mm/debug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/debug_vm_pgtable: fix kernel crash by checking for THP support Subsystem: ocfs2 Keyur Patel <iamkeyur96@gmail.com>: ocfs2: fix spelling mistake and grammar Ben Widawsky <ben.widawsky@intel.com>: mm: add comments on pglist_data zones Subsystem: lib Wei Yang <richard.weiyang@gmail.com>: lib: test get_count_order/long in test_bitops.c Subsystem: misc Walter Wu <walter-zh.wu@mediatek.com>: stacktrace: cleanup inconsistent variable type Christoph Hellwig <hch@lst.de>: Patch series "improve use_mm / unuse_mm", v2: kernel: move use_mm/unuse_mm to kthread.c kernel: move use_mm/unuse_mm to kthread.c kernel: better document the use_mm/unuse_mm API contract kernel: set USER_DS in kthread_use_mm Subsystem: mm/madvise Minchan Kim <minchan@kernel.org>: Patch series "introduce memory hinting API for external process", v7: mm/madvise: pass task and mm to do_madvise mm/madvise: introduce process_madvise() syscall: an external memory hinting API mm/madvise: check fatal signal pending of target process pid: move pidfd_get_pid() to pid.c mm/madvise: support both pid and pidfd for process_madvise Oleksandr Natalenko <oleksandr@redhat.com>: mm/madvise: allow KSM hints for remote API Minchan Kim <minchan@kernel.org>: mm: support vector address ranges for process_madvise mm: use only pidfd for process_madvise syscall YueHaibing <yuehaibing@huawei.com>: mm/madvise.c: remove duplicated include arch/alpha/kernel/syscalls/syscall.tbl | 1 arch/arm/tools/syscall.tbl | 1 arch/arm64/include/asm/unistd.h | 2 arch/arm64/include/asm/unistd32.h | 4 arch/ia64/kernel/syscalls/syscall.tbl | 1 arch/m68k/kernel/syscalls/syscall.tbl | 1 arch/microblaze/kernel/syscalls/syscall.tbl | 1 arch/mips/kernel/syscalls/syscall_n32.tbl | 3 arch/mips/kernel/syscalls/syscall_n64.tbl | 1 arch/mips/kernel/syscalls/syscall_o32.tbl | 3 arch/parisc/kernel/syscalls/syscall.tbl | 3 arch/powerpc/kernel/syscalls/syscall.tbl | 3 arch/powerpc/platforms/powernv/vas-fault.c | 4 arch/s390/kernel/syscalls/syscall.tbl | 3 arch/sh/kernel/syscalls/syscall.tbl | 1 arch/sparc/kernel/syscalls/syscall.tbl | 3 arch/x86/entry/syscalls/syscall_32.tbl | 3 arch/x86/entry/syscalls/syscall_64.tbl | 5 arch/xtensa/kernel/syscalls/syscall.tbl | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 5 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_arcturus.c | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v10.c | 1 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v9.c | 2 drivers/gpu/drm/i915/gvt/kvmgt.c | 2 drivers/usb/gadget/function/f_fs.c | 10 drivers/usb/gadget/legacy/inode.c | 6 drivers/vfio/vfio_iommu_type1.c | 6 drivers/vhost/vhost.c | 8 fs/aio.c | 1 fs/io-wq.c | 15 - fs/io_uring.c | 11 fs/nilfs2/segment.c | 2 fs/ocfs2/mmap.c | 2 include/linux/compat.h | 10 include/linux/kthread.h | 9 include/linux/mm.h | 3 include/linux/mmu_context.h | 5 include/linux/mmzone.h | 14 include/linux/pid.h | 1 include/linux/stacktrace.h | 2 include/linux/syscalls.h | 16 - include/uapi/asm-generic/unistd.h | 7 kernel/exit.c | 17 - kernel/kcov.c | 26 + kernel/kthread.c | 95 +++++- kernel/pid.c | 17 + kernel/sys_ni.c | 2 lib/Kconfig.debug | 10 lib/bitmap.c | 9 lib/lz4/lz4_decompress.c | 3 lib/test_bitops.c | 53 +++ mm/Makefile | 2 mm/debug_vm_pgtable.c | 6 mm/madvise.c | 295 ++++++++++++++------ mm/mmu_context.c | 64 ---- mm/oom_kill.c | 6 mm/vmacache.c | 4 scripts/checkpatch.pl | 4 scripts/spelling.txt | 9 tools/testing/selftests/vm/khugepaged.c | 2 62 files changed, 526 insertions(+), 285 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-09 4:29 Andrew Morton 2020-06-09 16:58 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-06-09 4:29 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a kernel-wide sweep of show_stack() - pagetable cleanups - abstract out accesses to mmap_sem - prep for mmap_sem scalability work - hch's user acess work 93 patches, based on abfbb29297c27e3f101f348dc9e467b0fe70f919: Subsystems affected by this patch series: debug mm/pagemap mm/maccess mm/documentation Subsystem: debug Dmitry Safonov <dima@arista.com>: Patch series "Add log level to show_stack()", v3: kallsyms/printk: add loglvl to print_ip_sym() alpha: add show_stack_loglvl() arc: add show_stack_loglvl() arm/asm: add loglvl to c_backtrace() arm: add loglvl to unwind_backtrace() arm: add loglvl to dump_backtrace() arm: wire up dump_backtrace_{entry,stm} arm: add show_stack_loglvl() arm64: add loglvl to dump_backtrace() arm64: add show_stack_loglvl() c6x: add show_stack_loglvl() csky: add show_stack_loglvl() h8300: add show_stack_loglvl() hexagon: add show_stack_loglvl() ia64: pass log level as arg into ia64_do_show_stack() ia64: add show_stack_loglvl() m68k: add show_stack_loglvl() microblaze: add loglvl to microblaze_unwind_inner() microblaze: add loglvl to microblaze_unwind() microblaze: add show_stack_loglvl() mips: add show_stack_loglvl() nds32: add show_stack_loglvl() nios2: add show_stack_loglvl() openrisc: add show_stack_loglvl() parisc: add show_stack_loglvl() powerpc: add show_stack_loglvl() riscv: add show_stack_loglvl() s390: add show_stack_loglvl() sh: add loglvl to dump_mem() sh: remove needless printk() sh: add loglvl to printk_address() sh: add loglvl to show_trace() sh: add show_stack_loglvl() sparc: add show_stack_loglvl() um/sysrq: remove needless variable sp um: add show_stack_loglvl() unicore32: remove unused pmode argument in c_backtrace() unicore32: add loglvl to c_backtrace() unicore32: add show_stack_loglvl() x86: add missing const qualifiers for log_lvl x86: add show_stack_loglvl() xtensa: add loglvl to show_trace() xtensa: add show_stack_loglvl() sysrq: use show_stack_loglvl() x86/amd_gart: print stacktrace for a leak with KERN_ERR power: use show_stack_loglvl() kdb: don't play with console_loglevel sched: print stack trace with KERN_INFO kernel: use show_stack_loglvl() kernel: rename show_stack_loglvl() => show_stack() Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: consolidate definitions of page table accessors", v2: mm: don't include asm/pgtable.h if linux/mm.h is already included mm: introduce include/linux/pgtable.h mm: reorder includes after introduction of linux/pgtable.h csky: replace definitions of __pXd_offset() with pXd_index() m68k/mm/motorola: move comment about page table allocation funcitons m68k/mm: move {cache,nocahe}_page() definitions close to their user x86/mm: simplify init_trampoline() and surrounding logic mm: pgtable: add shortcuts for accessing kernel PMD and PTE mm: consolidate pte_index() and pte_offset_*() definitions Michel Lespinasse <walken@google.com>: mmap locking API: initial implementation as rwsem wrappers MMU notifier: use the new mmap locking API DMA reservations: use the new mmap locking API mmap locking API: use coccinelle to convert mmap_sem rwsem call sites mmap locking API: convert mmap_sem call sites missed by coccinelle mmap locking API: convert nested write lock sites mmap locking API: add mmap_read_trylock_non_owner() mmap locking API: add MMAP_LOCK_INITIALIZER mmap locking API: add mmap_assert_locked() and mmap_assert_write_locked() mmap locking API: rename mmap_sem to mmap_lock mmap locking API: convert mmap_sem API comments mmap locking API: convert mmap_sem comments Subsystem: mm/maccess Christoph Hellwig <hch@lst.de>: Patch series "clean up and streamline probe_kernel_* and friends", v4: maccess: unexport probe_kernel_write() maccess: remove various unused weak aliases maccess: remove duplicate kerneldoc comments maccess: clarify kerneldoc comments maccess: update the top of file comment maccess: rename strncpy_from_unsafe_user to strncpy_from_user_nofault maccess: rename strncpy_from_unsafe_strict to strncpy_from_kernel_nofault maccess: rename strnlen_unsafe_user to strnlen_user_nofault maccess: remove probe_read_common and probe_write_common maccess: unify the probe kernel arch hooks bpf: factor out a bpf_trace_copy_string helper bpf: handle the compat string in bpf_trace_copy_string better Andrew Morton <akpm@linux-foundation.org>: bpf:bpf_seq_printf(): handle potentially unsafe format string better Christoph Hellwig <hch@lst.de>: bpf: rework the compat kernel probe handling tracing/kprobes: handle mixed kernel/userspace probes better maccess: remove strncpy_from_unsafe maccess: always use strict semantics for probe_kernel_read maccess: move user access routines together maccess: allow architectures to provide kernel probing directly x86: use non-set_fs based maccess routines maccess: return -ERANGE when probe_kernel_read() fails Subsystem: mm/documentation Luis Chamberlain <mcgrof@kernel.org>: include/linux/cache.h: expand documentation over __read_mostly Documentation/admin-guide/mm/numa_memory_policy.rst | 10 Documentation/admin-guide/mm/userfaultfd.rst | 2 Documentation/filesystems/locking.rst | 2 Documentation/vm/hmm.rst | 6 Documentation/vm/transhuge.rst | 4 arch/alpha/boot/bootp.c | 1 arch/alpha/boot/bootpz.c | 1 arch/alpha/boot/main.c | 1 arch/alpha/include/asm/io.h | 1 arch/alpha/include/asm/pgtable.h | 16 arch/alpha/kernel/process.c | 1 arch/alpha/kernel/proto.h | 4 arch/alpha/kernel/ptrace.c | 1 arch/alpha/kernel/setup.c | 1 arch/alpha/kernel/smp.c | 1 arch/alpha/kernel/sys_alcor.c | 1 arch/alpha/kernel/sys_cabriolet.c | 1 arch/alpha/kernel/sys_dp264.c | 1 arch/alpha/kernel/sys_eb64p.c | 1 arch/alpha/kernel/sys_eiger.c | 1 arch/alpha/kernel/sys_jensen.c | 1 arch/alpha/kernel/sys_marvel.c | 1 arch/alpha/kernel/sys_miata.c | 1 arch/alpha/kernel/sys_mikasa.c | 1 arch/alpha/kernel/sys_nautilus.c | 1 arch/alpha/kernel/sys_noritake.c | 1 arch/alpha/kernel/sys_rawhide.c | 1 arch/alpha/kernel/sys_ruffian.c | 1 arch/alpha/kernel/sys_rx164.c | 1 arch/alpha/kernel/sys_sable.c | 1 arch/alpha/kernel/sys_sio.c | 1 arch/alpha/kernel/sys_sx164.c | 1 arch/alpha/kernel/sys_takara.c | 1 arch/alpha/kernel/sys_titan.c | 1 arch/alpha/kernel/sys_wildfire.c | 1 arch/alpha/kernel/traps.c | 40 arch/alpha/mm/fault.c | 12 arch/alpha/mm/init.c | 1 arch/arc/include/asm/bug.h | 3 arch/arc/include/asm/pgtable.h | 24 arch/arc/kernel/process.c | 4 arch/arc/kernel/stacktrace.c | 29 arch/arc/kernel/troubleshoot.c | 6 arch/arc/mm/fault.c | 6 arch/arc/mm/highmem.c | 14 arch/arc/mm/tlbex.S | 4 arch/arm/include/asm/bug.h | 3 arch/arm/include/asm/efi.h | 3 arch/arm/include/asm/fixmap.h | 4 arch/arm/include/asm/idmap.h | 2 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 7 arch/arm/include/asm/pgtable-nommu.h | 3 arch/arm/include/asm/pgtable.h | 25 arch/arm/include/asm/traps.h | 3 arch/arm/include/asm/unwind.h | 3 arch/arm/kernel/head.S | 4 arch/arm/kernel/machine_kexec.c | 1 arch/arm/kernel/module.c | 1 arch/arm/kernel/process.c | 4 arch/arm/kernel/ptrace.c | 1 arch/arm/kernel/smp.c | 1 arch/arm/kernel/suspend.c | 4 arch/arm/kernel/swp_emulate.c | 4 arch/arm/kernel/traps.c | 61 arch/arm/kernel/unwind.c | 7 arch/arm/kernel/vdso.c | 2 arch/arm/kernel/vmlinux.lds.S | 4 arch/arm/lib/backtrace-clang.S | 9 arch/arm/lib/backtrace.S | 14 arch/arm/lib/uaccess_with_memcpy.c | 16 arch/arm/mach-ebsa110/core.c | 1 arch/arm/mach-footbridge/common.c | 1 arch/arm/mach-imx/mm-imx21.c | 1 arch/arm/mach-imx/mm-imx27.c | 1 arch/arm/mach-imx/mm-imx3.c | 1 arch/arm/mach-integrator/core.c | 4 arch/arm/mach-iop32x/i2c.c | 1 arch/arm/mach-iop32x/iq31244.c | 1 arch/arm/mach-iop32x/iq80321.c | 1 arch/arm/mach-iop32x/n2100.c | 1 arch/arm/mach-ixp4xx/common.c | 1 arch/arm/mach-keystone/platsmp.c | 4 arch/arm/mach-sa1100/assabet.c | 3 arch/arm/mach-sa1100/hackkit.c | 4 arch/arm/mach-tegra/iomap.h | 2 arch/arm/mach-zynq/common.c | 4 arch/arm/mm/copypage-v4mc.c | 1 arch/arm/mm/copypage-v6.c | 1 arch/arm/mm/copypage-xscale.c | 1 arch/arm/mm/dump.c | 1 arch/arm/mm/fault-armv.c | 1 arch/arm/mm/fault.c | 9 arch/arm/mm/highmem.c | 4 arch/arm/mm/idmap.c | 4 arch/arm/mm/ioremap.c | 31 arch/arm/mm/mm.h | 8 arch/arm/mm/mmu.c | 7 arch/arm/mm/pageattr.c | 1 arch/arm/mm/proc-arm1020.S | 4 arch/arm/mm/proc-arm1020e.S | 4 arch/arm/mm/proc-arm1022.S | 4 arch/arm/mm/proc-arm1026.S | 4 arch/arm/mm/proc-arm720.S | 4 arch/arm/mm/proc-arm740.S | 4 arch/arm/mm/proc-arm7tdmi.S | 4 arch/arm/mm/proc-arm920.S | 4 arch/arm/mm/proc-arm922.S | 4 arch/arm/mm/proc-arm925.S | 4 arch/arm/mm/proc-arm926.S | 4 arch/arm/mm/proc-arm940.S | 4 arch/arm/mm/proc-arm946.S | 4 arch/arm/mm/proc-arm9tdmi.S | 4 arch/arm/mm/proc-fa526.S | 4 arch/arm/mm/proc-feroceon.S | 4 arch/arm/mm/proc-mohawk.S | 4 arch/arm/mm/proc-sa110.S | 4 arch/arm/mm/proc-sa1100.S | 4 arch/arm/mm/proc-v6.S | 4 arch/arm/mm/proc-v7.S | 4 arch/arm/mm/proc-xsc3.S | 4 arch/arm/mm/proc-xscale.S | 4 arch/arm/mm/pv-fixup-asm.S | 4 arch/arm64/include/asm/io.h | 4 arch/arm64/include/asm/kernel-pgtable.h | 2 arch/arm64/include/asm/kvm_mmu.h | 4 arch/arm64/include/asm/mmu_context.h | 4 arch/arm64/include/asm/pgtable.h | 40 arch/arm64/include/asm/stacktrace.h | 3 arch/arm64/include/asm/stage2_pgtable.h | 2 arch/arm64/include/asm/vmap_stack.h | 4 arch/arm64/kernel/acpi.c | 4 arch/arm64/kernel/head.S | 4 arch/arm64/kernel/hibernate.c | 5 arch/arm64/kernel/kaslr.c | 4 arch/arm64/kernel/process.c | 2 arch/arm64/kernel/ptrace.c | 1 arch/arm64/kernel/smp.c | 1 arch/arm64/kernel/suspend.c | 4 arch/arm64/kernel/traps.c | 37 arch/arm64/kernel/vdso.c | 8 arch/arm64/kernel/vmlinux.lds.S | 3 arch/arm64/kvm/mmu.c | 14 arch/arm64/mm/dump.c | 1 arch/arm64/mm/fault.c | 9 arch/arm64/mm/kasan_init.c | 3 arch/arm64/mm/mmu.c | 8 arch/arm64/mm/pageattr.c | 1 arch/arm64/mm/proc.S | 4 arch/c6x/include/asm/pgtable.h | 3 arch/c6x/kernel/traps.c | 28 arch/csky/include/asm/io.h | 2 arch/csky/include/asm/pgtable.h | 37 arch/csky/kernel/module.c | 1 arch/csky/kernel/ptrace.c | 5 arch/csky/kernel/stacktrace.c | 20 arch/csky/kernel/vdso.c | 4 arch/csky/mm/fault.c | 10 arch/csky/mm/highmem.c | 2 arch/csky/mm/init.c | 7 arch/csky/mm/tlb.c | 1 arch/h8300/include/asm/pgtable.h | 1 arch/h8300/kernel/process.c | 1 arch/h8300/kernel/setup.c | 1 arch/h8300/kernel/signal.c | 1 arch/h8300/kernel/traps.c | 26 arch/h8300/mm/fault.c | 1 arch/h8300/mm/init.c | 1 arch/h8300/mm/memory.c | 1 arch/hexagon/include/asm/fixmap.h | 4 arch/hexagon/include/asm/pgtable.h | 55 arch/hexagon/kernel/traps.c | 39 arch/hexagon/kernel/vdso.c | 4 arch/hexagon/mm/uaccess.c | 2 arch/hexagon/mm/vm_fault.c | 9 arch/ia64/include/asm/pgtable.h | 34 arch/ia64/include/asm/ptrace.h | 1 arch/ia64/include/asm/uaccess.h | 2 arch/ia64/kernel/efi.c | 1 arch/ia64/kernel/entry.S | 4 arch/ia64/kernel/head.S | 5 arch/ia64/kernel/irq_ia64.c | 4 arch/ia64/kernel/ivt.S | 4 arch/ia64/kernel/kprobes.c | 4 arch/ia64/kernel/mca.c | 2 arch/ia64/kernel/mca_asm.S | 4 arch/ia64/kernel/perfmon.c | 8 arch/ia64/kernel/process.c | 37 arch/ia64/kernel/ptrace.c | 1 arch/ia64/kernel/relocate_kernel.S | 6 arch/ia64/kernel/setup.c | 4 arch/ia64/kernel/smp.c | 1 arch/ia64/kernel/smpboot.c | 1 arch/ia64/kernel/uncached.c | 4 arch/ia64/kernel/vmlinux.lds.S | 4 arch/ia64/mm/contig.c | 1 arch/ia64/mm/fault.c | 17 arch/ia64/mm/init.c | 12 arch/m68k/68000/m68EZ328.c | 2 arch/m68k/68000/m68VZ328.c | 4 arch/m68k/68000/timers.c | 1 arch/m68k/amiga/config.c | 1 arch/m68k/apollo/config.c | 1 arch/m68k/atari/atasound.c | 1 arch/m68k/atari/stram.c | 1 arch/m68k/bvme6000/config.c | 1 arch/m68k/include/asm/mcf_pgtable.h | 63 arch/m68k/include/asm/motorola_pgalloc.h | 8 arch/m68k/include/asm/motorola_pgtable.h | 84 - arch/m68k/include/asm/pgtable_mm.h | 1 arch/m68k/include/asm/pgtable_no.h | 2 arch/m68k/include/asm/sun3_pgtable.h | 24 arch/m68k/include/asm/sun3xflop.h | 4 arch/m68k/kernel/head.S | 4 arch/m68k/kernel/process.c | 1 arch/m68k/kernel/ptrace.c | 1 arch/m68k/kernel/setup_no.c | 1 arch/m68k/kernel/signal.c | 1 arch/m68k/kernel/sys_m68k.c | 14 arch/m68k/kernel/traps.c | 27 arch/m68k/kernel/uboot.c | 1 arch/m68k/mac/config.c | 1 arch/m68k/mm/fault.c | 10 arch/m68k/mm/init.c | 2 arch/m68k/mm/mcfmmu.c | 1 arch/m68k/mm/motorola.c | 65 arch/m68k/mm/sun3kmap.c | 1 arch/m68k/mm/sun3mmu.c | 1 arch/m68k/mvme147/config.c | 1 arch/m68k/mvme16x/config.c | 1 arch/m68k/q40/config.c | 1 arch/m68k/sun3/config.c | 1 arch/m68k/sun3/dvma.c | 1 arch/m68k/sun3/mmu_emu.c | 1 arch/m68k/sun3/sun3dvma.c | 1 arch/m68k/sun3x/dvma.c | 1 arch/m68k/sun3x/prom.c | 1 arch/microblaze/include/asm/pgalloc.h | 4 arch/microblaze/include/asm/pgtable.h | 23 arch/microblaze/include/asm/uaccess.h | 2 arch/microblaze/include/asm/unwind.h | 3 arch/microblaze/kernel/hw_exception_handler.S | 4 arch/microblaze/kernel/module.c | 4 arch/microblaze/kernel/setup.c | 4 arch/microblaze/kernel/signal.c | 9 arch/microblaze/kernel/stacktrace.c | 4 arch/microblaze/kernel/traps.c | 28 arch/microblaze/kernel/unwind.c | 46 arch/microblaze/mm/fault.c | 17 arch/microblaze/mm/init.c | 9 arch/microblaze/mm/pgtable.c | 4 arch/mips/fw/arc/memory.c | 1 arch/mips/include/asm/fixmap.h | 3 arch/mips/include/asm/mach-generic/floppy.h | 1 arch/mips/include/asm/mach-jazz/floppy.h | 1 arch/mips/include/asm/pgtable-32.h | 22 arch/mips/include/asm/pgtable-64.h | 32 arch/mips/include/asm/pgtable.h | 2 arch/mips/jazz/irq.c | 4 arch/mips/jazz/jazzdma.c | 1 arch/mips/jazz/setup.c | 4 arch/mips/kernel/module.c | 1 arch/mips/kernel/process.c | 1 arch/mips/kernel/ptrace.c | 1 arch/mips/kernel/ptrace32.c | 1 arch/mips/kernel/smp-bmips.c | 1 arch/mips/kernel/traps.c | 58 arch/mips/kernel/vdso.c | 4 arch/mips/kvm/mips.c | 4 arch/mips/kvm/mmu.c | 20 arch/mips/kvm/tlb.c | 1 arch/mips/kvm/trap_emul.c | 2 arch/mips/lib/dump_tlb.c | 1 arch/mips/lib/r3k_dump_tlb.c | 1 arch/mips/mm/c-octeon.c | 1 arch/mips/mm/c-r3k.c | 11 arch/mips/mm/c-r4k.c | 11 arch/mips/mm/c-tx39.c | 11 arch/mips/mm/fault.c | 12 arch/mips/mm/highmem.c | 2 arch/mips/mm/init.c | 1 arch/mips/mm/page.c | 1 arch/mips/mm/pgtable-32.c | 1 arch/mips/mm/pgtable-64.c | 1 arch/mips/mm/sc-ip22.c | 1 arch/mips/mm/sc-mips.c | 1 arch/mips/mm/sc-r5k.c | 1 arch/mips/mm/tlb-r3k.c | 1 arch/mips/mm/tlb-r4k.c | 1 arch/mips/mm/tlbex.c | 4 arch/mips/sgi-ip27/ip27-init.c | 1 arch/mips/sgi-ip27/ip27-timer.c | 1 arch/mips/sgi-ip32/ip32-memory.c | 1 arch/nds32/include/asm/highmem.h | 3 arch/nds32/include/asm/pgtable.h | 22 arch/nds32/kernel/head.S | 4 arch/nds32/kernel/module.c | 2 arch/nds32/kernel/traps.c | 33 arch/nds32/kernel/vdso.c | 6 arch/nds32/mm/fault.c | 17 arch/nds32/mm/init.c | 13 arch/nds32/mm/proc.c | 7 arch/nios2/include/asm/pgtable.h | 24 arch/nios2/kernel/module.c | 1 arch/nios2/kernel/nios2_ksyms.c | 4 arch/nios2/kernel/traps.c | 35 arch/nios2/mm/fault.c | 14 arch/nios2/mm/init.c | 5 arch/nios2/mm/pgtable.c | 1 arch/nios2/mm/tlb.c | 1 arch/openrisc/include/asm/io.h | 3 arch/openrisc/include/asm/pgtable.h | 33 arch/openrisc/include/asm/tlbflush.h | 1 arch/openrisc/kernel/asm-offsets.c | 1 arch/openrisc/kernel/entry.S | 4 arch/openrisc/kernel/head.S | 4 arch/openrisc/kernel/or32_ksyms.c | 4 arch/openrisc/kernel/process.c | 1 arch/openrisc/kernel/ptrace.c | 1 arch/openrisc/kernel/setup.c | 1 arch/openrisc/kernel/traps.c | 27 arch/openrisc/mm/fault.c | 12 arch/openrisc/mm/init.c | 1 arch/openrisc/mm/ioremap.c | 4 arch/openrisc/mm/tlb.c | 1 arch/parisc/include/asm/io.h | 2 arch/parisc/include/asm/mmu_context.h | 1 arch/parisc/include/asm/pgtable.h | 33 arch/parisc/kernel/asm-offsets.c | 4 arch/parisc/kernel/entry.S | 4 arch/parisc/kernel/head.S | 4 arch/parisc/kernel/module.c | 1 arch/parisc/kernel/pacache.S | 4 arch/parisc/kernel/pci-dma.c | 2 arch/parisc/kernel/pdt.c | 4 arch/parisc/kernel/ptrace.c | 1 arch/parisc/kernel/smp.c | 1 arch/parisc/kernel/traps.c | 42 arch/parisc/lib/memcpy.c | 14 arch/parisc/mm/fault.c | 10 arch/parisc/mm/fixmap.c | 6 arch/parisc/mm/init.c | 1 arch/powerpc/include/asm/book3s/32/pgtable.h | 20 arch/powerpc/include/asm/book3s/64/pgtable.h | 43 arch/powerpc/include/asm/fixmap.h | 4 arch/powerpc/include/asm/io.h | 1 arch/powerpc/include/asm/kup.h | 2 arch/powerpc/include/asm/nohash/32/pgtable.h | 17 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 4 arch/powerpc/include/asm/nohash/64/pgtable.h | 22 arch/powerpc/include/asm/nohash/pgtable.h | 2 arch/powerpc/include/asm/pgtable.h | 28 arch/powerpc/include/asm/pkeys.h | 2 arch/powerpc/include/asm/tlb.h | 2 arch/powerpc/kernel/asm-offsets.c | 1 arch/powerpc/kernel/btext.c | 4 arch/powerpc/kernel/fpu.S | 3 arch/powerpc/kernel/head_32.S | 4 arch/powerpc/kernel/head_40x.S | 4 arch/powerpc/kernel/head_44x.S | 4 arch/powerpc/kernel/head_8xx.S | 4 arch/powerpc/kernel/head_fsl_booke.S | 4 arch/powerpc/kernel/io-workarounds.c | 4 arch/powerpc/kernel/irq.c | 4 arch/powerpc/kernel/mce_power.c | 4 arch/powerpc/kernel/paca.c | 4 arch/powerpc/kernel/process.c | 30 arch/powerpc/kernel/prom.c | 4 arch/powerpc/kernel/prom_init.c | 4 arch/powerpc/kernel/rtas_pci.c | 4 arch/powerpc/kernel/setup-common.c | 4 arch/powerpc/kernel/setup_32.c | 4 arch/powerpc/kernel/setup_64.c | 4 arch/powerpc/kernel/signal_32.c | 1 arch/powerpc/kernel/signal_64.c | 1 arch/powerpc/kernel/smp.c | 4 arch/powerpc/kernel/stacktrace.c | 2 arch/powerpc/kernel/traps.c | 1 arch/powerpc/kernel/vdso.c | 7 arch/powerpc/kvm/book3s_64_mmu_radix.c | 4 arch/powerpc/kvm/book3s_hv.c | 6 arch/powerpc/kvm/book3s_hv_nested.c | 4 arch/powerpc/kvm/book3s_hv_rm_xics.c | 4 arch/powerpc/kvm/book3s_hv_rm_xive.c | 4 arch/powerpc/kvm/book3s_hv_uvmem.c | 18 arch/powerpc/kvm/e500_mmu_host.c | 4 arch/powerpc/kvm/fpu.S | 4 arch/powerpc/lib/code-patching.c | 1 arch/powerpc/mm/book3s32/hash_low.S | 4 arch/powerpc/mm/book3s32/mmu.c | 2 arch/powerpc/mm/book3s32/tlb.c | 6 arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/hash_native.c | 4 arch/powerpc/mm/book3s64/hash_pgtable.c | 5 arch/powerpc/mm/book3s64/hash_utils.c | 4 arch/powerpc/mm/book3s64/iommu_api.c | 4 arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1 arch/powerpc/mm/book3s64/radix_pgtable.c | 1 arch/powerpc/mm/book3s64/slb.c | 4 arch/powerpc/mm/book3s64/subpage_prot.c | 16 arch/powerpc/mm/copro_fault.c | 4 arch/powerpc/mm/fault.c | 23 arch/powerpc/mm/hugetlbpage.c | 1 arch/powerpc/mm/init-common.c | 4 arch/powerpc/mm/init_32.c | 1 arch/powerpc/mm/init_64.c | 1 arch/powerpc/mm/kasan/8xx.c | 4 arch/powerpc/mm/kasan/book3s_32.c | 2 arch/powerpc/mm/kasan/kasan_init_32.c | 8 arch/powerpc/mm/mem.c | 1 arch/powerpc/mm/nohash/40x.c | 5 arch/powerpc/mm/nohash/8xx.c | 2 arch/powerpc/mm/nohash/fsl_booke.c | 1 arch/powerpc/mm/nohash/tlb_low_64e.S | 4 arch/powerpc/mm/pgtable.c | 2 arch/powerpc/mm/pgtable_32.c | 5 arch/powerpc/mm/pgtable_64.c | 1 arch/powerpc/mm/ptdump/8xx.c | 2 arch/powerpc/mm/ptdump/bats.c | 4 arch/powerpc/mm/ptdump/book3s64.c | 2 arch/powerpc/mm/ptdump/hashpagetable.c | 1 arch/powerpc/mm/ptdump/ptdump.c | 1 arch/powerpc/mm/ptdump/shared.c | 2 arch/powerpc/oprofile/cell/spu_task_sync.c | 6 arch/powerpc/perf/callchain.c | 1 arch/powerpc/perf/callchain_32.c | 1 arch/powerpc/perf/callchain_64.c | 1 arch/powerpc/platforms/85xx/corenet_generic.c | 4 arch/powerpc/platforms/85xx/mpc85xx_cds.c | 4 arch/powerpc/platforms/85xx/qemu_e500.c | 4 arch/powerpc/platforms/85xx/sbc8548.c | 4 arch/powerpc/platforms/85xx/smp.c | 4 arch/powerpc/platforms/86xx/mpc86xx_smp.c | 4 arch/powerpc/platforms/8xx/cpm1.c | 1 arch/powerpc/platforms/8xx/micropatch.c | 1 arch/powerpc/platforms/cell/cbe_regs.c | 4 arch/powerpc/platforms/cell/interrupt.c | 4 arch/powerpc/platforms/cell/pervasive.c | 4 arch/powerpc/platforms/cell/setup.c | 1 arch/powerpc/platforms/cell/smp.c | 4 arch/powerpc/platforms/cell/spider-pic.c | 4 arch/powerpc/platforms/cell/spufs/file.c | 10 arch/powerpc/platforms/chrp/pci.c | 4 arch/powerpc/platforms/chrp/setup.c | 1 arch/powerpc/platforms/chrp/smp.c | 4 arch/powerpc/platforms/maple/setup.c | 1 arch/powerpc/platforms/maple/time.c | 1 arch/powerpc/platforms/powermac/setup.c | 1 arch/powerpc/platforms/powermac/smp.c | 4 arch/powerpc/platforms/powermac/time.c | 1 arch/powerpc/platforms/pseries/lpar.c | 4 arch/powerpc/platforms/pseries/setup.c | 1 arch/powerpc/platforms/pseries/smp.c | 4 arch/powerpc/sysdev/cpm2.c | 1 arch/powerpc/sysdev/fsl_85xx_cache_sram.c | 2 arch/powerpc/sysdev/mpic.c | 4 arch/powerpc/xmon/xmon.c | 1 arch/riscv/include/asm/fixmap.h | 4 arch/riscv/include/asm/io.h | 4 arch/riscv/include/asm/kasan.h | 4 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 22 arch/riscv/kernel/module.c | 2 arch/riscv/kernel/setup.c | 1 arch/riscv/kernel/soc.c | 2 arch/riscv/kernel/stacktrace.c | 23 arch/riscv/kernel/vdso.c | 4 arch/riscv/mm/cacheflush.c | 3 arch/riscv/mm/fault.c | 14 arch/riscv/mm/init.c | 31 arch/riscv/mm/kasan_init.c | 4 arch/riscv/mm/pageattr.c | 6 arch/riscv/mm/ptdump.c | 2 arch/s390/boot/ipl_parm.c | 4 arch/s390/boot/kaslr.c | 4 arch/s390/include/asm/hugetlb.h | 4 arch/s390/include/asm/kasan.h | 4 arch/s390/include/asm/pgtable.h | 15 arch/s390/include/asm/tlbflush.h | 1 arch/s390/kernel/asm-offsets.c | 4 arch/s390/kernel/dumpstack.c | 25 arch/s390/kernel/machine_kexec.c | 1 arch/s390/kernel/ptrace.c | 1 arch/s390/kernel/uv.c | 4 arch/s390/kernel/vdso.c | 5 arch/s390/kvm/gaccess.c | 8 arch/s390/kvm/interrupt.c | 4 arch/s390/kvm/kvm-s390.c | 32 arch/s390/kvm/priv.c | 38 arch/s390/mm/dump_pagetables.c | 1 arch/s390/mm/extmem.c | 4 arch/s390/mm/fault.c | 17 arch/s390/mm/gmap.c | 80 arch/s390/mm/init.c | 1 arch/s390/mm/kasan_init.c | 4 arch/s390/mm/pageattr.c | 13 arch/s390/mm/pgalloc.c | 2 arch/s390/mm/pgtable.c | 1 arch/s390/mm/vmem.c | 1 arch/s390/pci/pci_mmio.c | 4 arch/sh/include/asm/io.h | 2 arch/sh/include/asm/kdebug.h | 6 arch/sh/include/asm/pgtable-3level.h | 7 arch/sh/include/asm/pgtable.h | 2 arch/sh/include/asm/pgtable_32.h | 25 arch/sh/include/asm/processor_32.h | 2 arch/sh/kernel/dumpstack.c | 54 arch/sh/kernel/machine_kexec.c | 1 arch/sh/kernel/process_32.c | 2 arch/sh/kernel/ptrace_32.c | 1 arch/sh/kernel/signal_32.c | 1 arch/sh/kernel/sys_sh.c | 6 arch/sh/kernel/traps.c | 4 arch/sh/kernel/vsyscall/vsyscall.c | 4 arch/sh/mm/cache-sh3.c | 1 arch/sh/mm/cache-sh4.c | 11 arch/sh/mm/cache-sh7705.c | 1 arch/sh/mm/fault.c | 16 arch/sh/mm/kmap.c | 5 arch/sh/mm/nommu.c | 1 arch/sh/mm/pmb.c | 4 arch/sparc/include/asm/floppy_32.h | 4 arch/sparc/include/asm/highmem.h | 4 arch/sparc/include/asm/ide.h | 2 arch/sparc/include/asm/io-unit.h | 4 arch/sparc/include/asm/pgalloc_32.h | 4 arch/sparc/include/asm/pgalloc_64.h | 2 arch/sparc/include/asm/pgtable_32.h | 34 arch/sparc/include/asm/pgtable_64.h | 32 arch/sparc/kernel/cpu.c | 4 arch/sparc/kernel/entry.S | 4 arch/sparc/kernel/head_64.S | 4 arch/sparc/kernel/ktlb.S | 4 arch/sparc/kernel/leon_smp.c | 1 arch/sparc/kernel/pci.c | 4 arch/sparc/kernel/process_32.c | 29 arch/sparc/kernel/process_64.c | 3 arch/sparc/kernel/ptrace_32.c | 1 arch/sparc/kernel/ptrace_64.c | 1 arch/sparc/kernel/setup_32.c | 1 arch/sparc/kernel/setup_64.c | 1 arch/sparc/kernel/signal32.c | 1 arch/sparc/kernel/signal_32.c | 1 arch/sparc/kernel/signal_64.c | 1 arch/sparc/kernel/smp_32.c | 1 arch/sparc/kernel/smp_64.c | 1 arch/sparc/kernel/sun4m_irq.c | 4 arch/sparc/kernel/trampoline_64.S | 4 arch/sparc/kernel/traps_32.c | 4 arch/sparc/kernel/traps_64.c | 24 arch/sparc/lib/clear_page.S | 4 arch/sparc/lib/copy_page.S | 2 arch/sparc/mm/fault_32.c | 21 arch/sparc/mm/fault_64.c | 17 arch/sparc/mm/highmem.c | 12 arch/sparc/mm/hugetlbpage.c | 1 arch/sparc/mm/init_32.c | 1 arch/sparc/mm/init_64.c | 7 arch/sparc/mm/io-unit.c | 11 arch/sparc/mm/iommu.c | 9 arch/sparc/mm/tlb.c | 1 arch/sparc/mm/tsb.c | 4 arch/sparc/mm/ultra.S | 4 arch/sparc/vdso/vma.c | 4 arch/um/drivers/mconsole_kern.c | 2 arch/um/include/asm/mmu_context.h | 5 arch/um/include/asm/pgtable-3level.h | 4 arch/um/include/asm/pgtable.h | 69 arch/um/kernel/maccess.c | 12 arch/um/kernel/mem.c | 10 arch/um/kernel/process.c | 1 arch/um/kernel/skas/mmu.c | 3 arch/um/kernel/skas/uaccess.c | 1 arch/um/kernel/sysrq.c | 35 arch/um/kernel/tlb.c | 5 arch/um/kernel/trap.c | 15 arch/um/kernel/um_arch.c | 1 arch/unicore32/include/asm/pgtable.h | 19 arch/unicore32/kernel/hibernate.c | 4 arch/unicore32/kernel/hibernate_asm.S | 4 arch/unicore32/kernel/module.c | 1 arch/unicore32/kernel/setup.h | 4 arch/unicore32/kernel/traps.c | 50 arch/unicore32/lib/backtrace.S | 24 arch/unicore32/mm/alignment.c | 4 arch/unicore32/mm/fault.c | 9 arch/unicore32/mm/mm.h | 10 arch/unicore32/mm/proc-ucv2.S | 4 arch/x86/boot/compressed/kaslr_64.c | 4 arch/x86/entry/vdso/vma.c | 14 arch/x86/events/core.c | 4 arch/x86/include/asm/agp.h | 2 arch/x86/include/asm/asm-prototypes.h | 4 arch/x86/include/asm/efi.h | 4 arch/x86/include/asm/iomap.h | 1 arch/x86/include/asm/kaslr.h | 2 arch/x86/include/asm/mmu.h | 2 arch/x86/include/asm/pgtable-3level.h | 8 arch/x86/include/asm/pgtable.h | 89 - arch/x86/include/asm/pgtable_32.h | 11 arch/x86/include/asm/pgtable_64.h | 4 arch/x86/include/asm/setup.h | 12 arch/x86/include/asm/stacktrace.h | 2 arch/x86/include/asm/uaccess.h | 16 arch/x86/include/asm/xen/hypercall.h | 4 arch/x86/include/asm/xen/page.h | 1 arch/x86/kernel/acpi/boot.c | 4 arch/x86/kernel/acpi/sleep.c | 4 arch/x86/kernel/alternative.c | 1 arch/x86/kernel/amd_gart_64.c | 5 arch/x86/kernel/apic/apic_numachip.c | 4 arch/x86/kernel/cpu/bugs.c | 4 arch/x86/kernel/cpu/common.c | 4 arch/x86/kernel/cpu/intel.c | 4 arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 6 arch/x86/kernel/cpu/resctrl/rdtgroup.c | 6 arch/x86/kernel/crash_core_32.c | 4 arch/x86/kernel/crash_core_64.c | 4 arch/x86/kernel/doublefault_32.c | 1 arch/x86/kernel/dumpstack.c | 21 arch/x86/kernel/early_printk.c | 4 arch/x86/kernel/espfix_64.c | 2 arch/x86/kernel/head64.c | 4 arch/x86/kernel/head_64.S | 4 arch/x86/kernel/i8259.c | 4 arch/x86/kernel/irqinit.c | 4 arch/x86/kernel/kprobes/core.c | 4 arch/x86/kernel/kprobes/opt.c | 4 arch/x86/kernel/ldt.c | 2 arch/x86/kernel/machine_kexec_32.c | 1 arch/x86/kernel/machine_kexec_64.c | 1 arch/x86/kernel/module.c | 1 arch/x86/kernel/paravirt.c | 4 arch/x86/kernel/process_32.c | 1 arch/x86/kernel/process_64.c | 1 arch/x86/kernel/ptrace.c | 1 arch/x86/kernel/reboot.c | 4 arch/x86/kernel/smpboot.c | 4 arch/x86/kernel/tboot.c | 3 arch/x86/kernel/vm86_32.c | 4 arch/x86/kvm/mmu/paging_tmpl.h | 8 arch/x86/mm/cpu_entry_area.c | 4 arch/x86/mm/debug_pagetables.c | 2 arch/x86/mm/dump_pagetables.c | 1 arch/x86/mm/fault.c | 22 arch/x86/mm/init.c | 22 arch/x86/mm/init_32.c | 27 arch/x86/mm/init_64.c | 1 arch/x86/mm/ioremap.c | 4 arch/x86/mm/kasan_init_64.c | 1 arch/x86/mm/kaslr.c | 37 arch/x86/mm/maccess.c | 44 arch/x86/mm/mem_encrypt_boot.S | 2 arch/x86/mm/mmio-mod.c | 4 arch/x86/mm/pat/cpa-test.c | 1 arch/x86/mm/pat/memtype.c | 1 arch/x86/mm/pat/memtype_interval.c | 4 arch/x86/mm/pgtable.c | 1 arch/x86/mm/pgtable_32.c | 1 arch/x86/mm/pti.c | 1 arch/x86/mm/setup_nx.c | 4 arch/x86/platform/efi/efi_32.c | 4 arch/x86/platform/efi/efi_64.c | 1 arch/x86/platform/olpc/olpc_ofw.c | 4 arch/x86/power/cpu.c | 4 arch/x86/power/hibernate.c | 4 arch/x86/power/hibernate_32.c | 4 arch/x86/power/hibernate_64.c | 4 arch/x86/realmode/init.c | 4 arch/x86/um/vdso/vma.c | 4 arch/x86/xen/enlighten_pv.c | 1 arch/x86/xen/grant-table.c | 1 arch/x86/xen/mmu_pv.c | 4 arch/x86/xen/smp_pv.c | 2 arch/xtensa/include/asm/fixmap.h | 12 arch/xtensa/include/asm/highmem.h | 4 arch/xtensa/include/asm/initialize_mmu.h | 2 arch/xtensa/include/asm/mmu_context.h | 4 arch/xtensa/include/asm/pgtable.h | 20 arch/xtensa/kernel/entry.S | 4 arch/xtensa/kernel/process.c | 1 arch/xtensa/kernel/ptrace.c | 1 arch/xtensa/kernel/setup.c | 1 arch/xtensa/kernel/traps.c | 42 arch/xtensa/kernel/vectors.S | 4 arch/xtensa/mm/cache.c | 4 arch/xtensa/mm/fault.c | 12 arch/xtensa/mm/highmem.c | 2 arch/xtensa/mm/ioremap.c | 4 arch/xtensa/mm/kasan_init.c | 10 arch/xtensa/mm/misc.S | 4 arch/xtensa/mm/mmu.c | 5 drivers/acpi/scan.c | 3 drivers/android/binder_alloc.c | 14 drivers/atm/fore200e.c | 4 drivers/base/power/main.c | 4 drivers/block/z2ram.c | 4 drivers/char/agp/frontend.c | 1 drivers/char/agp/generic.c | 1 drivers/char/bsr.c | 1 drivers/char/mspec.c | 3 drivers/dma-buf/dma-resv.c | 5 drivers/firmware/efi/arm-runtime.c | 4 drivers/firmware/efi/efi.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 4 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 10 drivers/gpu/drm/amd/amdkfd/kfd_events.c | 4 drivers/gpu/drm/drm_vm.c | 4 drivers/gpu/drm/etnaviv/etnaviv_gem.c | 2 drivers/gpu/drm/i915/gem/i915_gem_mman.c | 4 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 14 drivers/gpu/drm/i915/i915_mm.c | 1 drivers/gpu/drm/i915/i915_perf.c | 2 drivers/gpu/drm/nouveau/nouveau_svm.c | 22 drivers/gpu/drm/radeon/radeon_cs.c | 4 drivers/gpu/drm/radeon/radeon_gem.c | 6 drivers/gpu/drm/ttm/ttm_bo_vm.c | 10 drivers/infiniband/core/umem_odp.c | 4 drivers/infiniband/core/uverbs_main.c | 6 drivers/infiniband/hw/hfi1/mmu_rb.c | 2 drivers/infiniband/hw/mlx4/mr.c | 4 drivers/infiniband/hw/qib/qib_file_ops.c | 4 drivers/infiniband/hw/qib/qib_user_pages.c | 6 drivers/infiniband/hw/usnic/usnic_uiom.c | 4 drivers/infiniband/sw/rdmavt/mmap.c | 1 drivers/infiniband/sw/rxe/rxe_mmap.c | 1 drivers/infiniband/sw/siw/siw_mem.c | 4 drivers/iommu/amd_iommu_v2.c | 4 drivers/iommu/intel-svm.c | 4 drivers/macintosh/macio-adb.c | 4 drivers/macintosh/mediabay.c | 4 drivers/macintosh/via-pmu.c | 4 drivers/media/pci/bt8xx/bt878.c | 4 drivers/media/pci/bt8xx/btcx-risc.c | 4 drivers/media/pci/bt8xx/bttv-risc.c | 4 drivers/media/platform/davinci/vpbe_display.c | 1 drivers/media/v4l2-core/v4l2-common.c | 1 drivers/media/v4l2-core/videobuf-core.c | 4 drivers/media/v4l2-core/videobuf-dma-contig.c | 4 drivers/media/v4l2-core/videobuf-dma-sg.c | 10 drivers/media/v4l2-core/videobuf-vmalloc.c | 4 drivers/misc/cxl/cxllib.c | 9 drivers/misc/cxl/fault.c | 4 drivers/misc/genwqe/card_utils.c | 2 drivers/misc/sgi-gru/grufault.c | 25 drivers/misc/sgi-gru/grufile.c | 4 drivers/mtd/ubi/ubi.h | 2 drivers/net/ethernet/amd/7990.c | 4 drivers/net/ethernet/amd/hplance.c | 4 drivers/net/ethernet/amd/mvme147.c | 4 drivers/net/ethernet/amd/sun3lance.c | 4 drivers/net/ethernet/amd/sunlance.c | 4 drivers/net/ethernet/apple/bmac.c | 4 drivers/net/ethernet/apple/mace.c | 4 drivers/net/ethernet/freescale/fs_enet/fs_enet-main.c | 4 drivers/net/ethernet/freescale/fs_enet/mac-fcc.c | 4 drivers/net/ethernet/freescale/fs_enet/mii-fec.c | 4 drivers/net/ethernet/i825xx/82596.c | 4 drivers/net/ethernet/korina.c | 4 drivers/net/ethernet/marvell/pxa168_eth.c | 4 drivers/net/ethernet/natsemi/jazzsonic.c | 4 drivers/net/ethernet/natsemi/macsonic.c | 4 drivers/net/ethernet/natsemi/xtsonic.c | 4 drivers/net/ethernet/sun/sunbmac.c | 4 drivers/net/ethernet/sun/sunhme.c | 1 drivers/net/ethernet/sun/sunqe.c | 4 drivers/oprofile/buffer_sync.c | 12 drivers/sbus/char/flash.c | 1 drivers/sbus/char/uctrl.c | 1 drivers/scsi/53c700.c | 4 drivers/scsi/a2091.c | 1 drivers/scsi/a3000.c | 1 drivers/scsi/arm/cumana_2.c | 4 drivers/scsi/arm/eesox.c | 4 drivers/scsi/arm/powertec.c | 4 drivers/scsi/dpt_i2o.c | 4 drivers/scsi/gvp11.c | 1 drivers/scsi/lasi700.c | 1 drivers/scsi/mac53c94.c | 4 drivers/scsi/mesh.c | 4 drivers/scsi/mvme147.c | 1 drivers/scsi/qlogicpti.c | 4 drivers/scsi/sni_53c710.c | 1 drivers/scsi/zorro_esp.c | 4 drivers/staging/android/ashmem.c | 4 drivers/staging/comedi/comedi_fops.c | 2 drivers/staging/kpc2000/kpc_dma/fileops.c | 4 drivers/staging/media/atomisp/pci/hmm/hmm_bo.c | 4 drivers/tee/optee/call.c | 4 drivers/tty/sysrq.c | 4 drivers/tty/vt/consolemap.c | 2 drivers/vfio/pci/vfio_pci.c | 22 drivers/vfio/vfio_iommu_type1.c | 8 drivers/vhost/vdpa.c | 4 drivers/video/console/newport_con.c | 1 drivers/video/fbdev/acornfb.c | 1 drivers/video/fbdev/atafb.c | 1 drivers/video/fbdev/cirrusfb.c | 1 drivers/video/fbdev/cyber2000fb.c | 1 drivers/video/fbdev/fb-puv3.c | 1 drivers/video/fbdev/hitfb.c | 1 drivers/video/fbdev/neofb.c | 1 drivers/video/fbdev/q40fb.c | 1 drivers/video/fbdev/savage/savagefb_driver.c | 1 drivers/xen/balloon.c | 1 drivers/xen/gntdev.c | 6 drivers/xen/grant-table.c | 1 drivers/xen/privcmd.c | 15 drivers/xen/xenbus/xenbus_probe.c | 1 drivers/xen/xenbus/xenbus_probe_backend.c | 1 drivers/xen/xenbus/xenbus_probe_frontend.c | 1 fs/aio.c | 4 fs/coredump.c | 8 fs/exec.c | 18 fs/ext2/file.c | 2 fs/ext4/super.c | 6 fs/hugetlbfs/inode.c | 2 fs/io_uring.c | 4 fs/kernfs/file.c | 4 fs/proc/array.c | 1 fs/proc/base.c | 24 fs/proc/meminfo.c | 1 fs/proc/nommu.c | 1 fs/proc/task_mmu.c | 34 fs/proc/task_nommu.c | 18 fs/proc/vmcore.c | 1 fs/userfaultfd.c | 46 fs/xfs/xfs_file.c | 2 fs/xfs/xfs_inode.c | 14 fs/xfs/xfs_iops.c | 4 include/asm-generic/io.h | 2 include/asm-generic/pgtable-nopmd.h | 1 include/asm-generic/pgtable-nopud.h | 1 include/asm-generic/pgtable.h | 1322 ---------------- include/linux/cache.h | 10 include/linux/crash_dump.h | 3 include/linux/dax.h | 1 include/linux/dma-noncoherent.h | 2 include/linux/fs.h | 4 include/linux/hmm.h | 2 include/linux/huge_mm.h | 2 include/linux/hugetlb.h | 2 include/linux/io-mapping.h | 4 include/linux/kallsyms.h | 4 include/linux/kasan.h | 4 include/linux/mempolicy.h | 2 include/linux/mm.h | 15 include/linux/mm_types.h | 4 include/linux/mmap_lock.h | 128 + include/linux/mmu_notifier.h | 13 include/linux/pagemap.h | 2 include/linux/pgtable.h | 1444 +++++++++++++++++- include/linux/rmap.h | 2 include/linux/sched/debug.h | 7 include/linux/sched/mm.h | 10 include/linux/uaccess.h | 62 include/xen/arm/page.h | 4 init/init_task.c | 1 ipc/shm.c | 8 kernel/acct.c | 6 kernel/bpf/stackmap.c | 21 kernel/bpf/syscall.c | 2 kernel/cgroup/cpuset.c | 4 kernel/debug/kdb/kdb_bt.c | 17 kernel/events/core.c | 10 kernel/events/uprobes.c | 20 kernel/exit.c | 11 kernel/fork.c | 15 kernel/futex.c | 4 kernel/locking/lockdep.c | 4 kernel/locking/rtmutex-debug.c | 4 kernel/power/snapshot.c | 1 kernel/relay.c | 2 kernel/sched/core.c | 10 kernel/sched/fair.c | 4 kernel/sys.c | 22 kernel/trace/bpf_trace.c | 176 +- kernel/trace/ftrace.c | 8 kernel/trace/trace_kprobe.c | 80 kernel/trace/trace_output.c | 4 lib/dump_stack.c | 4 lib/ioremap.c | 1 lib/test_hmm.c | 14 lib/test_lockup.c | 16 mm/debug.c | 10 mm/debug_vm_pgtable.c | 1 mm/filemap.c | 46 mm/frame_vector.c | 6 mm/gup.c | 73 mm/hmm.c | 2 mm/huge_memory.c | 8 mm/hugetlb.c | 3 mm/init-mm.c | 6 mm/internal.h | 6 mm/khugepaged.c | 72 mm/ksm.c | 48 mm/maccess.c | 496 +++--- mm/madvise.c | 40 mm/memcontrol.c | 10 mm/memory.c | 61 mm/mempolicy.c | 36 mm/migrate.c | 16 mm/mincore.c | 8 mm/mlock.c | 22 mm/mmap.c | 74 mm/mmu_gather.c | 2 mm/mmu_notifier.c | 22 mm/mprotect.c | 22 mm/mremap.c | 14 mm/msync.c | 8 mm/nommu.c | 22 mm/oom_kill.c | 14 mm/page_io.c | 1 mm/page_reporting.h | 2 mm/pagewalk.c | 12 mm/pgtable-generic.c | 6 mm/process_vm_access.c | 4 mm/ptdump.c | 4 mm/rmap.c | 12 mm/shmem.c | 5 mm/sparse-vmemmap.c | 1 mm/sparse.c | 1 mm/swap_state.c | 5 mm/swapfile.c | 5 mm/userfaultfd.c | 26 mm/util.c | 12 mm/vmacache.c | 1 mm/zsmalloc.c | 4 net/ipv4/tcp.c | 8 net/xdp/xdp_umem.c | 4 security/keys/keyctl.c | 2 sound/core/oss/pcm_oss.c | 2 sound/core/sgbuf.c | 1 sound/pci/hda/hda_intel.c | 4 sound/soc/intel/common/sst-firmware.c | 4 sound/soc/intel/haswell/sst-haswell-pcm.c | 4 tools/include/linux/kallsyms.h | 2 virt/kvm/async_pf.c | 4 virt/kvm/kvm_main.c | 9 942 files changed, 4580 insertions(+), 5662 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-09 4:29 incoming Andrew Morton @ 2020-06-09 16:58 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2020-06-09 16:58 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Mon, Jun 8, 2020 at 9:29 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > 942 files changed, 4580 insertions(+), 5662 deletions(-) If you use proper tools, add a "-M" to your diff script, so that you see 941 files changed, 2614 insertions(+), 3696 deletions(-) because a big portion of the lines were due to a rename: rename include/{asm-generic => linux}/pgtable.h (91%) but at some earlier point you mentioned "diffstat", so I guess "proper tools" isn't an option ;( Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-08 4:35 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-06-08 4:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Various trees. Mainly those parts of MM whose linux-next dependents are now merged. I'm still sitting on ~160 patches which await merges from -next. 54 patches, based on 9aa900c8094dba7a60dc805ecec1e9f720744ba1. Subsystems affected by this patch series: mm/proc ipc dynamic-debug panic lib sysctl mm/gup mm/pagemap Subsystem: mm/proc SeongJae Park <sjpark@amazon.de>: mm/page_idle.c: skip offline pages Subsystem: ipc Jules Irenge <jbi.octave@gmail.com>: ipc/msg: add missing annotation for freeque() Giuseppe Scrivano <gscrivan@redhat.com>: ipc/namespace.c: use a work queue to free_ipc Subsystem: dynamic-debug Orson Zhai <orson.zhai@unisoc.com>: dynamic_debug: add an option to enable dynamic debug for modules only Subsystem: panic Rafael Aquini <aquini@redhat.com>: kernel: add panic_on_taint Subsystem: lib Manfred Spraul <manfred@colorfullife.com>: xarray.h: correct return code documentation for xa_store_{bh,irq}() Subsystem: sysctl Vlastimil Babka <vbabka@suse.cz>: Patch series "support setting sysctl parameters from kernel command line", v3: kernel/sysctl: support setting sysctl parameters from kernel command line kernel/sysctl: support handling command line aliases kernel/hung_task convert hung_task_panic boot parameter to sysctl tools/testing/selftests/sysctl/sysctl.sh: support CONFIG_TEST_SYSCTL=y lib/test_sysctl: support testing of sysctl. boot parameter "Guilherme G. Piccoli" <gpiccoli@canonical.com>: kernel/watchdog.c: convert {soft/hard}lockup boot parameters to sysctl aliases kernel/hung_task.c: introduce sysctl to print all traces when a hung task is detected panic: add sysctl to dump all CPUs backtraces on oops event Rafael Aquini <aquini@redhat.com>: kernel/sysctl.c: ignore out-of-range taint bits introduced via kernel.tainted Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: convert to use get_user_{page|pages}_fast_only() John Hubbard <jhubbard@nvidia.com>: mm/gup: update pin_user_pages.rst for "case 3" (mmu notifiers) Patch series "mm/gup: introduce pin_user_pages_locked(), use it in frame_vector.c", v2: mm/gup: introduce pin_user_pages_locked() mm/gup: frame_vector: convert get_user_pages() --> pin_user_pages() mm/gup: documentation fix for pin_user_pages*() APIs Patch series "vhost, docs: convert to pin_user_pages(), new "case 5"": docs: mm/gup: pin_user_pages.rst: add a "case 5" vhost: convert get_user_pages() --> pin_user_pages() Subsystem: mm/pagemap Alexander Gordeev <agordeev@linux.ibm.com>: mm/mmap.c: add more sanity checks to get_unmapped_area() mm/mmap.c: do not allow mappings outside of allowed limits Christoph Hellwig <hch@lst.de>: Patch series "sort out the flush_icache_range mess", v2: arm: fix the flush_icache_range arguments in set_fiq_handler nds32: unexport flush_icache_page powerpc: unexport flush_icache_user_range unicore32: remove flush_cache_user_range asm-generic: fix the inclusion guards for cacheflush.h asm-generic: don't include <linux/mm.h> in cacheflush.h asm-generic: improve the flush_dcache_page stub alpha: use asm-generic/cacheflush.h arm64: use asm-generic/cacheflush.h c6x: use asm-generic/cacheflush.h hexagon: use asm-generic/cacheflush.h ia64: use asm-generic/cacheflush.h microblaze: use asm-generic/cacheflush.h m68knommu: use asm-generic/cacheflush.h openrisc: use asm-generic/cacheflush.h powerpc: use asm-generic/cacheflush.h riscv: use asm-generic/cacheflush.h arm,sparc,unicore32: remove flush_icache_user_range mm: rename flush_icache_user_range to flush_icache_user_page asm-generic: add a flush_icache_user_range stub sh: implement flush_icache_user_range xtensa: implement flush_icache_user_range arm: rename flush_cache_user_range to flush_icache_user_range m68k: implement flush_icache_user_range exec: only build read_code when needed exec: use flush_icache_user_range in read_code binfmt_flat: use flush_icache_user_range nommu: use flush_icache_user_range in brk and mmap module: move the set_fs hack for flush_icache_range to m68k Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: doc: cgroup: update note about conditions when oom killer is invoked Documentation/admin-guide/cgroup-v2.rst | 17 +- Documentation/admin-guide/dynamic-debug-howto.rst | 5 Documentation/admin-guide/kdump/kdump.rst | 8 + Documentation/admin-guide/kernel-parameters.txt | 34 +++- Documentation/admin-guide/sysctl/kernel.rst | 37 ++++ Documentation/core-api/pin_user_pages.rst | 47 ++++-- arch/alpha/include/asm/cacheflush.h | 38 +---- arch/alpha/kernel/smp.c | 2 arch/arm/include/asm/cacheflush.h | 7 arch/arm/kernel/fiq.c | 4 arch/arm/kernel/traps.c | 2 arch/arm64/include/asm/cacheflush.h | 46 ------ arch/c6x/include/asm/cacheflush.h | 19 -- arch/hexagon/include/asm/cacheflush.h | 19 -- arch/ia64/include/asm/cacheflush.h | 30 ---- arch/m68k/include/asm/cacheflush_mm.h | 6 arch/m68k/include/asm/cacheflush_no.h | 19 -- arch/m68k/mm/cache.c | 13 + arch/microblaze/include/asm/cacheflush.h | 29 --- arch/nds32/include/asm/cacheflush.h | 4 arch/nds32/mm/cacheflush.c | 3 arch/openrisc/include/asm/cacheflush.h | 33 ---- arch/powerpc/include/asm/cacheflush.h | 46 +----- arch/powerpc/kvm/book3s_64_mmu_hv.c | 2 arch/powerpc/kvm/book3s_64_mmu_radix.c | 2 arch/powerpc/mm/mem.c | 3 arch/powerpc/perf/callchain_64.c | 4 arch/riscv/include/asm/cacheflush.h | 65 -------- arch/sh/include/asm/cacheflush.h | 1 arch/sparc/include/asm/cacheflush_32.h | 2 arch/sparc/include/asm/cacheflush_64.h | 1 arch/um/include/asm/tlb.h | 2 arch/unicore32/include/asm/cacheflush.h | 11 - arch/x86/include/asm/cacheflush.h | 2 arch/xtensa/include/asm/cacheflush.h | 2 drivers/media/platform/omap3isp/ispvideo.c | 2 drivers/nvdimm/pmem.c | 3 drivers/vhost/vhost.c | 5 fs/binfmt_flat.c | 2 fs/exec.c | 5 fs/proc/proc_sysctl.c | 163 ++++++++++++++++++++-- include/asm-generic/cacheflush.h | 25 +-- include/linux/dev_printk.h | 6 include/linux/dynamic_debug.h | 2 include/linux/ipc_namespace.h | 2 include/linux/kernel.h | 9 + include/linux/mm.h | 12 + include/linux/net.h | 3 include/linux/netdevice.h | 6 include/linux/printk.h | 9 - include/linux/sched/sysctl.h | 7 include/linux/sysctl.h | 4 include/linux/xarray.h | 4 include/rdma/ib_verbs.h | 6 init/main.c | 2 ipc/msg.c | 2 ipc/namespace.c | 24 ++- kernel/events/core.c | 4 kernel/events/uprobes.c | 2 kernel/hung_task.c | 30 ++-- kernel/module.c | 8 - kernel/panic.c | 45 ++++++ kernel/sysctl.c | 38 ++++- kernel/watchdog.c | 37 +--- lib/Kconfig.debug | 12 + lib/Makefile | 2 lib/dynamic_debug.c | 9 - lib/test_sysctl.c | 13 + mm/frame_vector.c | 7 mm/gup.c | 74 +++++++-- mm/mmap.c | 28 ++- mm/nommu.c | 4 mm/page_alloc.c | 9 - mm/page_idle.c | 7 tools/testing/selftests/sysctl/sysctl.sh | 44 +++++ virt/kvm/kvm_main.c | 8 - 76 files changed, 732 insertions(+), 517 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-04 23:45 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-06-04 23:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - More MM work. 100ish more to go. Mike's "mm: remove __ARCH_HAS_5LEVEL_HACK" series should fix the current ppc issue. - Various other little subsystems 127 patches, based on 6929f71e46bdddbf1c4d67c2728648176c67c555. Subsystems affected by this patch series: kcov mm/pagemap mm/vmalloc mm/kmap mm/util mm/memory-hotplug mm/cleanups mm/zram procfs core-kernel get_maintainer lib bitops checkpatch binfmt init fat seq_file exec rapidio relay selftests ubsan Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series "kcov: collect coverage from usb soft interrupts", v4: kcov: cleanup debug messages kcov: fix potential use-after-free in kcov_remote_start kcov: move t->kcov assignments into kcov_start/stop kcov: move t->kcov_sequence assignment kcov: use t->kcov_mode as enabled indicator kcov: collect coverage from interrupts usb: core: kcov: collect coverage from usb complete callback Subsystem: mm/pagemap Feng Tang <feng.tang@intel.com>: mm/util.c: remove the VM_WARN_ONCE for vm_committed_as underflow check Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove __ARCH_HAS_5LEVEL_HACK", v4: h8300: remove usage of __ARCH_USE_5LEVEL_HACK arm: add support for folded p4d page tables arm64: add support for folded p4d page tables hexagon: remove __ARCH_USE_5LEVEL_HACK ia64: add support for folded p4d page tables nios2: add support for folded p4d page tables openrisc: add support for folded p4d page tables powerpc: add support for folded p4d page tables Geert Uytterhoeven <geert+renesas@glider.be>: sh: fault: modernize printing of kernel messages Mike Rapoport <rppt@linux.ibm.com>: sh: drop __pXd_offset() macros that duplicate pXd_index() ones sh: add support for folded p4d page tables unicore32: remove __ARCH_USE_5LEVEL_HACK asm-generic: remove pgtable-nop4d-hack.h mm: remove __ARCH_HAS_5LEVEL_HACK and include/asm-generic/5level-fixup.h Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/debug: Add tests validating architecture page table: x86/mm: define mm_p4d_folded() mm/debug: add tests validating architecture page table helpers Subsystem: mm/vmalloc Jeongtae Park <jtp.park@samsung.com>: mm/vmalloc: fix a typo in comment Subsystem: mm/kmap Ira Weiny <ira.weiny@intel.com>: Patch series "Remove duplicated kmap code", v3: arch/kmap: remove BUG_ON() arch/xtensa: move kmap build bug out of the way arch/kmap: remove redundant arch specific kmaps arch/kunmap: remove duplicate kunmap implementations {x86,powerpc,microblaze}/kmap: move preempt disable arch/kmap_atomic: consolidate duplicate code arch/kunmap_atomic: consolidate duplicate code arch/kmap: ensure kmap_prot visibility arch/kmap: don't hard code kmap_prot values arch/kmap: define kmap_atomic_prot() for all arch's drm: remove drm specific kmap_atomic code kmap: remove kmap_atomic_to_page() parisc/kmap: remove duplicate kmap code sparc: remove unnecessary includes kmap: consolidate kmap_prot definitions Subsystem: mm/util Waiman Long <longman@redhat.com>: mm: add kvfree_sensitive() for freeing sensitive data objects Subsystem: mm/memory-hotplug Vishal Verma <vishal.l.verma@intel.com>: mm/memory_hotplug: refrain from adding memory into an impossible node David Hildenbrand <david@redhat.com>: powerpc/pseries/hotplug-memory: stop checking is_mem_section_removable() mm/memory_hotplug: remove is_mem_section_removable() Patch series "mm/memory_hotplug: handle memblocks only with: mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0 mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK Patch series "mm/memory_hotplug: Interface to add driver-managed system: mm/memory_hotplug: introduce add_memory_driver_managed() kexec_file: don't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED device-dax: add memory via add_memory_driver_managed() Michal Hocko <mhocko@kernel.org>: mm/memory_hotplug: disable the functionality for 32b Subsystem: mm/cleanups chenqiwu <chenqiwu@xiaomi.com>: mm: replace zero-length array with flexible-array member Ethon Paul <ethp@qq.com>: mm/memory_hotplug: fix a typo in comment "recoreded"->"recorded" mm: ksm: fix a typo in comment "alreaady"->"already" mm: mmap: fix a typo in comment "compatbility"->"compatibility" mm/hugetlb: fix a typos in comments mm/vmsan: fix some typos in comment mm/compaction: fix a typo in comment "pessemistic"->"pessimistic" mm/memblock: fix a typo in comment "implict"->"implicit" mm/list_lru: fix a typo in comment "numbesr"->"numbers" mm/filemap: fix a typo in comment "unneccssary"->"unnecessary" mm/frontswap: fix some typos in frontswap.c mm, memcg: fix some typos in memcontrol.c mm: fix a typo in comment "strucure"->"structure" mm/slub: fix a typo in comment "disambiguiation"->"disambiguation" mm/sparse: fix a typo in comment "convienence"->"convenience" mm/page-writeback: fix a typo in comment "effictive"->"effective" mm/memory: fix a typo in comment "attampt"->"attempt" Zou Wei <zou_wei@huawei.com>: mm: use false for bool variable Jason Yan <yanaijie@huawei.com>: include/linux/mm.h: return true in cpupid_pid_unset() Subsystem: mm/zram Andy Shevchenko <andriy.shevchenko@linux.intel.com>: zcomp: Use ARRAY_SIZE() for backends list Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: rename "catch" function argument Subsystem: core-kernel Jason Yan <yanaijie@huawei.com>: user.c: make uidhash_table static Subsystem: get_maintainer Joe Perches <joe@perches.com>: get_maintainer: add email addresses from .yaml files get_maintainer: fix unexpected behavior for path/to//file (double slashes) Subsystem: lib Christophe JAILLET <christophe.jaillet@wanadoo.fr>: lib/math: avoid trailing newline hidden in pr_fmt() KP Singh <kpsingh@chromium.org>: lib: Add might_fault() to strncpy_from_user. Jason Yan <yanaijie@huawei.com>: lib/test_lockup.c: make test_inode static Jann Horn <jannh@google.com>: lib/zlib: remove outdated and incorrect pre-increment optimization Joe Perches <joe@perches.com>: lib/percpu-refcount.c: use a more common logging style Tan Hu <tan.hu@zte.com.cn>: lib/flex_proportions.c: cleanup __fprop_inc_percpu_max Jesse Brandeburg <jesse.brandeburg@intel.com>: lib: make a test module with set/clear bit Subsystem: bitops Arnd Bergmann <arnd@arndb.de>: include/linux/bitops.h: avoid clang shift-count-overflow warnings Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: additional MAINTAINER section entry ordering checks checkpatch: look for c99 comments in ctx_locate_comment checkpatch: disallow --git and --file/--fix Geert Uytterhoeven <geert+renesas@glider.be>: checkpatch: use patch subject when reading from stdin Subsystem: binfmt Anthony Iliopoulos <ailiop@suse.com>: fs/binfmt_elf: remove redundant elf_map ifndef Nick Desaulniers <ndesaulniers@google.com>: elfnote: mark all .note sections SHF_ALLOC Subsystem: init Chris Down <chris@chrisdown.name>: init: allow distribution configuration of default init Subsystem: fat OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: don't allow to mount if the FAT length == 0 fat: improve the readahead for FAT entries Subsystem: seq_file Joe Perches <joe@perches.com>: fs/seq_file.c: seq_read: Update pr_info_ratelimited Kefeng Wang <wangkefeng.wang@huawei.com>: Patch series "seq_file: Introduce DEFINE_SEQ_ATTRIBUTE() helper macro": include/linux/seq_file.h: introduce DEFINE_SEQ_ATTRIBUTE() helper macro mm/vmstat.c: convert to use DEFINE_SEQ_ATTRIBUTE macro kernel/kprobes.c: convert to use DEFINE_SEQ_ATTRIBUTE macro Subsystem: exec Christoph Hellwig <hch@lst.de>: exec: simplify the copy_strings_kernel calling convention exec: open code copy_string_kernel Subsystem: rapidio Madhuparna Bhowmik <madhuparnabhowmik10@gmail.com>: rapidio: avoid data race between file operation callbacks and mport_cdev_add(). John Hubbard <jhubbard@nvidia.com>: rapidio: convert get_user_pages() --> pin_user_pages() Subsystem: relay Daniel Axtens <dja@axtens.net>: kernel/relay.c: handle alloc_percpu returning NULL in relay_open Pengcheng Yang <yangpc@wangsu.com>: kernel/relay.c: fix read_pos error when multiple readers Subsystem: selftests Ram Pai <linuxram@us.ibm.com>: Patch series "selftests, powerpc, x86: Memory Protection Keys", v19: selftests/x86/pkeys: move selftests to arch-neutral directory selftests/vm/pkeys: rename all references to pkru to a generic name selftests/vm/pkeys: move generic definitions to header file Thiago Jung Bauermann <bauerman@linux.ibm.com>: selftests/vm/pkeys: move some definitions to arch-specific header selftests/vm/pkeys: make gcc check arguments of sigsafe_printf() Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: Use sane types for pkey register selftests: vm: pkeys: add helpers for pkey bits Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: fix pkey_disable_clear() selftests/vm/pkeys: fix assertion in pkey_disable_set/clear() selftests/vm/pkeys: fix alloc_random_pkey() to make it really random Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: use the correct huge page size Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: introduce generic pkey abstractions selftests/vm/pkeys: introduce powerpc support "Desnes A. Nunes do Rosario" <desnesn@linux.vnet.ibm.com>: selftests/vm/pkeys: fix number of reserved powerpc pkeys Ram Pai <linuxram@us.ibm.com>: selftests/vm/pkeys: fix assertion in test_pkey_alloc_exhaust() selftests/vm/pkeys: improve checks to determine pkey support selftests/vm/pkeys: associate key on a mapped page and detect access violation selftests/vm/pkeys: associate key on a mapped page and detect write violation selftests/vm/pkeys: detect write violation on a mapped access-denied-key page selftests/vm/pkeys: introduce a sub-page allocator selftests/vm/pkeys: test correct behaviour of pkey-0 selftests/vm/pkeys: override access right definitions on powerpc Sandipan Das <sandipan@linux.ibm.com>: selftests: vm: pkeys: use the correct page size on powerpc selftests: vm: pkeys: fix multilib builds for x86 Jagadeesh Pagadala <jagdsh.linux@gmail.com>: tools/testing/selftests/vm: remove duplicate headers Subsystem: ubsan Arnd Bergmann <arnd@arndb.de>: lib/ubsan.c: fix gcc-10 warnings Documentation/dev-tools/kcov.rst | 17 Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34 arch/arc/Kconfig | 1 arch/arc/include/asm/highmem.h | 20 arch/arc/mm/highmem.c | 34 arch/arm/include/asm/highmem.h | 9 arch/arm/include/asm/pgtable.h | 1 arch/arm/lib/uaccess_with_memcpy.c | 7 arch/arm/mach-sa1100/assabet.c | 2 arch/arm/mm/dump.c | 29 arch/arm/mm/fault-armv.c | 7 arch/arm/mm/fault.c | 22 arch/arm/mm/highmem.c | 41 arch/arm/mm/idmap.c | 3 arch/arm/mm/init.c | 2 arch/arm/mm/ioremap.c | 12 arch/arm/mm/mm.h | 2 arch/arm/mm/mmu.c | 35 arch/arm/mm/pgd.c | 40 arch/arm64/Kconfig | 1 arch/arm64/include/asm/kvm_mmu.h | 10 arch/arm64/include/asm/pgalloc.h | 10 arch/arm64/include/asm/pgtable-types.h | 5 arch/arm64/include/asm/pgtable.h | 37 arch/arm64/include/asm/stage2_pgtable.h | 48 arch/arm64/kernel/hibernate.c | 44 arch/arm64/kvm/mmu.c | 209 arch/arm64/mm/fault.c | 9 arch/arm64/mm/hugetlbpage.c | 15 arch/arm64/mm/kasan_init.c | 26 arch/arm64/mm/mmu.c | 52 arch/arm64/mm/pageattr.c | 7 arch/csky/include/asm/highmem.h | 12 arch/csky/mm/highmem.c | 64 arch/h8300/include/asm/pgtable.h | 1 arch/hexagon/include/asm/fixmap.h | 4 arch/hexagon/include/asm/pgtable.h | 1 arch/ia64/include/asm/pgalloc.h | 4 arch/ia64/include/asm/pgtable.h | 17 arch/ia64/mm/fault.c | 7 arch/ia64/mm/hugetlbpage.c | 18 arch/ia64/mm/init.c | 28 arch/microblaze/include/asm/highmem.h | 55 arch/microblaze/mm/highmem.c | 21 arch/microblaze/mm/init.c | 3 arch/mips/include/asm/highmem.h | 11 arch/mips/mm/cache.c | 6 arch/mips/mm/highmem.c | 62 arch/nds32/include/asm/highmem.h | 9 arch/nds32/mm/highmem.c | 49 arch/nios2/include/asm/pgtable.h | 3 arch/nios2/mm/fault.c | 9 arch/nios2/mm/ioremap.c | 6 arch/openrisc/include/asm/pgtable.h | 1 arch/openrisc/mm/fault.c | 10 arch/openrisc/mm/init.c | 4 arch/parisc/include/asm/cacheflush.h | 32 arch/powerpc/Kconfig | 1 arch/powerpc/include/asm/book3s/32/pgtable.h | 1 arch/powerpc/include/asm/book3s/64/hash.h | 4 arch/powerpc/include/asm/book3s/64/pgalloc.h | 4 arch/powerpc/include/asm/book3s/64/pgtable.h | 60 arch/powerpc/include/asm/book3s/64/radix.h | 6 arch/powerpc/include/asm/highmem.h | 56 arch/powerpc/include/asm/nohash/32/pgtable.h | 1 arch/powerpc/include/asm/nohash/64/pgalloc.h | 2 arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 32 arch/powerpc/include/asm/nohash/64/pgtable.h | 6 arch/powerpc/include/asm/pgtable.h | 10 arch/powerpc/kvm/book3s_64_mmu_radix.c | 32 arch/powerpc/lib/code-patching.c | 7 arch/powerpc/mm/book3s64/hash_pgtable.c | 4 arch/powerpc/mm/book3s64/radix_pgtable.c | 26 arch/powerpc/mm/book3s64/subpage_prot.c | 6 arch/powerpc/mm/highmem.c | 26 arch/powerpc/mm/hugetlbpage.c | 28 arch/powerpc/mm/kasan/kasan_init_32.c | 2 arch/powerpc/mm/mem.c | 3 arch/powerpc/mm/nohash/book3e_pgtable.c | 15 arch/powerpc/mm/pgtable.c | 30 arch/powerpc/mm/pgtable_64.c | 10 arch/powerpc/mm/ptdump/hashpagetable.c | 20 arch/powerpc/mm/ptdump/ptdump.c | 12 arch/powerpc/platforms/pseries/hotplug-memory.c | 26 arch/powerpc/xmon/xmon.c | 27 arch/s390/Kconfig | 1 arch/sh/include/asm/pgtable-2level.h | 1 arch/sh/include/asm/pgtable-3level.h | 1 arch/sh/include/asm/pgtable_32.h | 5 arch/sh/include/asm/pgtable_64.h | 5 arch/sh/kernel/io_trapped.c | 7 arch/sh/mm/cache-sh4.c | 4 arch/sh/mm/cache-sh5.c | 7 arch/sh/mm/fault.c | 64 arch/sh/mm/hugetlbpage.c | 28 arch/sh/mm/init.c | 15 arch/sh/mm/kmap.c | 2 arch/sh/mm/tlbex_32.c | 6 arch/sh/mm/tlbex_64.c | 7 arch/sparc/include/asm/highmem.h | 29 arch/sparc/mm/highmem.c | 31 arch/sparc/mm/io-unit.c | 1 arch/sparc/mm/iommu.c | 1 arch/unicore32/include/asm/pgtable.h | 1 arch/unicore32/kernel/hibernate.c | 4 arch/x86/Kconfig | 1 arch/x86/include/asm/fixmap.h | 1 arch/x86/include/asm/highmem.h | 37 arch/x86/include/asm/pgtable_64.h | 6 arch/x86/mm/highmem_32.c | 52 arch/xtensa/include/asm/highmem.h | 31 arch/xtensa/mm/highmem.c | 28 drivers/block/zram/zcomp.c | 7 drivers/dax/dax-private.h | 1 drivers/dax/kmem.c | 28 drivers/gpu/drm/ttm/ttm_bo_util.c | 56 drivers/gpu/drm/vmwgfx/vmwgfx_blit.c | 17 drivers/rapidio/devices/rio_mport_cdev.c | 27 drivers/usb/core/hcd.c | 3 fs/binfmt_elf.c | 4 fs/binfmt_em86.c | 6 fs/binfmt_misc.c | 4 fs/binfmt_script.c | 6 fs/exec.c | 58 fs/fat/fatent.c | 103 fs/fat/inode.c | 6 fs/proc/array.c | 8 fs/seq_file.c | 7 include/asm-generic/5level-fixup.h | 59 include/asm-generic/pgtable-nop4d-hack.h | 64 include/asm-generic/pgtable-nopud.h | 4 include/drm/ttm/ttm_bo_api.h | 4 include/linux/binfmts.h | 3 include/linux/bitops.h | 2 include/linux/elfnote.h | 2 include/linux/highmem.h | 89 include/linux/ioport.h | 1 include/linux/memory_hotplug.h | 9 include/linux/mm.h | 12 include/linux/sched.h | 3 include/linux/seq_file.h | 19 init/Kconfig | 10 init/main.c | 10 kernel/kcov.c | 282 - kernel/kexec_file.c | 5 kernel/kprobes.c | 34 kernel/relay.c | 22 kernel/user.c | 2 lib/Kconfig.debug | 44 lib/Makefile | 2 lib/flex_proportions.c | 7 lib/math/prime_numbers.c | 10 lib/percpu-refcount.c | 6 lib/strncpy_from_user.c | 1 lib/test_bitops.c | 60 lib/test_lockup.c | 2 lib/ubsan.c | 33 lib/zlib_inflate/inffast.c | 91 mm/Kconfig | 4 mm/Makefile | 1 mm/compaction.c | 2 mm/debug_vm_pgtable.c | 382 + mm/filemap.c | 2 mm/frontswap.c | 6 mm/huge_memory.c | 2 mm/hugetlb.c | 16 mm/internal.h | 2 mm/kasan/init.c | 11 mm/ksm.c | 10 mm/list_lru.c | 2 mm/memblock.c | 2 mm/memcontrol.c | 4 mm/memory.c | 10 mm/memory_hotplug.c | 179 mm/mmap.c | 2 mm/mremap.c | 2 mm/page-writeback.c | 2 mm/slub.c | 2 mm/sparse.c | 2 mm/util.c | 22 mm/vmalloc.c | 2 mm/vmscan.c | 6 mm/vmstat.c | 32 mm/zbud.c | 2 scripts/checkpatch.pl | 62 scripts/get_maintainer.pl | 46 security/keys/internal.h | 11 security/keys/keyctl.c | 16 tools/testing/selftests/lib/config | 1 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 75 tools/testing/selftests/vm/mremap_dontunmap.c | 1 tools/testing/selftests/vm/pkey-helpers.h | 557 +- tools/testing/selftests/vm/pkey-powerpc.h | 153 tools/testing/selftests/vm/pkey-x86.h | 191 tools/testing/selftests/vm/protection_keys.c | 2370 ++++++++-- tools/testing/selftests/x86/.gitignore | 1 tools/testing/selftests/x86/Makefile | 2 tools/testing/selftests/x86/pkey-helpers.h | 219 tools/testing/selftests/x86/protection_keys.c | 1506 ------ 200 files changed, 5182 insertions(+), 4033 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-03 22:55 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-06-03 22:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm More mm/ work, plenty more to come. 131 patches, based on d6f9469a03d832dcd17041ed67774ffb5f3e73b3. Subsystems affected by this patch series: mm/slub mm/memcg mm/gup mm/kasan mm/pagealloc mm/hugetlb mm/vmscan mm/tools mm/mempolicy mm/memblock mm/hugetlbfs mm/thp mm/mmap mm/kconfig Subsystem: mm/slub Wang Hai <wanghai38@huawei.com>: mm/slub: fix a memory leak in sysfs_slab_add() Subsystem: mm/memcg Shakeel Butt <shakeelb@google.com>: mm/memcg: optimize memory.numa_stat like memory.stat Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup, drm/i915: refactor gup_fast, convert to pin_user_pages()", v2: mm/gup: move __get_user_pages_fast() down a few lines in gup.c mm/gup: refactor and de-duplicate gup_fast() code mm/gup: introduce pin_user_pages_fast_only() drm/i915: convert get_user_pages() --> pin_user_pages() mm/gup: might_lock_read(mmap_sem) in get_user_pages_fast() Subsystem: mm/kasan Daniel Axtens <dja@axtens.net>: Patch series "Fix some incompatibilites between KASAN and FORTIFY_SOURCE", v4: kasan: stop tests being eliminated as dead code with FORTIFY_SOURCE string.h: fix incompatibility between FORTIFY_SOURCE and KASAN Subsystem: mm/pagealloc Michal Hocko <mhocko@suse.com>: mm: clarify __GFP_MEMALLOC usage Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: rework free_area_init*() funcitons": mm: memblock: replace dereferences of memblock_region.nid with API calls mm: make early_pfn_to_nid() and related defintions close to each other mm: remove CONFIG_HAVE_MEMBLOCK_NODE_MAP option mm: free_area_init: use maximal zone PFNs rather than zone sizes mm: use free_area_init() instead of free_area_init_nodes() alpha: simplify detection of memory zone boundaries arm: simplify detection of memory zone boundaries arm64: simplify detection of memory zone boundaries for UMA configs csky: simplify detection of memory zone boundaries m68k: mm: simplify detection of memory zone boundaries parisc: simplify detection of memory zone boundaries sparc32: simplify detection of memory zone boundaries unicore32: simplify detection of memory zone boundaries xtensa: simplify detection of memory zone boundaries Baoquan He <bhe@redhat.com>: mm: memmap_init: iterate over memblock regions rather that check each PFN Mike Rapoport <rppt@linux.ibm.com>: mm: remove early_pfn_in_nid() and CONFIG_NODES_SPAN_OTHER_NODES mm: free_area_init: allow defining max_zone_pfn in descending order mm: rename free_area_init_node() to free_area_init_memoryless_node() mm: clean up free_area_init_node() and its helpers mm: simplify find_min_pfn_with_active_regions() docs/vm: update memory-models documentation Wei Yang <richard.weiyang@gmail.com>: Patch series "mm/page_alloc.c: cleanup on check page", v3: mm/page_alloc.c: bad_[reason|flags] is not necessary when PageHWPoison mm/page_alloc.c: bad_flags is not necessary for bad_page() mm/page_alloc.c: rename free_pages_check_bad() to check_free_page_bad() mm/page_alloc.c: rename free_pages_check() to check_free_page() mm/page_alloc.c: extract check_[new|free]_page_bad() common part to page_bad_reason() Roman Gushchin <guro@fb.com>: mm,page_alloc,cma: conditionally prefer cma pageblocks for movable allocations Baoquan He <bhe@redhat.com>: mm/page_alloc.c: remove unused free_bootmem_with_active_regions Patch series "improvements about lowmem_reserve and /proc/zoneinfo", v2: mm/page_alloc.c: only tune sysctl_lowmem_reserve_ratio value once when changing it mm/page_alloc.c: clear out zone->lowmem_reserve[] if the zone is empty mm/vmstat.c: do not show lowmem reserve protection information of empty zone Joonsoo Kim <iamjoonsoo.kim@lge.com>: Patch series "integrate classzone_idx and high_zoneidx", v5: mm/page_alloc: use ac->high_zoneidx for classzone_idx mm/page_alloc: integrate classzone_idx and high_zoneidx Wei Yang <richard.weiyang@gmail.com>: mm/page_alloc.c: use NODE_MASK_NONE in build_zonelists() mm: rename gfpflags_to_migratetype to gfp_migratetype for same convention Sandipan Das <sandipan@linux.ibm.com>: mm/page_alloc.c: reset numa stats for boot pagesets Charan Teja Reddy <charante@codeaurora.org>: mm, page_alloc: reset the zone->watermark_boost early Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc: restrict and formalize compound_page_dtors[] Daniel Jordan <daniel.m.jordan@oracle.com>: Patch series "initialize deferred pages with interrupts enabled", v4: mm/pagealloc.c: call touch_nmi_watchdog() on max order boundaries in deferred init Pavel Tatashin <pasha.tatashin@soleen.com>: mm: initialize deferred pages with interrupts enabled mm: call cond_resched() from deferred_init_memmap() Daniel Jordan <daniel.m.jordan@oracle.com>: Patch series "padata: parallelize deferred page init", v3: padata: remove exit routine padata: initialize earlier padata: allocate work structures for parallel jobs from a pool padata: add basic support for multithreaded jobs mm: don't track number of pages during deferred initialization mm: parallelize deferred_init_memmap() mm: make deferred init's max threads arch-specific padata: document multithreaded jobs Chen Tao <chentao107@huawei.com>: mm/page_alloc.c: add missing newline Subsystem: mm/hugetlb "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: Patch series "thp/khugepaged improvements and CoW semantics", v4: khugepaged: add self test khugepaged: do not stop collapse if less than half PTEs are referenced khugepaged: drain all LRU caches before scanning pages khugepaged: drain LRU add pagevec after swapin khugepaged: allow to collapse a page shared across fork khugepaged: allow to collapse PTE-mapped compound pages thp: change CoW semantics for anon-THP khugepaged: introduce 'max_ptes_shared' tunable Mike Kravetz <mike.kravetz@oracle.com>: Patch series "Clean up hugetlb boot command line processing", v4: hugetlbfs: add arch_hugetlb_valid_size hugetlbfs: move hugepagesz= parsing to arch independent code hugetlbfs: remove hugetlb_add_hstate() warning for existing hstate hugetlbfs: clean up command line processing hugetlbfs: fix changes to command line processing Li Xinhai <lixinhai.lxh@gmail.com>: mm/hugetlb: avoid unnecessary check on pud and pmd entry in huge_pte_offset Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/hugetlb: Add some new generic fallbacks", v3: arm64/mm: drop __HAVE_ARCH_HUGE_PTEP_GET mm/hugetlb: define a generic fallback for is_hugepage_only_range() mm/hugetlb: define a generic fallback for arch_clear_hugepage_flags() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: simplify calling a compound page destructor Subsystem: mm/vmscan Wei Yang <richard.weiyang@gmail.com>: mm/vmscan.c: use update_lru_size() in update_lru_sizes() Jaewon Kim <jaewon31.kim@samsung.com>: mm/vmscan: count layzfree pages and fix nr_isolated_* mismatch Maninder Singh <maninder1.s@samsung.com>: mm/vmscan.c: change prototype for shrink_page_list Qiwu Chen <qiwuchen55@gmail.com>: mm/vmscan: update the comment of should_continue_reclaim() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: charge swapin pages on instantiation", v2: mm: fix NUMA node file count error in replace_page_cache() mm: memcontrol: fix stat-corrupting race in charge moving mm: memcontrol: drop @compound parameter from memcg charging API mm: shmem: remove rare optimization when swapin races with hole punching mm: memcontrol: move out cgroup swaprate throttling mm: memcontrol: convert page cache to a new mem_cgroup_charge() API mm: memcontrol: prepare uncharging for removal of private page type counters mm: memcontrol: prepare move_account for removal of private page type counters mm: memcontrol: prepare cgroup vmstat infrastructure for native anon counters mm: memcontrol: switch to native NR_FILE_PAGES and NR_SHMEM counters mm: memcontrol: switch to native NR_ANON_MAPPED counter mm: memcontrol: switch to native NR_ANON_THPS counter mm: memcontrol: convert anon and file-thp to new mem_cgroup_charge() API mm: memcontrol: drop unused try/commit/cancel charge API mm: memcontrol: prepare swap controller setup for integration mm: memcontrol: make swap tracking an integral part of memory control mm: memcontrol: charge swapin pages on instantiation Alex Shi <alex.shi@linux.alibaba.com>: mm: memcontrol: document the new swap control behavior Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: delete unused lrucare handling mm: memcontrol: update page->mem_cgroup stability rules mm: fix LRU balancing effect of new transparent huge pages mm: keep separate anon and file statistics on page reclaim activity mm: allow swappiness that prefers reclaiming anon over the file workingset mm: fold and remove lru_cache_add_anon() and lru_cache_add_file() mm: workingset: let cache workingset challenge anon mm: remove use-once cache bias from LRU balancing mm: vmscan: drop unnecessary div0 avoidance rounding in get_scan_count() mm: base LRU balancing on an explicit cost model mm: deactivations shouldn't bias the LRU balance mm: only count actual rotations as LRU reclaim cost mm: balance LRU lists based on relative thrashing mm: vmscan: determine anon/file pressure balance at the reclaim root mm: vmscan: reclaim writepage is IO cost mm: vmscan: limit the range of LRU type balancing Shakeel Butt <shakeelb@google.com>: mm: swap: fix vmstats for huge pages mm: swap: memcg: fix memcg stats for huge pages Subsystem: mm/tools Changhee Han <ch0.han@lge.com>: tools/vm/page_owner_sort.c: filter out unneeded line Subsystem: mm/mempolicy Michal Hocko <mhocko@suse.com>: mm, mempolicy: fix up gup usage in lookup_node Subsystem: mm/memblock chenqiwu <chenqiwu@xiaomi.com>: include/linux/memblock.h: fix minor typo and unclear comment Mike Rapoport <rppt@linux.ibm.com>: sparc32: register memory occupied by kernel as memblock.memory Subsystem: mm/hugetlbfs Shijie Hu <hushijie3@huawei.com>: hugetlbfs: get unmapped area below TASK_UNMAPPED_BASE for hugetlbfs Subsystem: mm/thp Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: don't need to drain lru cache when splitting and mlocking THP Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/thp: Rename pmd_mknotpresent() as pmd_mknotvalid()", v2: powerpc/mm: drop platform defined pmd_mknotpresent() mm/thp: rename pmd_mknotpresent() as pmd_mkinvalid() Subsystem: mm/mmap Scott Cheloha <cheloha@linux.vnet.ibm.com>: drivers/base/memory.c: cache memory blocks in xarray to accelerate lookup Subsystem: mm/kconfig Zong Li <zong.li@sifive.com>: Patch series "Extract DEBUG_WX to shared use": mm: add DEBUG_WX support riscv: support DEBUG_WX x86: mm: use ARCH_HAS_DEBUG_WX instead of arch defined arm64: mm: use ARCH_HAS_DEBUG_WX instead of arch defined Documentation/admin-guide/cgroup-v1/memory.rst | 19 Documentation/admin-guide/kernel-parameters.txt | 40 Documentation/admin-guide/mm/hugetlbpage.rst | 35 Documentation/admin-guide/mm/transhuge.rst | 7 Documentation/admin-guide/sysctl/vm.rst | 23 Documentation/core-api/padata.rst | 41 Documentation/features/vm/numa-memblock/arch-support.txt | 34 Documentation/vm/memory-model.rst | 9 Documentation/vm/page_owner.rst | 3 arch/alpha/mm/init.c | 16 arch/alpha/mm/numa.c | 22 arch/arc/include/asm/hugepage.h | 2 arch/arc/mm/init.c | 41 arch/arm/include/asm/hugetlb.h | 7 arch/arm/include/asm/pgtable-3level.h | 2 arch/arm/mm/init.c | 66 arch/arm64/Kconfig | 2 arch/arm64/Kconfig.debug | 29 arch/arm64/include/asm/hugetlb.h | 13 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/mm/hugetlbpage.c | 48 arch/arm64/mm/init.c | 56 arch/arm64/mm/numa.c | 9 arch/c6x/mm/init.c | 8 arch/csky/kernel/setup.c | 26 arch/h8300/mm/init.c | 6 arch/hexagon/mm/init.c | 6 arch/ia64/Kconfig | 1 arch/ia64/include/asm/hugetlb.h | 5 arch/ia64/mm/contig.c | 2 arch/ia64/mm/discontig.c | 2 arch/m68k/mm/init.c | 6 arch/m68k/mm/mcfmmu.c | 9 arch/m68k/mm/motorola.c | 15 arch/m68k/mm/sun3mmu.c | 10 arch/microblaze/Kconfig | 1 arch/microblaze/mm/init.c | 2 arch/mips/Kconfig | 1 arch/mips/include/asm/hugetlb.h | 11 arch/mips/include/asm/pgtable.h | 2 arch/mips/loongson64/numa.c | 2 arch/mips/mm/init.c | 2 arch/mips/sgi-ip27/ip27-memory.c | 2 arch/nds32/mm/init.c | 11 arch/nios2/mm/init.c | 8 arch/openrisc/mm/init.c | 9 arch/parisc/include/asm/hugetlb.h | 10 arch/parisc/mm/init.c | 22 arch/powerpc/Kconfig | 10 arch/powerpc/include/asm/book3s/64/pgtable.h | 4 arch/powerpc/include/asm/hugetlb.h | 5 arch/powerpc/mm/hugetlbpage.c | 38 arch/powerpc/mm/mem.c | 2 arch/riscv/Kconfig | 2 arch/riscv/include/asm/hugetlb.h | 10 arch/riscv/include/asm/ptdump.h | 11 arch/riscv/mm/hugetlbpage.c | 44 arch/riscv/mm/init.c | 5 arch/s390/Kconfig | 1 arch/s390/include/asm/hugetlb.h | 8 arch/s390/mm/hugetlbpage.c | 34 arch/s390/mm/init.c | 2 arch/sh/Kconfig | 1 arch/sh/include/asm/hugetlb.h | 7 arch/sh/mm/init.c | 2 arch/sparc/Kconfig | 10 arch/sparc/include/asm/hugetlb.h | 10 arch/sparc/mm/init_32.c | 1 arch/sparc/mm/init_64.c | 67 arch/sparc/mm/srmmu.c | 21 arch/um/kernel/mem.c | 12 arch/unicore32/include/asm/memory.h | 2 arch/unicore32/include/mach/memory.h | 6 arch/unicore32/kernel/pci.c | 14 arch/unicore32/mm/init.c | 43 arch/x86/Kconfig | 11 arch/x86/Kconfig.debug | 27 arch/x86/include/asm/hugetlb.h | 10 arch/x86/include/asm/pgtable.h | 2 arch/x86/mm/hugetlbpage.c | 35 arch/x86/mm/init.c | 2 arch/x86/mm/init_64.c | 12 arch/x86/mm/kmmio.c | 2 arch/x86/mm/numa.c | 11 arch/xtensa/mm/init.c | 8 drivers/base/memory.c | 44 drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 22 fs/cifs/file.c | 10 fs/fuse/dev.c | 2 fs/hugetlbfs/inode.c | 67 include/asm-generic/hugetlb.h | 2 include/linux/compaction.h | 9 include/linux/gfp.h | 7 include/linux/hugetlb.h | 16 include/linux/memblock.h | 15 include/linux/memcontrol.h | 102 - include/linux/mm.h | 52 include/linux/mmzone.h | 46 include/linux/padata.h | 43 include/linux/string.h | 60 include/linux/swap.h | 17 include/linux/vm_event_item.h | 4 include/linux/vmstat.h | 2 include/trace/events/compaction.h | 22 include/trace/events/huge_memory.h | 3 include/trace/events/vmscan.h | 14 init/Kconfig | 17 init/main.c | 2 kernel/events/uprobes.c | 22 kernel/padata.c | 293 +++- kernel/sysctl.c | 3 lib/test_kasan.c | 29 mm/Kconfig | 9 mm/Kconfig.debug | 32 mm/compaction.c | 70 - mm/filemap.c | 55 mm/gup.c | 237 ++- mm/huge_memory.c | 282 ---- mm/hugetlb.c | 260 ++- mm/internal.h | 25 mm/khugepaged.c | 316 ++-- mm/memblock.c | 19 mm/memcontrol.c | 642 +++------ mm/memory.c | 103 - mm/memory_hotplug.c | 10 mm/mempolicy.c | 5 mm/migrate.c | 30 mm/oom_kill.c | 4 mm/page_alloc.c | 735 ++++------ mm/page_owner.c | 7 mm/pgtable-generic.c | 2 mm/rmap.c | 53 mm/shmem.c | 156 -- mm/slab.c | 4 mm/slub.c | 8 mm/swap.c | 199 +- mm/swap_cgroup.c | 10 mm/swap_state.c | 110 - mm/swapfile.c | 39 mm/userfaultfd.c | 15 mm/vmscan.c | 344 ++-- mm/vmstat.c | 16 mm/workingset.c | 23 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 1 tools/testing/selftests/vm/khugepaged.c | 1035 +++++++++++++++ tools/vm/page_owner_sort.c | 5 147 files changed, 3876 insertions(+), 3108 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-02 20:09 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-06-02 20:09 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A few little subsystems and a start of a lot of MM patches. 128 patches, based on f359287765c04711ff54fbd11645271d8e5ff763: Subsystems affected by this patch series: squashfs ocfs2 parisc vfs mm/slab-generic mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memory-failure mm/vmalloc mm/kasan Subsystem: squashfs Philippe Liard <pliard@google.com>: squashfs: migrate from ll_rw_block usage to BIO Subsystem: ocfs2 Jules Irenge <jbi.octave@gmail.com>: ocfs2: add missing annotation for dlm_empty_lockres() Gang He <ghe@suse.com>: ocfs2: mount shared volume without ha stack Subsystem: parisc Andrew Morton <akpm@linux-foundation.org>: arch/parisc/include/asm/pgtable.h: remove unused `old_pte' Subsystem: vfs Jeff Layton <jlayton@redhat.com>: Patch series "vfs: have syncfs() return error when there are writeback: vfs: track per-sb writeback errors and report them to syncfs fs/buffer.c: record blockdev write errors in super_block that it backs Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: usercopy: mark dma-kmalloc caches as usercopy caches Subsystem: mm/slub Dongli Zhang <dongli.zhang@oracle.com>: mm/slub.c: fix corrupted freechain in deactivate_slab() Christoph Lameter <cl@linux.com>: slub: Remove userspace notifier for cache add/remove Christopher Lameter <cl@linux.com>: slub: remove kmalloc under list_lock from list_slab_objects() V2 Qian Cai <cai@lca.pw>: mm/slub: fix stack overruns with SLUB_STATS Andrew Morton <akpm@linux-foundation.org>: Documentation/vm/slub.rst: s/Toggle/Enable/ Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm, dump_page(): do not crash with invalid mapping pointer Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Change readahead API", v11: mm: move readahead prototypes from mm.h mm: return void from various readahead functions mm: ignore return value of ->readpages mm: move readahead nr_pages check into read_pages mm: add new readahead_control API mm: use readahead_control to pass arguments mm: rename various 'offset' parameters to 'index' mm: rename readahead loop variable to 'i' mm: remove 'page_offset' from readahead loop mm: put readahead pages in cache earlier mm: add readahead address space operation mm: move end_index check out of readahead loop mm: add page_cache_readahead_unbounded mm: document why we don't set PageReadahead mm: use memalloc_nofs_save in readahead path fs: convert mpage_readpages to mpage_readahead btrfs: convert from readpages to readahead erofs: convert uncompressed files from readpages to readahead erofs: convert compressed files from readpages to readahead ext4: convert from readpages to readahead ext4: pass the inode to ext4_mpage_readpages f2fs: convert from readpages to readahead f2fs: pass the inode to f2fs_mpage_readpages fuse: convert from readpages to readahead iomap: convert from readpages to readahead Guoqing Jiang <guoqing.jiang@cloud.ionos.com>: Patch series "Introduce attach/detach_page_private to cleanup code": include/linux/pagemap.h: introduce attach/detach_page_private md: remove __clear_page_buffers and use attach/detach_page_private btrfs: use attach/detach_page_private fs/buffer.c: use attach/detach_page_private f2fs: use attach/detach_page_private iomap: use attach/detach_page_private ntfs: replace attach_page_buffers with attach_page_private orangefs: use attach/detach_page_private buffer_head.h: remove attach_page_buffers mm/migrate.c: call detach_page_private to cleanup code mm_types.h: change set_page_private to inline function "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove misleading comment Chao Yu <yuchao0@huawei.com>: mm/page-writeback.c: remove unused variable NeilBrown <neilb@suse.de>: mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: update the documentation John Hubbard <jhubbard@nvidia.com>: mm/gup: introduce pin_user_pages_unlocked ivtv: convert get_user_pages() --> pin_user_pages() Miles Chen <miles.chen@mediatek.com>: mm/gup.c: further document vma_permits_fault() Subsystem: mm/swap chenqiwu <chenqiwu@xiaomi.com>: mm/swapfile: use list_{prev,next}_entry() instead of open-coding Qian Cai <cai@lca.pw>: mm/swap_state: fix a data race in swapin_nr_pages Andrea Righi <andrea.righi@canonical.com>: mm: swap: properly update readahead statistics in unuse_pte_range() Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: offset is only used when there is more slots mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive mm/swapfile.c: remove the unnecessary goto for SSD case mm/swapfile.c: simplify the calculation of n_goal mm/swapfile.c: remove the extra check in scan_swap_map_slots() mm/swapfile.c: found_free could be represented by (tmp < max) mm/swapfile.c: tmp is always smaller than max mm/swapfile.c: omit a duplicate code by compare tmp and max first Huang Ying <ying.huang@intel.com>: swap: try to scan more free slots even when fragmented Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable mm/swapfile.c: __swap_entry_free() always free 1 entry Huang Ying <ying.huang@intel.com>: mm/swapfile.c: use prandom_u32_max() swap: reduce lock contention on swap cache from swap slots allocation Randy Dunlap <rdunlap@infradead.org>: mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment Miaohe Lin <linmiaohe@huawei.com>: include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: add workingset_restore in memory.stat Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: simplify value comparison between count and limit Shakeel Butt <shakeelb@google.com>: memcg: expose root cgroup's memory.stat Jakub Kicinski <kuba@kernel.org>: Patch series "memcg: Slow down swap allocation as the available space gets: mm/memcg: prepare for swap over-high accounting and penalty calculation mm/memcg: move penalty delay clamping out of calculate_high_delay() mm/memcg: move cgroup high memory limit setting into struct page_counter mm/memcg: automatically penalize tasks with high swap use Zefan Li <lizefan@huawei.com>: memcg: fix memcg_kmem_bypass() for remote memcg charging Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Fix W+X debug feature on x86": x86: mm: ptdump: calculate effective permissions correctly mm: ptdump: expand type of 'val' in note_page() Huang Ying <ying.huang@intel.com>: /proc/PID/smaps: Add PMD migration entry parsing chenqiwu <chenqiwu@xiaomi.com>: mm/memory: remove unnecessary pte_devmap case in copy_one_pte() Subsystem: mm/memory-failure Wetp Zhang <wetp.zy@linux.alibaba.com>: mm, memory_failure: don't send BUS_MCEERR_AO for action required error Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "decruft the vmalloc API", v2: x86/hyperv: use vmalloc_exec for the hypercall page x86: fix vmap arguments in map_irq_stack staging: android: ion: use vmap instead of vm_map_ram staging: media: ipu3: use vmap instead of reimplementing it dma-mapping: use vmap insted of reimplementing it powerpc: add an ioremap_phb helper powerpc: remove __ioremap_at and __iounmap_at mm: remove __get_vm_area mm: unexport unmap_kernel_range_noflush mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING mm: only allow page table mappings for built-in zsmalloc mm: pass addr as unsigned long to vb_free mm: remove vmap_page_range_noflush and vunmap_page_range mm: rename vmap_page_range to map_kernel_range mm: don't return the number of pages from map_kernel_range{,_noflush} mm: remove map_vm_range mm: remove unmap_vmap_area mm: remove the prot argument from vm_map_ram mm: enforce that vmap can't map pages executable gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc mm: remove the pgprot argument to __vmalloc mm: remove the prot argument to __vmalloc_node mm: remove both instances of __vmalloc_node_flags mm: remove __vmalloc_node_flags_caller mm: switch the test_vmalloc module to use __vmalloc_node mm: remove vmalloc_user_node_flags arm64: use __vmalloc_node in arch_alloc_vmap_stack powerpc: use __vmalloc_node in alloc_vm_stack s390: use __vmalloc_node in stack_alloc Joerg Roedel <jroedel@suse.de>: Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3: mm: add functions to track page directory modifications mm/vmalloc: track which page-table levels were modified mm/ioremap: track which page-table levels were modified x86/mm/64: implement arch_sync_kernel_mappings() x86/mm/32: implement arch_sync_kernel_mappings() mm: remove vmalloc_sync_(un)mappings() x86/mm: remove vmalloc faulting Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix clang compilation warning due to stack protector Kees Cook <keescook@chromium.org>: ubsan: entirely disable alignment checks under UBSAN_TRAP Jing Xia <jing.xia@unisoc.com>: mm/mm_init.c: report kasan-tag information stored in page->flags Andrey Konovalov <andreyknvl@google.com>: kasan: move kasan_report() into report.c Documentation/admin-guide/cgroup-v2.rst | 24 + Documentation/core-api/cachetlb.rst | 2 Documentation/filesystems/locking.rst | 6 Documentation/filesystems/proc.rst | 4 Documentation/filesystems/vfs.rst | 15 Documentation/vm/slub.rst | 2 arch/arm/configs/omap2plus_defconfig | 2 arch/arm64/include/asm/pgtable.h | 3 arch/arm64/include/asm/vmap_stack.h | 6 arch/arm64/mm/dump.c | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/io.h | 10 arch/powerpc/include/asm/pci-bridge.h | 2 arch/powerpc/kernel/irq.c | 5 arch/powerpc/kernel/isa-bridge.c | 28 + arch/powerpc/kernel/pci_64.c | 56 +- arch/powerpc/mm/ioremap_64.c | 50 -- arch/riscv/include/asm/pgtable.h | 4 arch/riscv/mm/ptdump.c | 2 arch/s390/kernel/setup.c | 9 arch/sh/kernel/cpu/sh4/sq.c | 3 arch/x86/hyperv/hv_init.c | 5 arch/x86/include/asm/kvm_host.h | 3 arch/x86/include/asm/pgtable-2level_types.h | 2 arch/x86/include/asm/pgtable-3level_types.h | 2 arch/x86/include/asm/pgtable_64_types.h | 2 arch/x86/include/asm/pgtable_types.h | 8 arch/x86/include/asm/switch_to.h | 23 - arch/x86/kernel/irq_64.c | 2 arch/x86/kernel/setup_percpu.c | 6 arch/x86/kvm/svm/sev.c | 3 arch/x86/mm/dump_pagetables.c | 35 + arch/x86/mm/fault.c | 196 ---------- arch/x86/mm/init_64.c | 5 arch/x86/mm/pti.c | 8 arch/x86/mm/tlb.c | 37 - block/blk-core.c | 1 drivers/acpi/apei/ghes.c | 6 drivers/base/node.c | 2 drivers/block/drbd/drbd_bitmap.c | 4 drivers/block/loop.c | 2 drivers/dax/device.c | 1 drivers/gpu/drm/drm_scatter.c | 11 drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2 drivers/lightnvm/pblk-init.c | 5 drivers/md/dm-bufio.c | 4 drivers/md/md-bitmap.c | 12 drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3 drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3 drivers/media/pci/ivtv/ivtv-udma.c | 19 - drivers/media/pci/ivtv/ivtv-yuv.c | 17 drivers/media/pci/ivtv/ivtvfb.c | 4 drivers/mtd/ubi/io.c | 4 drivers/pcmcia/electra_cf.c | 45 -- drivers/scsi/sd_zbc.c | 3 drivers/staging/android/ion/ion_heap.c | 4 drivers/staging/media/ipu3/ipu3-css-pool.h | 4 drivers/staging/media/ipu3/ipu3-dmamap.c | 30 - fs/block_dev.c | 7 fs/btrfs/disk-io.c | 4 fs/btrfs/extent_io.c | 64 --- fs/btrfs/extent_io.h | 3 fs/btrfs/inode.c | 39 -- fs/buffer.c | 23 - fs/erofs/data.c | 41 -- fs/erofs/decompressor.c | 2 fs/erofs/zdata.c | 31 - fs/exfat/inode.c | 7 fs/ext2/inode.c | 10 fs/ext4/ext4.h | 5 fs/ext4/inode.c | 25 - fs/ext4/readpage.c | 25 - fs/ext4/verity.c | 35 - fs/f2fs/data.c | 56 +- fs/f2fs/f2fs.h | 14 fs/f2fs/verity.c | 35 - fs/fat/inode.c | 7 fs/file_table.c | 1 fs/fs-writeback.c | 1 fs/fuse/file.c | 100 +---- fs/gfs2/aops.c | 23 - fs/gfs2/dir.c | 9 fs/gfs2/quota.c | 2 fs/hpfs/file.c | 7 fs/iomap/buffered-io.c | 113 +---- fs/iomap/trace.h | 2 fs/isofs/inode.c | 7 fs/jfs/inode.c | 7 fs/mpage.c | 38 -- fs/nfs/blocklayout/extent_tree.c | 2 fs/nfs/internal.h | 10 fs/nfs/write.c | 4 fs/nfsd/vfs.c | 9 fs/nilfs2/inode.c | 15 fs/ntfs/aops.c | 2 fs/ntfs/malloc.h | 2 fs/ntfs/mft.c | 2 fs/ocfs2/aops.c | 34 - fs/ocfs2/dlm/dlmmaster.c | 1 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/slot_map.c | 46 +- fs/ocfs2/super.c | 21 + fs/omfs/file.c | 7 fs/open.c | 3 fs/orangefs/inode.c | 32 - fs/proc/meminfo.c | 3 fs/proc/task_mmu.c | 16 fs/qnx6/inode.c | 7 fs/reiserfs/inode.c | 8 fs/squashfs/block.c | 273 +++++++------- fs/squashfs/decompressor.h | 5 fs/squashfs/decompressor_multi.c | 9 fs/squashfs/decompressor_multi_percpu.c | 17 fs/squashfs/decompressor_single.c | 9 fs/squashfs/lz4_wrapper.c | 17 fs/squashfs/lzo_wrapper.c | 17 fs/squashfs/squashfs.h | 4 fs/squashfs/xz_wrapper.c | 51 +- fs/squashfs/zlib_wrapper.c | 63 +-- fs/squashfs/zstd_wrapper.c | 62 +-- fs/sync.c | 6 fs/ubifs/debug.c | 2 fs/ubifs/lprops.c | 2 fs/ubifs/lpt_commit.c | 4 fs/ubifs/orphan.c | 2 fs/udf/inode.c | 7 fs/xfs/kmem.c | 2 fs/xfs/xfs_aops.c | 13 fs/xfs/xfs_buf.c | 2 fs/zonefs/super.c | 7 include/asm-generic/5level-fixup.h | 5 include/asm-generic/pgtable.h | 27 + include/linux/buffer_head.h | 8 include/linux/fs.h | 18 include/linux/iomap.h | 3 include/linux/memcontrol.h | 4 include/linux/mm.h | 67 ++- include/linux/mm_types.h | 6 include/linux/mmzone.h | 1 include/linux/mpage.h | 4 include/linux/page_counter.h | 8 include/linux/pagemap.h | 193 ++++++++++ include/linux/ptdump.h | 3 include/linux/sched.h | 3 include/linux/swap.h | 17 include/linux/vmalloc.h | 49 +- include/linux/zsmalloc.h | 2 include/trace/events/erofs.h | 6 include/trace/events/f2fs.h | 6 include/trace/events/writeback.h | 5 kernel/bpf/core.c | 6 kernel/bpf/syscall.c | 29 - kernel/dma/remap.c | 48 -- kernel/groups.c | 2 kernel/module.c | 3 kernel/notifier.c | 1 kernel/sys.c | 2 kernel/trace/trace.c | 12 lib/Kconfig.ubsan | 2 lib/ioremap.c | 46 +- lib/test_vmalloc.c | 26 - mm/Kconfig | 4 mm/debug.c | 56 ++ mm/fadvise.c | 6 mm/filemap.c | 1 mm/gup.c | 77 +++- mm/internal.h | 14 mm/kasan/Makefile | 21 - mm/kasan/common.c | 19 - mm/kasan/report.c | 22 + mm/memcontrol.c | 198 +++++++--- mm/memory-failure.c | 15 mm/memory.c | 2 mm/migrate.c | 9 mm/mm_init.c | 16 mm/nommu.c | 52 +- mm/page-writeback.c | 62 ++- mm/page_alloc.c | 7 mm/percpu.c | 2 mm/ptdump.c | 17 mm/readahead.c | 349 ++++++++++-------- mm/slab_common.c | 3 mm/slub.c | 67 ++- mm/swap_state.c | 5 mm/swapfile.c | 194 ++++++---- mm/util.c | 2 mm/vmalloc.c | 399 ++++++++------------- mm/vmscan.c | 4 mm/vmstat.c | 11 mm/zsmalloc.c | 12 net/bridge/netfilter/ebtables.c | 6 net/ceph/ceph_common.c | 3 sound/core/memalloc.c | 2 sound/core/pcm_memory.c | 2 195 files changed, 2292 insertions(+), 2288 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-06-02 4:44 Andrew Morton 2020-06-02 20:08 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-06-02 4:44 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A few little subsystems and a start of a lot of MM patches. 128 patches, based on 9bf9511e3d9f328c03f6f79bfb741c3d18f2f2c0: Subsystems affected by this patch series: squashfs ocfs2 parisc vfs mm/slab-generic mm/slub mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memory-failure mm/vmalloc mm/kasan Subsystem: squashfs Philippe Liard <pliard@google.com>: squashfs: migrate from ll_rw_block usage to BIO Subsystem: ocfs2 Jules Irenge <jbi.octave@gmail.com>: ocfs2: add missing annotation for dlm_empty_lockres() Gang He <ghe@suse.com>: ocfs2: mount shared volume without ha stack Subsystem: parisc Andrew Morton <akpm@linux-foundation.org>: arch/parisc/include/asm/pgtable.h: remove unused `old_pte' Subsystem: vfs Jeff Layton <jlayton@redhat.com>: Patch series "vfs: have syncfs() return error when there are writeback: vfs: track per-sb writeback errors and report them to syncfs fs/buffer.c: record blockdev write errors in super_block that it backs Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: usercopy: mark dma-kmalloc caches as usercopy caches Subsystem: mm/slub Dongli Zhang <dongli.zhang@oracle.com>: mm/slub.c: fix corrupted freechain in deactivate_slab() Christoph Lameter <cl@linux.com>: slub: Remove userspace notifier for cache add/remove Christopher Lameter <cl@linux.com>: slub: remove kmalloc under list_lock from list_slab_objects() V2 Qian Cai <cai@lca.pw>: mm/slub: fix stack overruns with SLUB_STATS Andrew Morton <akpm@linux-foundation.org>: Documentation/vm/slub.rst: s/Toggle/Enable/ Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm, dump_page(): do not crash with invalid mapping pointer Subsystem: mm/pagecache "Matthew Wilcox (Oracle)" <willy@infradead.org>: Patch series "Change readahead API", v11: mm: move readahead prototypes from mm.h mm: return void from various readahead functions mm: ignore return value of ->readpages mm: move readahead nr_pages check into read_pages mm: add new readahead_control API mm: use readahead_control to pass arguments mm: rename various 'offset' parameters to 'index' mm: rename readahead loop variable to 'i' mm: remove 'page_offset' from readahead loop mm: put readahead pages in cache earlier mm: add readahead address space operation mm: move end_index check out of readahead loop mm: add page_cache_readahead_unbounded mm: document why we don't set PageReadahead mm: use memalloc_nofs_save in readahead path fs: convert mpage_readpages to mpage_readahead btrfs: convert from readpages to readahead erofs: convert uncompressed files from readpages to readahead erofs: convert compressed files from readpages to readahead ext4: convert from readpages to readahead ext4: pass the inode to ext4_mpage_readpages f2fs: convert from readpages to readahead f2fs: pass the inode to f2fs_mpage_readpages fuse: convert from readpages to readahead iomap: convert from readpages to readahead Guoqing Jiang <guoqing.jiang@cloud.ionos.com>: Patch series "Introduce attach/detach_page_private to cleanup code": include/linux/pagemap.h: introduce attach/detach_page_private md: remove __clear_page_buffers and use attach/detach_page_private btrfs: use attach/detach_page_private fs/buffer.c: use attach/detach_page_private f2fs: use attach/detach_page_private iomap: use attach/detach_page_private ntfs: replace attach_page_buffers with attach_page_private orangefs: use attach/detach_page_private buffer_head.h: remove attach_page_buffers mm/migrate.c: call detach_page_private to cleanup code mm_types.h: change set_page_private to inline function "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: remove misleading comment Chao Yu <yuchao0@huawei.com>: mm/page-writeback.c: remove unused variable NeilBrown <neilb@suse.de>: mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead Subsystem: mm/gup Souptick Joarder <jrdr.linux@gmail.com>: mm/gup.c: update the documentation John Hubbard <jhubbard@nvidia.com>: mm/gup: introduce pin_user_pages_unlocked ivtv: convert get_user_pages() --> pin_user_pages() Miles Chen <miles.chen@mediatek.com>: mm/gup.c: further document vma_permits_fault() Subsystem: mm/swap chenqiwu <chenqiwu@xiaomi.com>: mm/swapfile: use list_{prev,next}_entry() instead of open-coding Qian Cai <cai@lca.pw>: mm/swap_state: fix a data race in swapin_nr_pages Andrea Righi <andrea.righi@canonical.com>: mm: swap: properly update readahead statistics in unuse_pte_range() Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: offset is only used when there is more slots mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive mm/swapfile.c: remove the unnecessary goto for SSD case mm/swapfile.c: simplify the calculation of n_goal mm/swapfile.c: remove the extra check in scan_swap_map_slots() mm/swapfile.c: found_free could be represented by (tmp < max) mm/swapfile.c: tmp is always smaller than max mm/swapfile.c: omit a duplicate code by compare tmp and max first Huang Ying <ying.huang@intel.com>: swap: try to scan more free slots even when fragmented Wei Yang <richard.weiyang@gmail.com>: mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable mm/swapfile.c: __swap_entry_free() always free 1 entry Huang Ying <ying.huang@intel.com>: mm/swapfile.c: use prandom_u32_max() swap: reduce lock contention on swap cache from swap slots allocation Randy Dunlap <rdunlap@infradead.org>: mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment Miaohe Lin <linmiaohe@huawei.com>: include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: add workingset_restore in memory.stat Kaixu Xia <kaixuxia@tencent.com>: mm: memcontrol: simplify value comparison between count and limit Shakeel Butt <shakeelb@google.com>: memcg: expose root cgroup's memory.stat Jakub Kicinski <kuba@kernel.org>: Patch series "memcg: Slow down swap allocation as the available space gets: mm/memcg: prepare for swap over-high accounting and penalty calculation mm/memcg: move penalty delay clamping out of calculate_high_delay() mm/memcg: move cgroup high memory limit setting into struct page_counter mm/memcg: automatically penalize tasks with high swap use Zefan Li <lizefan@huawei.com>: memcg: fix memcg_kmem_bypass() for remote memcg charging Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Fix W+X debug feature on x86": x86: mm: ptdump: calculate effective permissions correctly mm: ptdump: expand type of 'val' in note_page() Huang Ying <ying.huang@intel.com>: /proc/PID/smaps: Add PMD migration entry parsing chenqiwu <chenqiwu@xiaomi.com>: mm/memory: remove unnecessary pte_devmap case in copy_one_pte() Subsystem: mm/memory-failure Wetp Zhang <wetp.zy@linux.alibaba.com>: mm, memory_failure: don't send BUS_MCEERR_AO for action required error Subsystem: mm/vmalloc Christoph Hellwig <hch@lst.de>: Patch series "decruft the vmalloc API", v2: x86/hyperv: use vmalloc_exec for the hypercall page x86: fix vmap arguments in map_irq_stack staging: android: ion: use vmap instead of vm_map_ram staging: media: ipu3: use vmap instead of reimplementing it dma-mapping: use vmap insted of reimplementing it powerpc: add an ioremap_phb helper powerpc: remove __ioremap_at and __iounmap_at mm: remove __get_vm_area mm: unexport unmap_kernel_range_noflush mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING mm: only allow page table mappings for built-in zsmalloc mm: pass addr as unsigned long to vb_free mm: remove vmap_page_range_noflush and vunmap_page_range mm: rename vmap_page_range to map_kernel_range mm: don't return the number of pages from map_kernel_range{,_noflush} mm: remove map_vm_range mm: remove unmap_vmap_area mm: remove the prot argument from vm_map_ram mm: enforce that vmap can't map pages executable gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc mm: remove the pgprot argument to __vmalloc mm: remove the prot argument to __vmalloc_node mm: remove both instances of __vmalloc_node_flags mm: remove __vmalloc_node_flags_caller mm: switch the test_vmalloc module to use __vmalloc_node mm: remove vmalloc_user_node_flags arm64: use __vmalloc_node in arch_alloc_vmap_stack powerpc: use __vmalloc_node in alloc_vm_stack s390: use __vmalloc_node in stack_alloc Joerg Roedel <jroedel@suse.de>: Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3: mm: add functions to track page directory modifications mm/vmalloc: track which page-table levels were modified mm/ioremap: track which page-table levels were modified x86/mm/64: implement arch_sync_kernel_mappings() x86/mm/32: implement arch_sync_kernel_mappings() mm: remove vmalloc_sync_(un)mappings() x86/mm: remove vmalloc faulting Subsystem: mm/kasan Andrey Konovalov <andreyknvl@google.com>: kasan: fix clang compilation warning due to stack protector Kees Cook <keescook@chromium.org>: ubsan: entirely disable alignment checks under UBSAN_TRAP Jing Xia <jing.xia@unisoc.com>: mm/mm_init.c: report kasan-tag information stored in page->flags Andrey Konovalov <andreyknvl@google.com>: kasan: move kasan_report() into report.c Documentation/admin-guide/cgroup-v2.rst | 24 + Documentation/core-api/cachetlb.rst | 2 Documentation/filesystems/locking.rst | 6 Documentation/filesystems/proc.rst | 4 Documentation/filesystems/vfs.rst | 15 Documentation/vm/slub.rst | 2 arch/arm/configs/omap2plus_defconfig | 2 arch/arm64/include/asm/pgtable.h | 3 arch/arm64/include/asm/vmap_stack.h | 6 arch/arm64/mm/dump.c | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/io.h | 10 arch/powerpc/include/asm/pci-bridge.h | 2 arch/powerpc/kernel/irq.c | 5 arch/powerpc/kernel/isa-bridge.c | 28 + arch/powerpc/kernel/pci_64.c | 56 +- arch/powerpc/mm/ioremap_64.c | 50 -- arch/riscv/include/asm/pgtable.h | 4 arch/riscv/mm/ptdump.c | 2 arch/s390/kernel/setup.c | 9 arch/sh/kernel/cpu/sh4/sq.c | 3 arch/x86/hyperv/hv_init.c | 5 arch/x86/include/asm/kvm_host.h | 3 arch/x86/include/asm/pgtable-2level_types.h | 2 arch/x86/include/asm/pgtable-3level_types.h | 2 arch/x86/include/asm/pgtable_64_types.h | 2 arch/x86/include/asm/pgtable_types.h | 8 arch/x86/include/asm/switch_to.h | 23 - arch/x86/kernel/irq_64.c | 2 arch/x86/kernel/setup_percpu.c | 6 arch/x86/kvm/svm/sev.c | 3 arch/x86/mm/dump_pagetables.c | 35 + arch/x86/mm/fault.c | 196 ---------- arch/x86/mm/init_64.c | 5 arch/x86/mm/pti.c | 8 arch/x86/mm/tlb.c | 37 - block/blk-core.c | 1 drivers/acpi/apei/ghes.c | 6 drivers/base/node.c | 2 drivers/block/drbd/drbd_bitmap.c | 4 drivers/block/loop.c | 2 drivers/dax/device.c | 1 drivers/gpu/drm/drm_scatter.c | 11 drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4 drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2 drivers/lightnvm/pblk-init.c | 5 drivers/md/dm-bufio.c | 4 drivers/md/md-bitmap.c | 12 drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3 drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3 drivers/media/pci/ivtv/ivtv-udma.c | 19 - drivers/media/pci/ivtv/ivtv-yuv.c | 17 drivers/media/pci/ivtv/ivtvfb.c | 4 drivers/mtd/ubi/io.c | 4 drivers/pcmcia/electra_cf.c | 45 -- drivers/scsi/sd_zbc.c | 3 drivers/staging/android/ion/ion_heap.c | 4 drivers/staging/media/ipu3/ipu3-css-pool.h | 4 drivers/staging/media/ipu3/ipu3-dmamap.c | 30 - fs/block_dev.c | 7 fs/btrfs/disk-io.c | 4 fs/btrfs/extent_io.c | 64 --- fs/btrfs/extent_io.h | 3 fs/btrfs/inode.c | 39 -- fs/buffer.c | 23 - fs/erofs/data.c | 41 -- fs/erofs/decompressor.c | 2 fs/erofs/zdata.c | 31 - fs/exfat/inode.c | 7 fs/ext2/inode.c | 10 fs/ext4/ext4.h | 5 fs/ext4/inode.c | 25 - fs/ext4/readpage.c | 25 - fs/ext4/verity.c | 35 - fs/f2fs/data.c | 56 +- fs/f2fs/f2fs.h | 14 fs/f2fs/verity.c | 35 - fs/fat/inode.c | 7 fs/file_table.c | 1 fs/fs-writeback.c | 1 fs/fuse/file.c | 100 +---- fs/gfs2/aops.c | 23 - fs/gfs2/dir.c | 9 fs/gfs2/quota.c | 2 fs/hpfs/file.c | 7 fs/iomap/buffered-io.c | 113 +---- fs/iomap/trace.h | 2 fs/isofs/inode.c | 7 fs/jfs/inode.c | 7 fs/mpage.c | 38 -- fs/nfs/blocklayout/extent_tree.c | 2 fs/nfs/internal.h | 10 fs/nfs/write.c | 4 fs/nfsd/vfs.c | 9 fs/nilfs2/inode.c | 15 fs/ntfs/aops.c | 2 fs/ntfs/malloc.h | 2 fs/ntfs/mft.c | 2 fs/ocfs2/aops.c | 34 - fs/ocfs2/dlm/dlmmaster.c | 1 fs/ocfs2/ocfs2.h | 4 fs/ocfs2/slot_map.c | 46 +- fs/ocfs2/super.c | 21 + fs/omfs/file.c | 7 fs/open.c | 3 fs/orangefs/inode.c | 32 - fs/proc/meminfo.c | 3 fs/proc/task_mmu.c | 16 fs/qnx6/inode.c | 7 fs/reiserfs/inode.c | 8 fs/squashfs/block.c | 273 +++++++------- fs/squashfs/decompressor.h | 5 fs/squashfs/decompressor_multi.c | 9 fs/squashfs/decompressor_multi_percpu.c | 17 fs/squashfs/decompressor_single.c | 9 fs/squashfs/lz4_wrapper.c | 17 fs/squashfs/lzo_wrapper.c | 17 fs/squashfs/squashfs.h | 4 fs/squashfs/xz_wrapper.c | 51 +- fs/squashfs/zlib_wrapper.c | 63 +-- fs/squashfs/zstd_wrapper.c | 62 +-- fs/sync.c | 6 fs/ubifs/debug.c | 2 fs/ubifs/lprops.c | 2 fs/ubifs/lpt_commit.c | 4 fs/ubifs/orphan.c | 2 fs/udf/inode.c | 7 fs/xfs/kmem.c | 2 fs/xfs/xfs_aops.c | 13 fs/xfs/xfs_buf.c | 2 fs/zonefs/super.c | 7 include/asm-generic/5level-fixup.h | 5 include/asm-generic/pgtable.h | 27 + include/linux/buffer_head.h | 8 include/linux/fs.h | 18 include/linux/iomap.h | 3 include/linux/memcontrol.h | 4 include/linux/mm.h | 67 ++- include/linux/mm_types.h | 6 include/linux/mmzone.h | 1 include/linux/mpage.h | 4 include/linux/page_counter.h | 8 include/linux/pagemap.h | 193 ++++++++++ include/linux/ptdump.h | 3 include/linux/sched.h | 3 include/linux/swap.h | 17 include/linux/vmalloc.h | 49 +- include/linux/zsmalloc.h | 2 include/trace/events/erofs.h | 6 include/trace/events/f2fs.h | 6 include/trace/events/writeback.h | 5 kernel/bpf/core.c | 6 kernel/bpf/syscall.c | 29 - kernel/dma/remap.c | 48 -- kernel/groups.c | 2 kernel/module.c | 3 kernel/notifier.c | 1 kernel/sys.c | 2 kernel/trace/trace.c | 12 lib/Kconfig.ubsan | 2 lib/ioremap.c | 46 +- lib/test_vmalloc.c | 26 - mm/Kconfig | 4 mm/debug.c | 56 ++ mm/fadvise.c | 6 mm/filemap.c | 1 mm/gup.c | 77 +++- mm/internal.h | 14 mm/kasan/Makefile | 21 - mm/kasan/common.c | 19 - mm/kasan/report.c | 22 + mm/memcontrol.c | 198 +++++++--- mm/memory-failure.c | 15 mm/memory.c | 2 mm/migrate.c | 9 mm/mm_init.c | 16 mm/nommu.c | 52 +- mm/page-writeback.c | 62 ++- mm/page_alloc.c | 7 mm/percpu.c | 2 mm/ptdump.c | 17 mm/readahead.c | 349 ++++++++++-------- mm/slab_common.c | 3 mm/slub.c | 67 ++- mm/swap_state.c | 5 mm/swapfile.c | 194 ++++++---- mm/util.c | 2 mm/vmalloc.c | 399 ++++++++------------- mm/vmscan.c | 4 mm/vmstat.c | 11 mm/zsmalloc.c | 12 net/bridge/netfilter/ebtables.c | 6 net/ceph/ceph_common.c | 3 sound/core/memalloc.c | 2 sound/core/pcm_memory.c | 2 195 files changed, 2292 insertions(+), 2288 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-02 4:44 incoming Andrew Morton @ 2020-06-02 20:08 ` Andrew Morton 2020-06-02 20:45 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-06-02 20:08 UTC (permalink / raw) To: Linus Torvalds, mm-commits, linux-mm The local_lock merge made rather a mess of all of this. I'm cooking up a full resend of the same material. ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-02 20:08 ` incoming Andrew Morton @ 2020-06-02 20:45 ` Linus Torvalds 2020-06-02 21:38 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2020-06-02 20:45 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > The local_lock merge made rather a mess of all of this. I'm > cooking up a full resend of the same material. Hmm. I have no issues with conflicts, and already took your previous series. I've pushed it out now - does my tree match what you expect? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-02 20:45 ` incoming Linus Torvalds @ 2020-06-02 21:38 ` Andrew Morton 2020-06-02 22:18 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-06-02 21:38 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > The local_lock merge made rather a mess of all of this. I'm > > cooking up a full resend of the same material. > > Hmm. I have no issues with conflicts, and already took your previous series. Well that's odd. > I've pushed it out now - does my tree match what you expect? Yup, thanks. ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-06-02 21:38 ` incoming Andrew Morton @ 2020-06-02 22:18 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2020-06-02 22:18 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Jun 2, 2020 at 2:38 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > > Hmm. I have no issues with conflicts, and already took your previous series. > > Well that's odd. I meant "I saw the conflicts and had no issue with them". Nothing odd. And I actually much prefer seeing conflicts from your series (against other pulls I've done) over having you delay your patch bombs because of any fear for them. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-05-28 5:20 Andrew Morton 2020-05-28 20:10 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-05-28 5:20 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 fixes, based on 444fc5cde64330661bf59944c43844e7d4c2ccd8: Qian Cai <cai@lca.pw>: mm/z3fold: silence kmemleak false positives of slots Hugh Dickins <hughd@google.com>: mm,thp: stop leaking unreleased file pages Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm: remove VM_BUG_ON(PageSlab()) from page_mapcount() Alexander Potapenko <glider@google.com>: fs/binfmt_elf.c: allocate initialized memory in fill_thread_core_info() Arnd Bergmann <arnd@arndb.de>: include/asm-generic/topology.h: guard cpumask_of_node() macro argument fs/binfmt_elf.c | 2 +- include/asm-generic/topology.h | 2 +- include/linux/mm.h | 19 +++++++++++++++---- mm/khugepaged.c | 1 + mm/z3fold.c | 3 +++ 5 files changed, 21 insertions(+), 6 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-05-28 5:20 incoming Andrew Morton @ 2020-05-28 20:10 ` Linus Torvalds 2020-05-29 20:31 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2020-05-28 20:10 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM Hmm.. On Wed, May 27, 2020 at 10:20 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > fs/binfmt_elf.c | 2 +- > include/asm-generic/topology.h | 2 +- > include/linux/mm.h | 19 +++++++++++++++---- > mm/khugepaged.c | 1 + > mm/z3fold.c | 3 +++ > 5 files changed, 21 insertions(+), 6 deletions(-) I wonder how you generate that diffstat. The change to <linux/mm.h> simply doesn't match what you sent me. The patch you sent me that changed mm.h had this: include/linux/mm.h | 15 +++++++++++++-- 1 file changed, 13 insertions(+), 2 deletions(-) (note 15 lines changed: it's +13 and -2) but now suddenly in your overall diffstat you have that include/linux/mm.h | 19 +++++++++++++++---- with +15/-4. So your diffstat simply doesn't match what you are sending. What's going on? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-05-28 20:10 ` incoming Linus Torvalds @ 2020-05-29 20:31 ` Andrew Morton 2020-05-29 20:38 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-05-29 20:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Thu, 28 May 2020 13:10:18 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > Hmm.. > > On Wed, May 27, 2020 at 10:20 PM Andrew Morton > <akpm@linux-foundation.org> wrote: > > > > fs/binfmt_elf.c | 2 +- > > include/asm-generic/topology.h | 2 +- > > include/linux/mm.h | 19 +++++++++++++++---- > > mm/khugepaged.c | 1 + > > mm/z3fold.c | 3 +++ > > 5 files changed, 21 insertions(+), 6 deletions(-) > > I wonder how you generate that diffstat. > > The change to <linux/mm.h> simply doesn't match what you sent me. The > patch you sent me that changed mm.h had this: > > include/linux/mm.h | 15 +++++++++++++-- > 1 file changed, 13 insertions(+), 2 deletions(-) > > (note 15 lines changed: it's +13 and -2) but now suddenly in your > overall diffstat you have that > > include/linux/mm.h | 19 +++++++++++++++---- > > with +15/-4. > > So your diffstat simply doesn't match what you are sending. What's going on? > Bah. I got lazy (didn't want to interrupt an ongoing build) so I generated the diffstat prior to folding two patches into a single one. Evidently diffstat isn't as smart as I had assumed! ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-05-29 20:31 ` incoming Andrew Morton @ 2020-05-29 20:38 ` Linus Torvalds 2020-05-29 21:12 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2020-05-29 20:38 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Bah. I got lazy (didn't want to interrupt an ongoing build) so I > generated the diffstat prior to folding two patches into a single one. > Evidently diffstat isn't as smart as I had assumed! Ahh. Yes - given two patches, diffstat just adds up the line number counts for the individual diffs, it doesn't count some kind of "combined diff result" line counts. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-05-29 20:38 ` incoming Linus Torvalds @ 2020-05-29 21:12 ` Andrew Morton 2020-05-29 21:20 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-05-29 21:12 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Fri, 29 May 2020 13:38:35 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Bah. I got lazy (didn't want to interrupt an ongoing build) so I > > generated the diffstat prior to folding two patches into a single one. > > Evidently diffstat isn't as smart as I had assumed! > > Ahh. Yes - given two patches, diffstat just adds up the line number > counts for the individual diffs, it doesn't count some kind of > "combined diff result" line counts. Stupid diffstat. Means that basically all my diffstats are very wrong. Thanks for spotting it. I can fix that... ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-05-29 21:12 ` incoming Andrew Morton @ 2020-05-29 21:20 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2020-05-29 21:20 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Fri, May 29, 2020 at 2:12 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Stupid diffstat. Means that basically all my diffstats are very wrong. I'm actually used to diffstats not matching 100%/ Usually it's not due to this issue - a "git diff --stat" *will* give the stat from the actual combined diff result - but with git diffstats the issue is that I might have gotten a patch from another source. So the diffstat I see after-the-merge is possibly different from the pre-merge diffstat simply due to merge issues. So then I usually take a look at "ok, why did that diffstat differ" and go "Ahh". In your case, when I looked at the diffstat, I couldn't for the life of me see how you would have gotten the diffstat you did, since I only saw a single patch with no merge issues. > Thanks for spotting it. > > I can fix that... I can also just live with it, knowing what your workflow is. The diffstat matching exactly just isn't that important - in fact, different versions of "diff" can give slightly different output anyway depending on diff algorithms even when they are looking at the exact same before/after state. There's not necessarily always only one way to generate a valid diff. So to me, the diffstat is more of a guide than a hard thing, and I want to see the rough outline, In fact, one reason I want to see it in pull requests is actually just that I want to get a feel for what changes even before I do the pull or merge, so it's not just a "match against what I get" thing. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-05-23 5:22 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-05-23 5:22 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 444565650a5fe9c63ddf153e6198e31705dedeb2: David Hildenbrand <david@redhat.com>: device-dax: don't leak kernel memory to user space after unloading kmem Nick Desaulniers <ndesaulniers@google.com>: x86: bitops: fix build regression John Hubbard <jhubbard@nvidia.com>: rapidio: fix an error in get_user_pages_fast() error handling selftests/vm/.gitignore: add mremap_dontunmap selftests/vm/write_to_hugetlbfs.c: fix unused variable warning Marco Elver <elver@google.com>: kasan: disable branch tracing for core runtime Arnd Bergmann <arnd@arndb.de>: sh: include linux/time_types.h for sockios Naoya Horiguchi <n-horiguchi@ah.jp.nec.com>: MAINTAINERS: update email address for Naoya Horiguchi Mike Rapoport <rppt@linux.ibm.com>: sparc32: use PUD rather than PGD to get PMD in srmmu_nocache_init() Uladzislau Rezki <uladzislau.rezki@sony.com>: z3fold: fix use-after-free when freeing handles Baoquan He <bhe@redhat.com>: MAINTAINERS: add files related to kdump MAINTAINERS | 7 ++++++- arch/sh/include/uapi/asm/sockios.h | 2 ++ arch/sparc/mm/srmmu.c | 2 +- arch/x86/include/asm/bitops.h | 12 ++++++------ drivers/dax/kmem.c | 14 +++++++++++--- drivers/rapidio/devices/rio_mport_cdev.c | 5 +++++ mm/kasan/Makefile | 16 ++++++++-------- mm/kasan/generic.c | 1 - mm/kasan/tags.c | 1 - mm/z3fold.c | 11 ++++++----- tools/testing/selftests/vm/.gitignore | 1 + tools/testing/selftests/vm/write_to_hugetlbfs.c | 2 -- 12 files changed, 46 insertions(+), 28 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-05-14 0:50 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-05-14 0:50 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 fixes, based on 24085f70a6e1b0cb647ec92623284641d8270637: Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix inconsistent oom event behavior Roman Penyaev <rpenyaev@suse.de>: epoll: call final ep_events_available() check under the lock Peter Xu <peterx@redhat.com>: mm/gup: fix fixup_user_fault() on multiple retries Brian Geffon <bgeffon@google.com>: userfaultfd: fix remap event with MREMAP_DONTUNMAP Vasily Averin <vvs@virtuozzo.com>: ipc/util.c: sysvipc_find_ipc() incorrectly updates position index Andrey Konovalov <andreyknvl@google.com>: kasan: consistently disable debugging features kasan: add missing functions declarations to kasan.h fs/eventpoll.c | 48 ++++++++++++++++++++++++++------------------- include/linux/memcontrol.h | 2 + ipc/util.c | 12 +++++------ mm/gup.c | 12 ++++++----- mm/kasan/Makefile | 15 +++++++++----- mm/kasan/kasan.h | 34 ++++++++++++++++++++++++++++++- mm/mremap.c | 2 - 7 files changed, 86 insertions(+), 39 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-05-08 1:35 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-05-08 1:35 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 14 fixes and one selftest to verify the ipc fixes herein. 15 patches, based on a811c1fa0a02c062555b54651065899437bacdbe: Oleg Nesterov <oleg@redhat.com>: ipc/mqueue.c: change __do_notify() to bypass check_kill_permission() Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix error return value of mem_cgroup_css_alloc() David Hildenbrand <david@redhat.com>: mm/page_alloc: fix watchdog soft lockups during set_zone_contiguous() Maciej Grochowski <maciej.grochowski@pm.me>: kernel/kcov.c: fix typos in kcov_remote_start documentation Ivan Delalande <colona@arista.com>: scripts/decodecode: fix trapping instruction formatting Janakarajan Natarajan <Janakarajan.Natarajan@amd.com>: arch/x86/kvm/svm/sev.c: change flag passed to GUP fast in sev_pin_memory() Khazhismel Kumykov <khazhy@google.com>: eventpoll: fix missing wakeup for ovflist in ep_poll_callback Aymeric Agon-Rambosson <aymeric.agon@yandex.com>: scripts/gdb: repair rb_first() and rb_last() Waiman Long <longman@redhat.com>: mm/slub: fix incorrect interpretation of s->offset Filipe Manana <fdmanana@suse.com>: percpu: make pcpu_alloc() aware of current gfp context Roman Penyaev <rpenyaev@suse.de>: kselftests: introduce new epoll60 testcase for catching lost wakeups epoll: atomically remove wait entry on wake up Qiwu Chen <qiwuchen55@gmail.com>: mm/vmscan: remove unnecessary argument description of isolate_lru_pages() Kees Cook <keescook@chromium.org>: ubsan: disable UBSAN_ALIGNMENT under COMPILE_TEST Henry Willard <henry.willard@oracle.com>: mm: limit boost_watermark on small zones arch/x86/kvm/svm/sev.c | 2 fs/eventpoll.c | 61 ++-- ipc/mqueue.c | 34 +- kernel/kcov.c | 4 lib/Kconfig.ubsan | 15 - mm/memcontrol.c | 15 - mm/page_alloc.c | 9 mm/percpu.c | 14 mm/slub.c | 45 ++- mm/vmscan.c | 1 scripts/decodecode | 2 scripts/gdb/linux/rbtree.py | 4 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 146 ++++++++++ tools/testing/selftests/wireguard/qemu/debug.config | 1 14 files changed, 275 insertions(+), 78 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-04-21 1:13 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-04-21 1:13 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 15 fixes, based on ae83d0b416db002fe95601e7f97f64b59514d936: Masahiro Yamada <masahiroy@kernel.org>: sh: fix build error in mm/init.c Kees Cook <keescook@chromium.org>: slub: avoid redzone when choosing freepointer location Peter Xu <peterx@redhat.com>: mm/userfaultfd: disable userfaultfd-wp on x86_32 Bartosz Golaszewski <bgolaszewski@baylibre.com>: MAINTAINERS: add an entry for kfifo Longpeng <longpeng2@huawei.com>: mm/hugetlb: fix a addressing exception caused by huge_pte_offset Michal Hocko <mhocko@suse.com>: mm, gup: return EINTR when gup is interrupted by fatal signals Christophe JAILLET <christophe.jaillet@wanadoo.fr>: checkpatch: fix a typo in the regex for $allocFunctions George Burgess IV <gbiv@google.com>: tools/build: tweak unused value workaround Muchun Song <songmuchun@bytedance.com>: mm/ksm: fix NULL pointer dereference when KSM zero page is enabled Hugh Dickins <hughd@google.com>: mm/shmem: fix build without THP Jann Horn <jannh@google.com>: vmalloc: fix remap_vmalloc_range() bounds checks Hugh Dickins <hughd@google.com>: shmem: fix possible deadlocks on shmlock_user_lock Yang Shi <yang.shi@linux.alibaba.com>: mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path Sudip Mukherjee <sudipm.mukherjee@gmail.com>: coredump: fix null pointer dereference on coredump Lucas Stach <l.stach@pengutronix.de>: tools/vm: fix cross-compile build MAINTAINERS | 7 +++++++ arch/sh/mm/init.c | 2 +- arch/x86/Kconfig | 2 +- fs/coredump.c | 2 ++ fs/proc/vmcore.c | 5 +++-- include/linux/vmalloc.h | 2 +- mm/gup.c | 2 +- mm/hugetlb.c | 14 ++++++++------ mm/ksm.c | 12 ++++++++++-- mm/shmem.c | 13 ++++++++----- mm/slub.c | 12 ++++++++++-- mm/vmalloc.c | 16 +++++++++++++--- samples/vfio-mdev/mdpy.c | 2 +- scripts/checkpatch.pl | 2 +- tools/build/feature/test-sync-compare-and-swap.c | 2 +- tools/vm/Makefile | 2 ++ 16 files changed, 70 insertions(+), 27 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-04-12 7:41 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-04-12 7:41 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm A straggler. This patch caused a lot of build errors on a lot of architectures for a long time, but Anshuman believes it's all fixed up now. 1 patch, based on GIT b032227c62939b5481bcd45442b36dfa263f4a7c. Anshuman Khandual <anshuman.khandual@arm.com>: mm/debug: add tests validating architecture page table helpers Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34 arch/arc/Kconfig | 1 arch/arm64/Kconfig | 1 arch/powerpc/Kconfig | 1 arch/s390/Kconfig | 1 arch/x86/Kconfig | 1 arch/x86/include/asm/pgtable_64.h | 6 include/linux/mmdebug.h | 5 init/main.c | 2 lib/Kconfig.debug | 26 mm/Makefile | 1 mm/debug_vm_pgtable.c | 392 ++++++++++ 12 files changed, 471 insertions(+) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-04-10 21:30 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-04-10 21:30 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Almost all of the rest of MM. Various other things. 35 patches, based on c0cc271173b2e1c2d8d0ceaef14e4dfa79eefc0d. Subsystems affected by this patch series: hfs mm/memcg mm/slab-generic mm/slab mm/pagealloc mm/gup ocfs2 mm/hugetlb mm/pagemap mm/memremap kmod misc seqfile Subsystem: hfs Simon Gander <simon@tuxera.com>: hfsplus: fix crash and filesystem corruption when deleting files Subsystem: mm/memcg Jakub Kicinski <kuba@kernel.org>: mm, memcg: do not high throttle allocators based on wraparound Subsystem: mm/slab-generic Qiujun Huang <hqjagain@gmail.com>: mm, slab_common: fix a typo in comment "eariler"->"earlier" Subsystem: mm/slab Mauro Carvalho Chehab <mchehab+huawei@kernel.org>: docs: mm: slab.h: fix a broken cross-reference Subsystem: mm/pagealloc Randy Dunlap <rdunlap@infradead.org>: mm/page_alloc.c: fix kernel-doc warning Jason Yan <yanaijie@huawei.com>: mm/page_alloc: make pcpu_drain_mutex and pcpu_drain static Subsystem: mm/gup Miles Chen <miles.chen@mediatek.com>: mm/gup: fix null pointer dereference detected by coverity Subsystem: ocfs2 Changwei Ge <chge@linux.alibaba.com>: ocfs2: no need try to truncate file beyond i_size Subsystem: mm/hugetlb Aslan Bakirov <aslan@fb.com>: mm: cma: NUMA node interface Roman Gushchin <guro@fb.com>: mm: hugetlb: optionally allocate gigantic hugepages using cma Subsystem: mm/pagemap Jaewon Kim <jaewon31.kim@samsung.com>: mm/mmap.c: initialize align_offset explicitly for vm_unmapped_area Arjun Roy <arjunroy@google.com>: mm/memory.c: refactor insert_page to prepare for batched-lock insert mm: bring sparc pte_index() semantics inline with other platforms mm: define pte_index as macro for x86 mm/memory.c: add vm_insert_pages() Anshuman Khandual <anshuman.khandual@arm.com>: mm/vma: define a default value for VM_DATA_DEFAULT_FLAGS mm/vma: introduce VM_ACCESS_FLAGS mm/special: create generic fallbacks for pte_special() and pte_mkspecial() Subsystem: mm/memremap Logan Gunthorpe <logang@deltatee.com>: Patch series "Allow setting caching mode in arch_add_memory() for P2PDMA", v4: mm/memory_hotplug: drop the flags field from struct mhp_restrictions mm/memory_hotplug: rename mhp_restrictions to mhp_params x86/mm: thread pgprot_t through init_memory_mapping() x86/mm: introduce __set_memory_prot() powerpc/mm: thread pgprot_t through create_section_mapping() mm/memory_hotplug: add pgprot_t to mhp_params mm/memremap: set caching mode for PCI P2PDMA memory to WC Subsystem: kmod Eric Biggers <ebiggers@google.com>: Patch series "module autoloading fixes and cleanups", v5: kmod: make request_module() return an error when autoloading is disabled fs/filesystems.c: downgrade user-reachable WARN_ONCE() to pr_warn_once() docs: admin-guide: document the kernel.modprobe sysctl selftests: kmod: fix handling test numbers above 9 selftests: kmod: test disabling module autoloading Subsystem: misc Pali Rohár <pali@kernel.org>: change email address for Pali Rohár kbuild test robot <lkp@intel.com>: drivers/dma/tegra20-apb-dma.c: fix platform_get_irq.cocci warnings Subsystem: seqfile Vasily Averin <vvs@virtuozzo.com>: Patch series "seq_file .next functions should increase position index": fs/seq_file.c: seq_read(): add info message about buggy .next functions kernel/gcov/fs.c: gcov_seq_next() should increase position index ipc/util.c: sysvipc_find_ipc() should increase position index Documentation/ABI/testing/sysfs-platform-dell-laptop | 8 Documentation/admin-guide/kernel-parameters.txt | 8 Documentation/admin-guide/sysctl/kernel.rst | 21 ++ MAINTAINERS | 16 - arch/alpha/include/asm/page.h | 3 arch/alpha/include/asm/pgtable.h | 2 arch/arc/include/asm/page.h | 2 arch/arm/include/asm/page.h | 4 arch/arm/include/asm/pgtable-2level.h | 2 arch/arm/include/asm/pgtable.h | 15 - arch/arm/mach-omap2/omap-secure.c | 2 arch/arm/mach-omap2/omap-secure.h | 2 arch/arm/mach-omap2/omap-smc.S | 2 arch/arm/mm/fault.c | 2 arch/arm/mm/mmu.c | 14 + arch/arm64/include/asm/page.h | 4 arch/arm64/mm/fault.c | 2 arch/arm64/mm/init.c | 6 arch/arm64/mm/mmu.c | 7 arch/c6x/include/asm/page.h | 5 arch/csky/include/asm/page.h | 3 arch/csky/include/asm/pgtable.h | 3 arch/h8300/include/asm/page.h | 2 arch/hexagon/include/asm/page.h | 3 arch/hexagon/include/asm/pgtable.h | 2 arch/ia64/include/asm/page.h | 5 arch/ia64/include/asm/pgtable.h | 2 arch/ia64/mm/init.c | 7 arch/m68k/include/asm/mcf_pgtable.h | 10 - arch/m68k/include/asm/motorola_pgtable.h | 2 arch/m68k/include/asm/page.h | 3 arch/m68k/include/asm/sun3_pgtable.h | 2 arch/microblaze/include/asm/page.h | 2 arch/microblaze/include/asm/pgtable.h | 4 arch/mips/include/asm/page.h | 5 arch/mips/include/asm/pgtable.h | 44 +++- arch/nds32/include/asm/page.h | 3 arch/nds32/include/asm/pgtable.h | 9 - arch/nds32/mm/fault.c | 2 arch/nios2/include/asm/page.h | 3 arch/nios2/include/asm/pgtable.h | 3 arch/openrisc/include/asm/page.h | 5 arch/openrisc/include/asm/pgtable.h | 2 arch/parisc/include/asm/page.h | 3 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/book3s/64/hash.h | 3 arch/powerpc/include/asm/book3s/64/radix.h | 3 arch/powerpc/include/asm/page.h | 9 - arch/powerpc/include/asm/page_64.h | 7 arch/powerpc/include/asm/sparsemem.h | 3 arch/powerpc/mm/book3s64/hash_utils.c | 5 arch/powerpc/mm/book3s64/pgtable.c | 7 arch/powerpc/mm/book3s64/pkeys.c | 2 arch/powerpc/mm/book3s64/radix_pgtable.c | 18 +- arch/powerpc/mm/mem.c | 12 - arch/riscv/include/asm/page.h | 3 arch/s390/include/asm/page.h | 3 arch/s390/mm/fault.c | 2 arch/s390/mm/init.c | 9 - arch/sh/include/asm/page.h | 3 arch/sh/mm/init.c | 7 arch/sparc/include/asm/page_32.h | 3 arch/sparc/include/asm/page_64.h | 3 arch/sparc/include/asm/pgtable_32.h | 7 arch/sparc/include/asm/pgtable_64.h | 10 - arch/um/include/asm/pgtable.h | 10 - arch/unicore32/include/asm/page.h | 3 arch/unicore32/include/asm/pgtable.h | 3 arch/unicore32/mm/fault.c | 2 arch/x86/include/asm/page_types.h | 7 arch/x86/include/asm/pgtable.h | 6 arch/x86/include/asm/set_memory.h | 1 arch/x86/kernel/amd_gart_64.c | 3 arch/x86/kernel/setup.c | 4 arch/x86/mm/init.c | 9 - arch/x86/mm/init_32.c | 19 +- arch/x86/mm/init_64.c | 42 ++-- arch/x86/mm/mm_internal.h | 3 arch/x86/mm/pat/set_memory.c | 13 + arch/x86/mm/pkeys.c | 2 arch/x86/platform/uv/bios_uv.c | 3 arch/x86/um/asm/vm-flags.h | 10 - arch/xtensa/include/asm/page.h | 3 arch/xtensa/include/asm/pgtable.h | 3 drivers/char/hw_random/omap3-rom-rng.c | 4 drivers/dma/tegra20-apb-dma.c | 1 drivers/hwmon/dell-smm-hwmon.c | 4 drivers/platform/x86/dell-laptop.c | 4 drivers/platform/x86/dell-rbtn.c | 4 drivers/platform/x86/dell-rbtn.h | 2 drivers/platform/x86/dell-smbios-base.c | 4 drivers/platform/x86/dell-smbios-smm.c | 2 drivers/platform/x86/dell-smbios.h | 2 drivers/platform/x86/dell-smo8800.c | 2 drivers/platform/x86/dell-wmi.c | 4 drivers/power/supply/bq2415x_charger.c | 4 drivers/power/supply/bq27xxx_battery.c | 2 drivers/power/supply/isp1704_charger.c | 2 drivers/power/supply/rx51_battery.c | 4 drivers/staging/gasket/gasket_core.c | 2 fs/filesystems.c | 4 fs/hfsplus/attributes.c | 4 fs/ocfs2/alloc.c | 4 fs/seq_file.c | 7 fs/udf/ecma_167.h | 2 fs/udf/osta_udf.h | 2 include/linux/cma.h | 14 + include/linux/hugetlb.h | 12 + include/linux/memblock.h | 3 include/linux/memory_hotplug.h | 21 +- include/linux/mm.h | 34 +++ include/linux/power/bq2415x_charger.h | 2 include/linux/slab.h | 2 ipc/util.c | 2 kernel/gcov/fs.c | 2 kernel/kmod.c | 4 mm/cma.c | 16 + mm/gup.c | 3 mm/hugetlb.c | 109 ++++++++++++ mm/memblock.c | 2 mm/memcontrol.c | 3 mm/memory.c | 168 +++++++++++++++++-- mm/memory_hotplug.c | 13 - mm/memremap.c | 17 + mm/mmap.c | 4 mm/mprotect.c | 4 mm/page_alloc.c | 5 mm/slab_common.c | 2 tools/laptop/freefall/freefall.c | 2 tools/testing/selftests/kmod/kmod.sh | 43 ++++ 130 files changed, 710 insertions(+), 370 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-04-07 3:02 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-04-07 3:02 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - a lot more of MM, quite a bit more yet to come. - various other subsystems 166 patches based on 7e63420847ae5f1036e4f7c42f0b3282e73efbc2. Subsystems affected by this patch series: mm/memcg mm/pagemap mm/vmalloc mm/pagealloc mm/migration mm/thp mm/ksm mm/madvise mm/virtio mm/userfaultfd mm/memory-hotplug mm/shmem mm/rmap mm/zswap mm/zsmalloc mm/cleanups procfs misc MAINTAINERS bitops lib checkpatch epoll binfmt kallsyms reiserfs kmod gcov kconfig kcov ubsan fault-injection ipc Subsystem: mm/memcg Chris Down <chris@chrisdown.name>: mm, memcg: bypass high reclaim iteration for cgroup hierarchy root Subsystem: mm/pagemap Li Xinhai <lixinhai.lxh@gmail.com>: Patch series "mm: Fix misuse of parent anon_vma in dup_mmap path": mm: don't prepare anon_vma if vma has VM_WIPEONFORK Revert "mm/rmap.c: reuse mergeable anon_vma as parent when fork" mm: set vm_next and vm_prev to NULL in vm_area_dup() Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/vma: Use all available wrappers when possible", v2: mm/vma: add missing VMA flag readable name for VM_SYNC mm/vma: make vma_is_accessible() available for general use mm/vma: replace all remaining open encodings with is_vm_hugetlb_page() mm/vma: replace all remaining open encodings with vma_is_anonymous() mm/vma: append unlikely() while testing VMA access permissions Subsystem: mm/vmalloc Qiujun Huang <hqjagain@gmail.com>: mm/vmalloc: fix a typo in comment Subsystem: mm/pagealloc Michal Hocko <mhocko@suse.com>: mm: make it clear that gfp reclaim modifiers are valid only for sleepable allocations Subsystem: mm/migration Wei Yang <richardw.yang@linux.intel.com>: Patch series "cleanup on do_pages_move()", v5: mm/migrate.c: no need to check for i > start in do_pages_move() mm/migrate.c: wrap do_move_pages_to_node() and store_status() mm/migrate.c: check pagelist in move_pages_and_store_status() mm/migrate.c: unify "not queued for migration" handling in do_pages_move() Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate.c: migrate PG_readahead flag Subsystem: mm/thp David Rientjes <rientjes@google.com>: mm, shmem: add vmstat for hugepage fallback mm, thp: track fallbacks due to failed memcg charges separately "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/pagemap.h: optimise find_subpage for !THP mm: remove CONFIG_TRANSPARENT_HUGE_PAGECACHE Subsystem: mm/ksm Li Chen <chenli@uniontech.com>: mm/ksm.c: update get_user_pages() argument in comment Subsystem: mm/madvise Huang Ying <ying.huang@intel.com>: mm: code cleanup for MADV_FREE Subsystem: mm/virtio Alexander Duyck <alexander.h.duyck@linux.intel.com>: Patch series "mm / virtio: Provide support for free page reporting", v17: mm: adjust shuffle code to allow for future coalescing mm: use zone and order instead of free area in free_list manipulators mm: add function __putback_isolated_page mm: introduce Reported pages virtio-balloon: pull page poisoning config out of free page hinting virtio-balloon: add support for providing free page reports to host mm/page_reporting: rotate reported pages to the tail of the list mm/page_reporting: add budget limit on how many pages can be reported per pass mm/page_reporting: add free page reporting documentation David Hildenbrand <david@redhat.com>: virtio-balloon: switch back to OOM handler for VIRTIO_BALLOON_F_DEFLATE_ON_OOM Subsystem: mm/userfaultfd Shaohua Li <shli@fb.com>: Patch series "userfaultfd: write protection support", v6: userfaultfd: wp: add helper for writeprotect check Andrea Arcangeli <aarcange@redhat.com>: userfaultfd: wp: hook userfault handler to write protection fault userfaultfd: wp: add WP pagetable tracking to x86 userfaultfd: wp: userfaultfd_pte/huge_pmd_wp() helpers userfaultfd: wp: add UFFDIO_COPY_MODE_WP Peter Xu <peterx@redhat.com>: mm: merge parameters for change_protection() userfaultfd: wp: apply _PAGE_UFFD_WP bit userfaultfd: wp: drop _PAGE_UFFD_WP properly when fork userfaultfd: wp: add pmd_swp_*uffd_wp() helpers userfaultfd: wp: support swap and page migration khugepaged: skip collapse if uffd-wp detected Shaohua Li <shli@fb.com>: userfaultfd: wp: support write protection for userfault vma range Andrea Arcangeli <aarcange@redhat.com>: userfaultfd: wp: add the writeprotect API to userfaultfd ioctl Shaohua Li <shli@fb.com>: userfaultfd: wp: enabled write protection in userfaultfd API Peter Xu <peterx@redhat.com>: userfaultfd: wp: don't wake up when doing write protect Martin Cracauer <cracauer@cons.org>: userfaultfd: wp: UFFDIO_REGISTER_MODE_WP documentation update Peter Xu <peterx@redhat.com>: userfaultfd: wp: declare _UFFDIO_WRITEPROTECT conditionally userfaultfd: selftests: refactor statistics userfaultfd: selftests: add write-protect test Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm: drop superfluous section checks when onlining/offlining": drivers/base/memory.c: drop section_count drivers/base/memory.c: drop pages_correctly_probed() mm/page_ext.c: drop pfn_present() check when onlining Baoquan He <bhe@redhat.com>: mm/memory_hotplug.c: only respect mem= parameter during boot stage David Hildenbrand <david@redhat.com>: mm/memory_hotplug.c: simplify calculation of number of pages in __remove_pages() mm/memory_hotplug.c: cleanup __add_pages() Baoquan He <bhe@redhat.com>: Patch series "mm/hotplug: Only use subsection map for VMEMMAP", v4: mm/sparse.c: introduce new function fill_subsection_map() mm/sparse.c: introduce a new function clear_subsection_map() mm/sparse.c: only use subsection map in VMEMMAP case mm/sparse.c: add note about only VMEMMAP supporting sub-section hotplug mm/sparse.c: move subsection_map related functions together David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: allow to specify a default online_type", v3: drivers/base/memory: rename MMOP_ONLINE_KEEP to MMOP_ONLINE drivers/base/memory: map MMOP_OFFLINE to 0 drivers/base/memory: store mapping between MMOP_* and string in an array powernv/memtrace: always online added memory blocks hv_balloon: don't check for memhp_auto_online manually mm/memory_hotplug: unexport memhp_auto_online mm/memory_hotplug: convert memhp_auto_online to store an online_type mm/memory_hotplug: allow to specify a default online_type chenqiwu <chenqiwu@xiaomi.com>: mm/memory_hotplug.c: use __pfn_to_section() instead of open-coding Subsystem: mm/shmem Kees Cook <keescook@chromium.org>: mm/shmem.c: distribute switch variables for initialization Mateusz Nosek <mateusznosek0@gmail.com>: mm/shmem.c: clean code by removing unnecessary assignment Hugh Dickins <hughd@google.com>: mm: huge tmpfs: try to split_huge_page() when punching hole Subsystem: mm/rmap Palmer Dabbelt <palmerdabbelt@google.com>: mm: prevent a warning when casting void* -> enum Subsystem: mm/zswap "Maciej S. Szmigiero" <mail@maciej.szmigiero.name>: mm/zswap: allow setting default status, compressor and allocator in Kconfig Subsystem: mm/zsmalloc Subsystem: mm/cleanups Jules Irenge <jbi.octave@gmail.com>: mm/compaction: add missing annotation for compact_lock_irqsave mm/hugetlb: add missing annotation for gather_surplus_pages() mm/mempolicy: add missing annotation for queue_pages_pmd() mm/slub: add missing annotation for get_map() mm/slub: add missing annotation for put_map() mm/zsmalloc: add missing annotation for migrate_read_lock() mm/zsmalloc: add missing annotation for migrate_read_unlock() mm/zsmalloc: add missing annotation for pin_tag() mm/zsmalloc: add missing annotation for unpin_tag() chenqiwu <chenqiwu@xiaomi.com>: mm: fix ambiguous comments for better code readability Mateusz Nosek <mateusznosek0@gmail.com>: mm/mm_init.c: clean code. Use BUILD_BUG_ON when comparing compile time constant Joe Perches <joe@perches.com>: mm: use fallthrough; Steven Price <steven.price@arm.com>: include/linux/swapops.h: correct guards for non_swap_entry() Ira Weiny <ira.weiny@intel.com>: include/linux/memremap.h: remove stale comments Mateusz Nosek <mateusznosek0@gmail.com>: mm/dmapool.c: micro-optimisation remove unnecessary branch Waiman Long <longman@redhat.com>: mm: remove dummy struct bootmem_data/bootmem_data_t Subsystem: procfs Jules Irenge <jbi.octave@gmail.com>: fs/proc/inode.c: annotate close_pdeo() for sparse Alexey Dobriyan <adobriyan@gmail.com>: proc: faster open/read/close with "permanent" files proc: speed up /proc/*/statm "Matthew Wilcox (Oracle)" <willy@infradead.org>: proc: inline vma_stop into m_stop proc: remove m_cache_vma proc: use ppos instead of m->version seq_file: remove m->version proc: inline m_next_vma into m_next Subsystem: misc Michal Simek <michal.simek@xilinx.com>: asm-generic: fix unistd_32.h generation format Nathan Chancellor <natechancellor@gmail.com>: kernel/extable.c: use address-of operator on section symbols Masahiro Yamada <masahiroy@kernel.org>: sparc,x86: vdso: remove meaningless undefining CONFIG_OPTIMIZE_INLINING compiler: remove CONFIG_OPTIMIZE_INLINING entirely Vegard Nossum <vegard.nossum@oracle.com>: compiler.h: fix error in BUILD_BUG_ON() reporting Subsystem: MAINTAINERS Joe Perches <joe@perches.com>: MAINTAINERS: list the section entries in the preferred order Subsystem: bitops Josh Poimboeuf <jpoimboe@redhat.com>: bitops: always inline sign extension helpers Subsystem: lib Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: lib/test_lockup: test module to generate lockups Colin Ian King <colin.king@canonical.com>: lib/test_lockup.c: fix spelling mistake "iteraions" -> "iterations" Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: lib/test_lockup.c: add parameters for locking generic vfs locks "Gustavo A. R. Silva" <gustavo@embeddedor.com>: lib/bch.c: replace zero-length array with flexible-array member lib/ts_bm.c: replace zero-length array with flexible-array member lib/ts_fsm.c: replace zero-length array with flexible-array member lib/ts_kmp.c: replace zero-length array with flexible-array member Geert Uytterhoeven <geert+renesas@glider.be>: lib/scatterlist: fix sg_copy_buffer() kerneldoc Kees Cook <keescook@chromium.org>: lib: test_stackinit.c: XFAIL switch variable init tests Alexander Potapenko <glider@google.com>: lib/stackdepot.c: check depot_index before accessing the stack slab lib/stackdepot.c: fix a condition in stack_depot_fetch() lib/stackdepot.c: build with -fno-builtin kasan: stackdepot: move filter_irq_stacks() to stackdepot.c Qian Cai <cai@lca.pw>: percpu_counter: fix a data race at vm_committed_as Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/test_bitmap.c: make use of EXP2_IN_BITS chenqiwu <chenqiwu@xiaomi.com>: lib/rbtree: fix coding style of assignments Dan Carpenter <dan.carpenter@oracle.com>: lib/test_kmod.c: remove a NULL test Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/bits.h: add compile time sanity check of GENMASK inputs Chris Wilson <chris@chris-wilson.co.uk>: lib/list: prevent compiler reloads inside 'safe' list iteration Nathan Chancellor <natechancellor@gmail.com>: lib/dynamic_debug.c: use address-of operator on section symbols Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: remove email address comment from email address comparisons Lubomir Rintel <lkundrak@v3.sk>: checkpatch: check SPDX tags in YAML files John Hubbard <jhubbard@nvidia.com>: checkpatch: support "base-commit:" format Joe Perches <joe@perches.com>: checkpatch: prefer fallthrough; over fallthrough comments Antonio Borneo <borneo.antonio@gmail.com>: checkpatch: fix minor typo and mixed space+tab in indentation checkpatch: fix multiple const * types checkpatch: add command-line option for TAB size Joe Perches <joe@perches.com>: checkpatch: improve Gerrit Change-Id: test Lubomir Rintel <lkundrak@v3.sk>: checkpatch: check proper licensing of Devicetree bindings Joe Perches <joe@perches.com>: checkpatch: avoid warning about uninitialized_var() Subsystem: epoll Roman Penyaev <rpenyaev@suse.de>: kselftest: introduce new epoll test case Jason Baron <jbaron@akamai.com>: fs/epoll: make nesting accounting safe for -rt kernel Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: delete "loc" variable fs/binfmt_elf.c: allocate less for static executable fs/binfmt_elf.c: don't free interpreter's ELF pheaders on common path Subsystem: kallsyms Will Deacon <will@kernel.org>: Patch series "Unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()": samples/hw_breakpoint: drop HW_BREAKPOINT_R when reporting writes samples/hw_breakpoint: drop use of kallsyms_lookup_name() kallsyms: unexport kallsyms_lookup_name() and kallsyms_on_each_symbol() Subsystem: reiserfs Colin Ian King <colin.king@canonical.com>: reiserfs: clean up several indentation issues Subsystem: kmod Qiujun Huang <hqjagain@gmail.com>: kernel/kmod.c: fix a typo "assuems" -> "assumes" Subsystem: gcov "Gustavo A. R. Silva" <gustavo@embeddedor.com>: gcov: gcc_4_7: replace zero-length array with flexible-array member gcov: gcc_3_4: replace zero-length array with flexible-array member kernel/gcov/fs.c: replace zero-length array with flexible-array member Subsystem: kconfig Krzysztof Kozlowski <krzk@kernel.org>: init/Kconfig: clean up ANON_INODES and old IO schedulers options Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series "kcov: collect coverage from usb soft interrupts", v4: kcov: cleanup debug messages kcov: fix potential use-after-free in kcov_remote_start kcov: move t->kcov assignments into kcov_start/stop kcov: move t->kcov_sequence assignment kcov: use t->kcov_mode as enabled indicator kcov: collect coverage from interrupts usb: core: kcov: collect coverage from usb complete callback Subsystem: ubsan Kees Cook <keescook@chromium.org>: Patch series "ubsan: Split out bounds checker", v5: ubsan: add trap instrumentation option ubsan: split "bounds" checker from other options drivers/misc/lkdtm/bugs.c: add arithmetic overflow and array bounds checks ubsan: check panic_on_warn kasan: unset panic_on_warn before calling panic() ubsan: include bug type in report header Subsystem: fault-injection Qiujun Huang <hqjagain@gmail.com>: lib/Kconfig.debug: fix a typo "capabilitiy" -> "capability" Subsystem: ipc Somala Swaraj <somalaswaraj@gmail.com>: ipc/mqueue.c: fix a brace coding style issue Jason Yan <yanaijie@huawei.com>: ipc/shm.c: make compat_ksys_shmctl() static Documentation/admin-guide/kernel-parameters.txt | 13 Documentation/admin-guide/mm/transhuge.rst | 14 Documentation/admin-guide/mm/userfaultfd.rst | 51 Documentation/dev-tools/kcov.rst | 17 Documentation/vm/free_page_reporting.rst | 41 Documentation/vm/zswap.rst | 20 MAINTAINERS | 35 arch/alpha/include/asm/mmzone.h | 2 arch/alpha/kernel/syscalls/syscallhdr.sh | 2 arch/csky/mm/fault.c | 4 arch/ia64/kernel/syscalls/syscallhdr.sh | 2 arch/ia64/kernel/vmlinux.lds.S | 2 arch/m68k/mm/fault.c | 4 arch/microblaze/kernel/syscalls/syscallhdr.sh | 2 arch/mips/kernel/syscalls/syscallhdr.sh | 3 arch/mips/mm/fault.c | 4 arch/nds32/kernel/vmlinux.lds.S | 1 arch/parisc/kernel/syscalls/syscallhdr.sh | 2 arch/powerpc/kernel/syscalls/syscallhdr.sh | 3 arch/powerpc/kvm/e500_mmu_host.c | 2 arch/powerpc/mm/fault.c | 2 arch/powerpc/platforms/powernv/memtrace.c | 14 arch/sh/kernel/syscalls/syscallhdr.sh | 2 arch/sh/mm/fault.c | 2 arch/sparc/kernel/syscalls/syscallhdr.sh | 2 arch/sparc/vdso/vdso32/vclock_gettime.c | 4 arch/x86/Kconfig | 1 arch/x86/configs/i386_defconfig | 1 arch/x86/configs/x86_64_defconfig | 1 arch/x86/entry/vdso/vdso32/vclock_gettime.c | 4 arch/x86/include/asm/pgtable.h | 67 + arch/x86/include/asm/pgtable_64.h | 8 arch/x86/include/asm/pgtable_types.h | 12 arch/x86/mm/fault.c | 2 arch/xtensa/kernel/syscalls/syscallhdr.sh | 2 drivers/base/memory.c | 138 -- drivers/hv/hv_balloon.c | 25 drivers/misc/lkdtm/bugs.c | 75 + drivers/misc/lkdtm/core.c | 3 drivers/misc/lkdtm/lkdtm.h | 3 drivers/usb/core/hcd.c | 3 drivers/virtio/Kconfig | 1 drivers/virtio/virtio_balloon.c | 190 ++- fs/binfmt_elf.c | 56 fs/eventpoll.c | 64 - fs/proc/array.c | 39 fs/proc/cpuinfo.c | 1 fs/proc/generic.c | 31 fs/proc/inode.c | 188 ++- fs/proc/internal.h | 6 fs/proc/kmsg.c | 1 fs/proc/stat.c | 1 fs/proc/task_mmu.c | 97 - fs/reiserfs/do_balan.c | 2 fs/reiserfs/ioctl.c | 11 fs/reiserfs/namei.c | 10 fs/seq_file.c | 28 fs/userfaultfd.c | 116 + include/asm-generic/pgtable.h | 1 include/asm-generic/pgtable_uffd.h | 66 + include/asm-generic/tlb.h | 3 include/linux/bitops.h | 4 include/linux/bits.h | 22 include/linux/compiler.h | 2 include/linux/compiler_types.h | 11 include/linux/gfp.h | 2 include/linux/huge_mm.h | 2 include/linux/list.h | 50 include/linux/memory.h | 1 include/linux/memory_hotplug.h | 13 include/linux/memremap.h | 2 include/linux/mm.h | 25 include/linux/mm_inline.h | 15 include/linux/mm_types.h | 4 include/linux/mmzone.h | 47 include/linux/page-flags.h | 16 include/linux/page_reporting.h | 26 include/linux/pagemap.h | 4 include/linux/percpu_counter.h | 4 include/linux/proc_fs.h | 17 include/linux/sched.h | 3 include/linux/seq_file.h | 1 include/linux/shmem_fs.h | 10 include/linux/stackdepot.h | 2 include/linux/swapops.h | 5 include/linux/userfaultfd_k.h | 42 include/linux/vm_event_item.h | 5 include/trace/events/huge_memory.h | 1 include/trace/events/mmflags.h | 1 include/trace/events/vmscan.h | 2 include/uapi/linux/userfaultfd.h | 40 include/uapi/linux/virtio_balloon.h | 1 init/Kconfig | 8 ipc/mqueue.c | 5 ipc/shm.c | 2 ipc/util.c | 1 kernel/configs/tiny.config | 1 kernel/events/core.c | 3 kernel/extable.c | 3 kernel/fork.c | 10 kernel/gcov/fs.c | 2 kernel/gcov/gcc_3_4.c | 6 kernel/gcov/gcc_4_7.c | 2 kernel/kallsyms.c | 2 kernel/kcov.c | 282 +++- kernel/kmod.c | 2 kernel/module.c | 1 kernel/sched/fair.c | 2 lib/Kconfig.debug | 35 lib/Kconfig.ubsan | 51 lib/Makefile | 8 lib/bch.c | 2 lib/dynamic_debug.c | 2 lib/rbtree.c | 4 lib/scatterlist.c | 2 lib/stackdepot.c | 39 lib/test_bitmap.c | 2 lib/test_kmod.c | 2 lib/test_lockup.c | 601 +++++++++- lib/test_stackinit.c | 28 lib/ts_bm.c | 2 lib/ts_fsm.c | 2 lib/ts_kmp.c | 2 lib/ubsan.c | 47 mm/Kconfig | 135 ++ mm/Makefile | 1 mm/compaction.c | 3 mm/dmapool.c | 4 mm/filemap.c | 14 mm/gup.c | 9 mm/huge_memory.c | 36 mm/hugetlb.c | 1 mm/hugetlb_cgroup.c | 6 mm/internal.h | 2 mm/kasan/common.c | 23 mm/kasan/report.c | 10 mm/khugepaged.c | 39 mm/ksm.c | 5 mm/list_lru.c | 2 mm/memcontrol.c | 5 mm/memory-failure.c | 2 mm/memory.c | 42 mm/memory_hotplug.c | 53 mm/mempolicy.c | 11 mm/migrate.c | 122 +- mm/mm_init.c | 2 mm/mmap.c | 10 mm/mprotect.c | 76 - mm/page_alloc.c | 174 ++ mm/page_ext.c | 5 mm/page_isolation.c | 6 mm/page_reporting.c | 384 ++++++ mm/page_reporting.h | 54 mm/rmap.c | 23 mm/shmem.c | 168 +- mm/shuffle.c | 12 mm/shuffle.h | 6 mm/slab_common.c | 1 mm/slub.c | 3 mm/sparse.c | 236 ++- mm/swap.c | 20 mm/swapfile.c | 1 mm/userfaultfd.c | 98 + mm/vmalloc.c | 2 mm/vmscan.c | 12 mm/vmstat.c | 3 mm/zsmalloc.c | 10 mm/zswap.c | 24 samples/hw_breakpoint/data_breakpoint.c | 11 scripts/Makefile.ubsan | 16 scripts/checkpatch.pl | 155 +- tools/lib/rbtree.c | 4 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 67 + tools/testing/selftests/vm/userfaultfd.c | 233 +++ 174 files changed, 3990 insertions(+), 1399 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-04-02 4:01 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-04-02 4:01 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits A large amount of MM, plenty more to come. 155 patches, based on GIT 1a323ea5356edbb3073dc59d51b9e6b86908857d Subsystems affected by this patch series: tools kthread kbuild scripts ocfs2 vfs mm/slub mm/kmemleak mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/mremap mm/sparsemem mm/kasan mm/pagealloc mm/vmscan mm/compaction mm/mempolicy mm/hugetlbfs mm/hugetlb Subsystem: tools David Ahern <dsahern@kernel.org>: tools/accounting/getdelays.c: fix netlink attribute length Subsystem: kthread Petr Mladek <pmladek@suse.com>: kthread: mark timer used by delayed kthread works as IRQ safe Subsystem: kbuild Masahiro Yamada <masahiroy@kernel.org>: asm-generic: make more kernel-space headers mandatory Subsystem: scripts Jonathan Neuschäfer <j.neuschaefer@gmx.net>: scripts/spelling.txt: add syfs/sysfs pattern Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ocfs2 Alex Shi <alex.shi@linux.alibaba.com>: ocfs2: remove FS_OCFS2_NM ocfs2: remove unused macros ocfs2: use OCFS2_SEC_BITS in macro ocfs2: remove dlm_lock_is_remote wangyan <wangyan122@huawei.com>: ocfs2: there is no need to log twice in several functions ocfs2: correct annotation from "l_next_rec" to "l_next_free_rec" Alex Shi <alex.shi@linux.alibaba.com>: ocfs2: remove useless err Jules Irenge <jbi.octave@gmail.com>: ocfs2: Add missing annotations for ocfs2_refcount_cache_lock() and ocfs2_refcount_cache_unlock() "Gustavo A. R. Silva" <gustavo@embeddedor.com>: ocfs2: replace zero-length array with flexible-array member ocfs2: cluster: replace zero-length array with flexible-array member ocfs2: dlm: replace zero-length array with flexible-array member ocfs2: ocfs2_fs.h: replace zero-length array with flexible-array member wangjian <wangjian161@huawei.com>: ocfs2: roll back the reference count modification of the parent directory if an error occurs Takashi Iwai <tiwai@suse.de>: ocfs2: use scnprintf() for avoiding potential buffer overflow "Matthew Wilcox (Oracle)" <willy@infradead.org>: ocfs2: use memalloc_nofs_save instead of memalloc_noio_save Subsystem: vfs Kees Cook <keescook@chromium.org>: fs_parse: Remove pr_notice() about each validation Subsystem: mm/slub chenqiwu <chenqiwu@xiaomi.com>: mm/slub.c: replace cpu_slab->partial with wrapped APIs mm/slub.c: replace kmem_cache->cpu_partial with wrapped APIs Kees Cook <keescook@chromium.org>: slub: improve bit diffusion for freelist ptr obfuscation slub: relocate freelist pointer to middle of object Vlastimil Babka <vbabka@suse.cz>: Revert "topology: add support for node_to_mem_node() to determine the fallback node" Subsystem: mm/kmemleak Nathan Chancellor <natechancellor@gmail.com>: mm/kmemleak.c: use address-of operator on section symbols Qian Cai <cai@lca.pw>: mm/Makefile: disable KCSAN for kmemleak Subsystem: mm/pagecache Jan Kara <jack@suse.cz>: mm/filemap.c: don't bother dropping mmap_sem for zero size readahead Mauricio Faria de Oliveira <mfo@canonical.com>: mm/page-writeback.c: write_cache_pages(): deduplicate identical checks Xianting Tian <xianting_tian@126.com>: mm/filemap.c: clear page error before actual read Souptick Joarder <jrdr.linux@gmail.com>: mm/filemap.c: remove unused argument from shrink_readahead_size_eio() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm/filemap.c: use vm_fault error code directly include/linux/pagemap.h: rename arguments to find_subpage mm/page-writeback.c: use VM_BUG_ON_PAGE in clear_page_dirty_for_io mm/filemap.c: unexport find_get_entry mm/filemap.c: rewrite pagecache_get_page documentation Subsystem: mm/gup John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: track FOLL_PIN pages", v6: mm/gup: split get_user_pages_remote() into two routines mm/gup: pass a flags arg to __gup_device_* functions mm: introduce page_ref_sub_return() mm/gup: pass gup flags to two more routines mm/gup: require FOLL_GET for get_user_pages_fast() mm/gup: track FOLL_PIN pages mm/gup: page->hpage_pinned_refcount: exact pin counts for huge pages mm/gup: /proc/vmstat: pin_user_pages (FOLL_PIN) reporting mm/gup_benchmark: support pin_user_pages() and related calls selftests/vm: run_vmtests: invoke gup_benchmark with basic FOLL_PIN coverage "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: improve dump_page() for compound pages John Hubbard <jhubbard@nvidia.com>: mm: dump_page(): additional diagnostics for huge pinned pages Claudio Imbrenda <imbrenda@linux.ibm.com>: mm/gup/writeback: add callbacks for inaccessible pages Pingfan Liu <kernelfans@gmail.com>: mm/gup: rename nr as nr_pinned in get_user_pages_fast() mm/gup: fix omission of check on FOLL_LONGTERM in gup fast path Subsystem: mm/swap Chen Wandun <chenwandun@huawei.com>: mm/swapfile.c: fix comments for swapcache_prepare Wei Yang <richardw.yang@linux.intel.com>: mm/swap.c: not necessary to export __pagevec_lru_add() Qian Cai <cai@lca.pw>: mm/swapfile: fix data races in try_to_unuse() Wei Yang <richard.weiyang@linux.alibaba.com>: mm/swap_slots.c: assign|reset cache slot by value directly Yang Shi <yang.shi@linux.alibaba.com>: mm: swap: make page_evictable() inline mm: swap: use smp_mb__after_atomic() to order LRU bit set Wei Yang <richard.weiyang@gmail.com>: mm/swap_state.c: use the same way to count page in [add_to|delete_from]_swap_cache Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: fix build error around the usage of kmem_caches Kirill Tkhai <ktkhai@virtuozzo.com>: mm/memcontrol.c: allocate shrinker_map on appropriate NUMA node Roman Gushchin <guro@fb.com>: mm: memcg/slab: use mem_cgroup_from_obj() Patch series "mm: memcg: kmem API cleanup", v2: mm: kmem: cleanup (__)memcg_kmem_charge_memcg() arguments mm: kmem: cleanup memcg_kmem_uncharge_memcg() arguments mm: kmem: rename memcg_kmem_(un)charge() into memcg_kmem_(un)charge_page() mm: kmem: switch to nr_pages in (__)memcg_kmem_charge_memcg() mm: memcg/slab: cache page number in memcg_(un)charge_slab() mm: kmem: rename (__)memcg_kmem_(un)charge_memcg() to __memcg_kmem_(un)charge() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: memcontrol: recursive memory.low protection", v3: mm: memcontrol: fix memory.low proportional distribution mm: memcontrol: clean up and document effective low/min calculations mm: memcontrol: recursive memory.low protection Shakeel Butt <shakeelb@google.com>: memcg: css_tryget_online cleanups Vincenzo Frascino <vincenzo.frascino@arm.com>: mm/memcontrol.c: make mem_cgroup_id_get_many() __maybe_unused Chris Down <chris@chrisdown.name>: mm, memcg: prevent memory.high load/store tearing mm, memcg: prevent memory.max load tearing mm, memcg: prevent memory.low load/store tearing mm, memcg: prevent memory.min load/store tearing mm, memcg: prevent memory.swap.max load tearing mm, memcg: prevent mem_cgroup_protected store tearing Roman Gushchin <guro@fb.com>: mm: memcg: make memory.oom.group tolerable to task migration Subsystem: mm/pagemap Thomas Hellstrom <thellstrom@vmware.com>: mm/mapping_dirty_helpers: Update huge page-table entry callbacks Anshuman Khandual <anshuman.khandual@arm.com>: Patch series "mm/vma: some more minor changes", v2: mm/vma: move VM_NO_KHUGEPAGED into generic header mm/vma: make vma_is_foreign() available for general use mm/vma: make is_vma_temporary_stack() available for general use "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: add pagemap.h to the fine documentation Peter Xu <peterx@redhat.com>: Patch series "mm: Page fault enhancements", v6: mm/gup: rename "nonblocking" to "locked" where proper mm/gup: fix __get_user_pages() on fault retry of hugetlb mm: introduce fault_signal_pending() x86/mm: use helper fault_signal_pending() arc/mm: use helper fault_signal_pending() arm64/mm: use helper fault_signal_pending() powerpc/mm: use helper fault_signal_pending() sh/mm: use helper fault_signal_pending() mm: return faster for non-fatal signals in user mode faults userfaultfd: don't retake mmap_sem to emulate NOPAGE mm: introduce FAULT_FLAG_DEFAULT mm: introduce FAULT_FLAG_INTERRUPTIBLE mm: allow VM_FAULT_RETRY for multiple times mm/gup: allow VM_FAULT_RETRY for multiple times mm/gup: allow to react to fatal signals mm/userfaultfd: honor FAULT_FLAG_KILLABLE in fault path WANG Wenhu <wenhu.wang@vivo.com>: mm: clarify a confusing comment for remap_pfn_range() Wang Wenhu <wenhu.wang@vivo.com>: mm/memory.c: clarify a confusing comment for vm_iomap_memory Jaewon Kim <jaewon31.kim@samsung.com>: Patch series "mm: mmap: add mmap trace point", v3: mmap: remove inline of vm_unmapped_area mm: mmap: add trace point of vm_unmapped_area Subsystem: mm/mremap Brian Geffon <bgeffon@google.com>: mm/mremap: add MREMAP_DONTUNMAP to mremap() selftests: add MREMAP_DONTUNMAP selftest Subsystem: mm/sparsemem Wei Yang <richardw.yang@linux.intel.com>: mm/sparsemem: get address to page struct instead of address to pfn Pingfan Liu <kernelfans@gmail.com>: mm/sparse: rename pfn_present() to pfn_in_present_section() Baoquan He <bhe@redhat.com>: mm/sparse.c: use kvmalloc/kvfree to alloc/free memmap for the classic sparse mm/sparse.c: allocate memmap preferring the given node Subsystem: mm/kasan Walter Wu <walter-zh.wu@mediatek.com>: Patch series "fix the missing underflow in memory operation function", v4: kasan: detect negative size in memory operation function kasan: add test for invalid size in memmove Subsystem: mm/pagealloc Joel Savitz <jsavitz@redhat.com>: mm/page_alloc: increase default min_free_kbytes bound Mateusz Nosek <mateusznosek0@gmail.com>: mm, pagealloc: micro-optimisation: save two branches on hot page allocation path chenqiwu <chenqiwu@xiaomi.com>: mm/page_alloc.c: use free_area_empty() instead of open-coding Mateusz Nosek <mateusznosek0@gmail.com>: mm/page_alloc.c: micro-optimisation Remove unnecessary branch chenqiwu <chenqiwu@xiaomi.com>: mm/page_alloc: simplify page_is_buddy() for better code readability Subsystem: mm/vmscan Yang Shi <yang.shi@linux.alibaba.com>: mm: vmpressure: don't need call kfree if kstrndup fails mm: vmpressure: use mem_cgroup_is_root API mm: vmscan: replace open codings to NUMA_NO_NODE Wei Yang <richardw.yang@linux.intel.com>: mm/vmscan.c: remove cpu online notification for now Qian Cai <cai@lca.pw>: mm/vmscan.c: fix data races using kswapd_classzone_idx Mateusz Nosek <mateusznosek0@gmail.com>: mm/vmscan.c: Clean code by removing unnecessary assignment Kirill Tkhai <ktkhai@virtuozzo.com>: mm/vmscan.c: make may_enter_fs bool in shrink_page_list() Mateusz Nosek <mateusznosek0@gmail.com>: mm/vmscan.c: do_try_to_free_pages(): clean code by removing unnecessary assignment Michal Hocko <mhocko@suse.com>: selftests: vm: drop dependencies on page flags from mlock2 tests Subsystem: mm/compaction Rik van Riel <riel@surriel.com>: Patch series "fix THP migration for CMA allocations", v2: mm,compaction,cma: add alloc_contig flag to compact_control mm,thp,compaction,cma: allow THP migration for CMA allocations Vlastimil Babka <vbabka@suse.cz>: mm, compaction: fully assume capture is not NULL in compact_zone_order() Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/compaction: really limit compact_unevictable_allowed to 0 and 1 mm/compaction: Disable compact_unevictable_allowed on RT Mateusz Nosek <mateusznosek0@gmail.com>: mm/compaction.c: clean code by removing unnecessary assignment Subsystem: mm/mempolicy Li Xinhai <lixinhai.lxh@gmail.com>: mm/mempolicy: support MPOL_MF_STRICT for huge page mapping mm/mempolicy: check hugepage migration is supported by arch in vma_migratable() Yang Shi <yang.shi@linux.alibaba.com>: mm: mempolicy: use VM_BUG_ON_VMA in queue_pages_test_walk() Randy Dunlap <rdunlap@infradead.org>: mm: mempolicy: require at least one nodeid for MPOL_PREFERRED Colin Ian King <colin.king@canonical.com>: mm/memblock.c: remove redundant assignment to variable max_addr Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: Patch series "hugetlbfs: use i_mmap_rwsem for more synchronization", v2: hugetlbfs: use i_mmap_rwsem for more pmd sharing synchronization hugetlbfs: Use i_mmap_rwsem to address page fault/truncate race Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb_cgroup: add hugetlb_cgroup reservation counter hugetlb_cgroup: add interface for charge/uncharge hugetlb reservations mm/hugetlb_cgroup: fix hugetlb_cgroup migration hugetlb_cgroup: add reservation accounting for private mappings hugetlb: disable region_add file_region coalescing hugetlb_cgroup: add accounting for shared mappings hugetlb_cgroup: support noreserve mappings hugetlb: support file_region coalescing again hugetlb_cgroup: add hugetlb_cgroup reservation tests hugetlb_cgroup: add hugetlb_cgroup reservation docs Mateusz Nosek <mateusznosek0@gmail.com>: mm/hugetlb.c: clean code by removing unnecessary initialization Vlastimil Babka <vbabka@suse.cz>: mm/hugetlb: remove unnecessary memory fetch in PageHeadHuge() Christophe Leroy <christophe.leroy@c-s.fr>: selftests/vm: fix map_hugetlb length used for testing read and write mm/hugetlb: fix build failure with HUGETLB_PAGE but not HUGEBTLBFS "Matthew Wilcox (Oracle)" <willy@infradead.org>: include/linux/huge_mm.h: check PageTail in hpage_nr_pages even when !THP Documentation/admin-guide/cgroup-v1/hugetlb.rst | 103 +- Documentation/admin-guide/cgroup-v2.rst | 11 Documentation/admin-guide/sysctl/vm.rst | 3 Documentation/core-api/mm-api.rst | 3 Documentation/core-api/pin_user_pages.rst | 86 + arch/alpha/include/asm/Kbuild | 11 arch/alpha/mm/fault.c | 6 arch/arc/include/asm/Kbuild | 21 arch/arc/mm/fault.c | 37 arch/arm/include/asm/Kbuild | 12 arch/arm/mm/fault.c | 7 arch/arm64/include/asm/Kbuild | 18 arch/arm64/mm/fault.c | 26 arch/c6x/include/asm/Kbuild | 37 arch/csky/include/asm/Kbuild | 36 arch/h8300/include/asm/Kbuild | 46 arch/hexagon/include/asm/Kbuild | 33 arch/hexagon/mm/vm_fault.c | 5 arch/ia64/include/asm/Kbuild | 7 arch/ia64/mm/fault.c | 5 arch/m68k/include/asm/Kbuild | 24 arch/m68k/mm/fault.c | 7 arch/microblaze/include/asm/Kbuild | 29 arch/microblaze/mm/fault.c | 5 arch/mips/include/asm/Kbuild | 13 arch/mips/mm/fault.c | 5 arch/nds32/include/asm/Kbuild | 37 arch/nds32/mm/fault.c | 5 arch/nios2/include/asm/Kbuild | 38 arch/nios2/mm/fault.c | 7 arch/openrisc/include/asm/Kbuild | 36 arch/openrisc/mm/fault.c | 5 arch/parisc/include/asm/Kbuild | 18 arch/parisc/mm/fault.c | 8 arch/powerpc/include/asm/Kbuild | 4 arch/powerpc/mm/book3s64/pkeys.c | 12 arch/powerpc/mm/fault.c | 20 arch/powerpc/platforms/pseries/hotplug-memory.c | 2 arch/riscv/include/asm/Kbuild | 28 arch/riscv/mm/fault.c | 9 arch/s390/include/asm/Kbuild | 15 arch/s390/mm/fault.c | 10 arch/sh/include/asm/Kbuild | 16 arch/sh/mm/fault.c | 13 arch/sparc/include/asm/Kbuild | 14 arch/sparc/mm/fault_32.c | 5 arch/sparc/mm/fault_64.c | 5 arch/um/kernel/trap.c | 3 arch/unicore32/include/asm/Kbuild | 34 arch/unicore32/mm/fault.c | 8 arch/x86/include/asm/Kbuild | 2 arch/x86/include/asm/mmu_context.h | 15 arch/x86/mm/fault.c | 32 arch/xtensa/include/asm/Kbuild | 26 arch/xtensa/mm/fault.c | 5 drivers/base/node.c | 2 drivers/gpu/drm/ttm/ttm_bo_vm.c | 12 fs/fs_parser.c | 2 fs/hugetlbfs/inode.c | 30 fs/ocfs2/alloc.c | 3 fs/ocfs2/cluster/heartbeat.c | 12 fs/ocfs2/cluster/netdebug.c | 4 fs/ocfs2/cluster/tcp.c | 27 fs/ocfs2/cluster/tcp.h | 2 fs/ocfs2/dir.c | 4 fs/ocfs2/dlm/dlmcommon.h | 8 fs/ocfs2/dlm/dlmdebug.c | 100 - fs/ocfs2/dlm/dlmmaster.c | 2 fs/ocfs2/dlm/dlmthread.c | 3 fs/ocfs2/dlmglue.c | 2 fs/ocfs2/journal.c | 2 fs/ocfs2/namei.c | 15 fs/ocfs2/ocfs2_fs.h | 18 fs/ocfs2/refcounttree.c | 2 fs/ocfs2/reservations.c | 3 fs/ocfs2/stackglue.c | 2 fs/ocfs2/suballoc.c | 5 fs/ocfs2/super.c | 46 fs/pipe.c | 2 fs/userfaultfd.c | 64 - include/asm-generic/Kbuild | 52 + include/linux/cgroup-defs.h | 5 include/linux/fs.h | 5 include/linux/gfp.h | 6 include/linux/huge_mm.h | 10 include/linux/hugetlb.h | 76 + include/linux/hugetlb_cgroup.h | 175 +++ include/linux/kasan.h | 2 include/linux/kthread.h | 3 include/linux/memcontrol.h | 66 - include/linux/mempolicy.h | 29 include/linux/mm.h | 243 +++- include/linux/mm_types.h | 7 include/linux/mmzone.h | 6 include/linux/page_ref.h | 9 include/linux/pagemap.h | 29 include/linux/sched/signal.h | 18 include/linux/swap.h | 1 include/linux/topology.h | 17 include/trace/events/mmap.h | 48 include/uapi/linux/mman.h | 5 kernel/cgroup/cgroup.c | 17 kernel/fork.c | 9 kernel/sysctl.c | 31 lib/test_kasan.c | 19 mm/Makefile | 1 mm/compaction.c | 31 mm/debug.c | 54 - mm/filemap.c | 77 - mm/gup.c | 682 ++++++++++--- mm/gup_benchmark.c | 71 + mm/huge_memory.c | 29 mm/hugetlb.c | 866 ++++++++++++----- mm/hugetlb_cgroup.c | 347 +++++- mm/internal.h | 32 mm/kasan/common.c | 26 mm/kasan/generic.c | 9 mm/kasan/generic_report.c | 11 mm/kasan/kasan.h | 2 mm/kasan/report.c | 5 mm/kasan/tags.c | 9 mm/kasan/tags_report.c | 11 mm/khugepaged.c | 4 mm/kmemleak.c | 2 mm/list_lru.c | 12 mm/mapping_dirty_helpers.c | 42 mm/memblock.c | 2 mm/memcontrol.c | 378 ++++--- mm/memory-failure.c | 29 mm/memory.c | 4 mm/mempolicy.c | 73 + mm/migrate.c | 25 mm/mmap.c | 32 mm/mremap.c | 92 + mm/page-writeback.c | 19 mm/page_alloc.c | 82 - mm/page_counter.c | 29 mm/page_ext.c | 2 mm/rmap.c | 39 mm/shuffle.c | 2 mm/slab.h | 32 mm/slab_common.c | 2 mm/slub.c | 27 mm/sparse.c | 33 mm/swap.c | 5 mm/swap_slots.c | 12 mm/swap_state.c | 2 mm/swapfile.c | 10 mm/userfaultfd.c | 11 mm/vmpressure.c | 8 mm/vmscan.c | 111 -- mm/vmstat.c | 2 scripts/spelling.txt | 21 tools/accounting/getdelays.c | 2 tools/testing/selftests/vm/.gitignore | 1 tools/testing/selftests/vm/Makefile | 2 tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 575 +++++++++++ tools/testing/selftests/vm/gup_benchmark.c | 15 tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 244 ++++ tools/testing/selftests/vm/map_hugetlb.c | 14 tools/testing/selftests/vm/mlock2-tests.c | 233 ---- tools/testing/selftests/vm/mremap_dontunmap.c | 313 ++++++ tools/testing/selftests/vm/run_vmtests | 37 tools/testing/selftests/vm/write_hugetlb_memory.sh | 23 tools/testing/selftests/vm/write_to_hugetlbfs.c | 242 ++++ 165 files changed, 5020 insertions(+), 2376 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-03-29 2:14 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-03-29 2:14 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 5 fixes, based on 83fd69c93340177dcd66fd26ce6441fb581c1dbf: Naohiro Aota <naohiro.aota@wdc.com>: mm/swapfile.c: move inode_lock out of claim_swapfile David Hildenbrand <david@redhat.com>: drivers/base/memory.c: indicate all memory blocks as removable Mina Almasry <almasrymina@google.com>: hugetlb_cgroup: fix illegal access to memory Roman Gushchin <guro@fb.com>: mm: fork: fix kernel_stack memcg stats for various stack implementations "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: mm/sparse: fix kernel crash with pfn_section_valid check drivers/base/memory.c | 23 +++-------------------- include/linux/memcontrol.h | 12 ++++++++++++ kernel/fork.c | 4 ++-- mm/hugetlb_cgroup.c | 3 +-- mm/memcontrol.c | 38 ++++++++++++++++++++++++++++++++++++++ mm/sparse.c | 6 ++++++ mm/swapfile.c | 41 ++++++++++++++++++++--------------------- 7 files changed, 82 insertions(+), 45 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-03-22 1:19 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-03-22 1:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 10 fixes, based on c63c50fc2ec9afc4de21ef9ead2eac64b178cce1: Chunguang Xu <brookxu@tencent.com>: memcg: fix NULL pointer dereference in __mem_cgroup_usage_unregister_event Baoquan He <bhe@redhat.com>: mm/hotplug: fix hot remove failure in SPARSEMEM|!VMEMMAP case Qian Cai <cai@lca.pw>: page-flags: fix a crash at SetPageError(THP_SWAP) Chris Down <chris@chrisdown.name>: mm, memcg: fix corruption on 64-bit divisor in memory.high throttling mm, memcg: throttle allocators based on ancestral memory.high Michal Hocko <mhocko@suse.com>: mm: do not allow MADV_PAGEOUT for CoW pages Roman Penyaev <rpenyaev@suse.de>: epoll: fix possible lost wakeup on epoll_ctl() path Qian Cai <cai@lca.pw>: mm/mmu_notifier: silence PROVE_RCU_LIST warnings Vlastimil Babka <vbabka@suse.cz>: mm, slub: prevent kmalloc_node crashes and memory leaks Joerg Roedel <jroedel@suse.de>: x86/mm: split vmalloc_sync_all() arch/x86/mm/fault.c | 26 ++++++++++- drivers/acpi/apei/ghes.c | 2 fs/eventpoll.c | 8 +-- include/linux/page-flags.h | 2 include/linux/vmalloc.h | 5 +- kernel/notifier.c | 2 mm/madvise.c | 12 +++-- mm/memcontrol.c | 105 ++++++++++++++++++++++++++++----------------- mm/mmu_notifier.c | 27 +++++++---- mm/nommu.c | 10 +++- mm/slub.c | 26 +++++++---- mm/sparse.c | 8 ++- mm/vmalloc.c | 11 +++- 13 files changed, 165 insertions(+), 79 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-03-06 6:27 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-03-06 6:27 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 7 fixes, based on 9f65ed5fe41ce08ed1cb1f6a950f9ec694c142ad: Mel Gorman <mgorman@techsingularity.net>: mm, numa: fix bad pmd by atomically check for pmd_trans_huge when marking page tables prot_numa Huang Ying <ying.huang@intel.com>: mm: fix possible PMD dirty bit lost in set_pmd_migration_entry() "Kirill A. Shutemov" <kirill@shutemov.name>: mm: avoid data corruption on CoW fault into PFN-mapped VMA OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: fix uninit-memory access for partial initialized inode Sebastian Andrzej Siewior <bigeasy@linutronix.de>: mm/z3fold.c: do not include rwlock.h directly Vlastimil Babka <vbabka@suse.cz>: mm, hotplug: fix page online with DEBUG_PAGEALLOC compiled but not enabled Miroslav Benes <mbenes@suse.cz>: arch/Kconfig: update HAVE_RELIABLE_STACKTRACE description arch/Kconfig | 5 +++-- fs/fat/inode.c | 19 +++++++------------ include/linux/mm.h | 4 ++++ mm/huge_memory.c | 3 +-- mm/memory.c | 35 +++++++++++++++++++++++++++-------- mm/memory_hotplug.c | 8 +++++++- mm/mprotect.c | 38 ++++++++++++++++++++++++++++++++++++-- mm/z3fold.c | 1 - 8 files changed, 85 insertions(+), 28 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-02-21 4:00 Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 0 siblings, 2 replies; 389+ messages in thread From: Andrew Morton @ 2020-02-21 4:00 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits - A few y2038 fixes which missed the merge window whiole dependencies in NFS were being sorted out. - A bunch of fixes. Some minor, some not. Subsystems affected by this patch series: Arnd Bergmann <arnd@arndb.de>: y2038: remove ktime to/from timespec/timeval conversion y2038: remove unused time32 interfaces y2038: hide timeval/timespec/itimerval/itimerspec types Ioanna Alifieraki <ioanna-maria.alifieraki@canonical.com>: Revert "ipc,sem: remove uneeded sem_undo_list lock usage in exit_sem()" Christian Borntraeger <borntraeger@de.ibm.com>: include/uapi/linux/swab.h: fix userspace breakage, use __BITS_PER_LONG for swap SeongJae Park <sjpark@amazon.de>: selftests/vm: add missed tests in run_vmtests Joe Perches <joe@perches.com>: get_maintainer: remove uses of P: for maintainer name Douglas Anderson <dianders@chromium.org>: scripts/get_maintainer.pl: deprioritize old Fixes: addresses Christoph Hellwig <hch@lst.de>: mm/swapfile.c: fix a comment in sys_swapon() Vasily Averin <vvs@virtuozzo.com>: mm/memcontrol.c: lost css_put in memcg_expand_shrinker_maps() Alexandru Ardelean <alexandru.ardelean@analog.com>: lib/string.c: update match_string() doc-strings with correct behavior Gavin Shan <gshan@redhat.com>: mm/vmscan.c: don't round up scan size for online memory cgroup Wei Yang <richardw.yang@linux.intel.com>: mm/sparsemem: pfn_to_page is not valid yet on SPARSEMEM Alexander Potapenko <glider@google.com>: lib/stackdepot.c: fix global out-of-bounds in stack_slabs Randy Dunlap <rdunlap@infradead.org>: MAINTAINERS: use tabs for SAFESETID MAINTAINERS | 8 - include/linux/compat.h | 29 ------ include/linux/ktime.h | 37 ------- include/linux/time32.h | 154 --------------------------------- include/linux/timekeeping32.h | 32 ------ include/linux/types.h | 5 - include/uapi/asm-generic/posix_types.h | 2 include/uapi/linux/swab.h | 4 include/uapi/linux/time.h | 22 ++-- ipc/sem.c | 6 - kernel/compat.c | 64 ------------- kernel/time/time.c | 43 --------- lib/stackdepot.c | 8 + lib/string.c | 16 +++ mm/memcontrol.c | 4 mm/sparse.c | 2 mm/swapfile.c | 2 mm/vmscan.c | 9 + scripts/get_maintainer.pl | 32 ------ tools/testing/selftests/vm/run_vmtests | 33 +++++++ 20 files changed, 93 insertions(+), 419 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-02-21 4:00 incoming Andrew Morton @ 2020-02-21 4:03 ` Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 1 sibling, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-02-21 4:03 UTC (permalink / raw) To: Linus Torvalds, linux-mm, mm-commits On Thu, 20 Feb 2020 20:00:30 -0800 Andrew Morton <akpm@linux-foundation.org> wrote: > - A few y2038 fixes which missed the merge window whiole dependencies > in NFS were being sorted out. > > - A bunch of fixes. Some minor, some not. 15 patches, based on ca7e1fd1026c5af6a533b4b5447e1d2f153e28f2 ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-02-21 4:00 incoming Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton @ 2020-02-21 18:21 ` Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev 2020-02-21 19:33 ` incoming Linus Torvalds 1 sibling, 2 replies; 389+ messages in thread From: Linus Torvalds @ 2020-02-21 18:21 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - A few y2038 fixes which missed the merge window whiole dependencies > in NFS were being sorted out. > > - A bunch of fixes. Some minor, some not. Hmm. Konstantin's nice lore script _used_ to pick up your patches, but now they don't. I'm not sure what changed. It worked with your big series of 118 patches. It doesn't work with this smaller series of fixes. I think the difference is that you've done something bad to your patch sending. That big series was properly threaded with each of the patches being a reply to the 'incoming' message. This series is not. Please, Andrew, can you make your email flow more consistent so that I can actually use the nice new tool to download a patch series? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-02-21 18:21 ` incoming Linus Torvalds @ 2020-02-21 18:32 ` Konstantin Ryabitsev 2020-02-27 9:59 ` incoming Vlastimil Babka 2020-02-21 19:33 ` incoming Linus Torvalds 1 sibling, 1 reply; 389+ messages in thread From: Konstantin Ryabitsev @ 2020-02-21 18:32 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote: > On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - A few y2038 fixes which missed the merge window whiole dependencies > > in NFS were being sorted out. > > > > - A bunch of fixes. Some minor, some not. > > Hmm. Konstantin's nice lore script _used_ to pick up your patches, but > now they don't. > > I'm not sure what changed. It worked with your big series of 118 patches. > > It doesn't work with this smaller series of fixes. > > I think the difference is that you've done something bad to your patch > sending. That big series was properly threaded with each of the > patches being a reply to the 'incoming' message. > > This series is not. This is correct -- each patch is posted without an in-reply-to, so public-inbox doesn't group them into a thread. E.g.: https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/ > > Please, Andrew, can you make your email flow more consistent so that I > can actually use the nice new tool to download a patch series? Andrew, I'll be happy to provide you with a helper tool if you can describe me your workflow. E.g. if you have a quilt directory of patches plus a series file, it could easily be a tiny wrapper like: send-patches --base-commit 1234abcd --cover cover.txt patchdir/series -K ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-02-21 18:32 ` incoming Konstantin Ryabitsev @ 2020-02-27 9:59 ` Vlastimil Babka 0 siblings, 0 replies; 389+ messages in thread From: Vlastimil Babka @ 2020-02-27 9:59 UTC (permalink / raw) To: Konstantin Ryabitsev, Linus Torvalds; +Cc: Andrew Morton, Linux-MM, mm-commits On 2/21/20 7:32 PM, Konstantin Ryabitsev wrote: > On Fri, Feb 21, 2020 at 10:21:19AM -0800, Linus Torvalds wrote: >> On Thu, Feb 20, 2020 at 8:00 PM Andrew Morton <akpm@linux-foundation.org> wrote: >> > >> > - A few y2038 fixes which missed the merge window whiole dependencies >> > in NFS were being sorted out. >> > >> > - A bunch of fixes. Some minor, some not. >> >> Hmm. Konstantin's nice lore script _used_ to pick up your patches, but >> now they don't. >> >> I'm not sure what changed. It worked with your big series of 118 patches. >> >> It doesn't work with this smaller series of fixes. >> >> I think the difference is that you've done something bad to your patch >> sending. That big series was properly threaded with each of the >> patches being a reply to the 'incoming' message. >> >> This series is not. > > This is correct -- each patch is posted without an in-reply-to, so > public-inbox doesn't group them into a thread. > > E.g.: > https://lore.kernel.org/linux-mm/20200221040350.84HaG%25akpm@linux-foundation.org/ > >> >> Please, Andrew, can you make your email flow more consistent so that I >> can actually use the nice new tool to download a patch series? > > Andrew, I'll be happy to provide you with a helper tool if you can > describe me your workflow. E.g. if you have a quilt directory of patches > plus a series file, it could easily be a tiny wrapper like: > > send-patches --base-commit 1234abcd --cover cover.txt patchdir/series Once/if there is such tool, could it perhaps instead of mass e-mailing create git commits, push them to korg repo and send a pull request? Thanks, Vlastimil > -K > ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-02-21 18:21 ` incoming Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev @ 2020-02-21 19:33 ` Linus Torvalds 1 sibling, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2020-02-21 19:33 UTC (permalink / raw) To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits Side note: I've obviously picked it up the old-fashioned way, but I had been looking forward to seeing if I could just automate this more. Linus On Fri, Feb 21, 2020 at 10:21 AM Linus Torvalds <torvalds@linux-foundation.org> wrote: > > Please, Andrew, can you make your email flow more consistent so that I > can actually use the nice new tool to download a patch series? > > Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-02-04 1:33 Andrew Morton 2020-02-04 2:27 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-02-04 1:33 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The rest of MM and the rest of everything else. Subsystems affected by this patch series: hotfixes mm/pagealloc mm/memory-hotplug ipc misc mm/cleanups mm/pagemap procfs lib cleanups arm Subsystem: hotfixes Gang He <GHe@suse.com>: ocfs2: fix oops when writing cloned file David Hildenbrand <david@redhat.com>: Patch series "mm: fix max_pfn not falling on section boundary", v2: mm/page_alloc.c: fix uninitialized memmaps on a partially populated last section fs/proc/page.c: allow inspection of last section and fix end detection mm/page_alloc.c: initialize memmap of unavailable memory directly Subsystem: mm/pagealloc David Hildenbrand <david@redhat.com>: mm/page_alloc: fix and rework pfn handling in memmap_init_zone() mm: factor out next_present_section_nr() Subsystem: mm/memory-hotplug "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6: mm/memmap_init: update variable name in memmap_init_zone David Hildenbrand <david@redhat.com>: mm/memory_hotplug: poison memmap in remove_pfn_range_from_zone() mm/memory_hotplug: we always have a zone in find_(smallest|biggest)_section_pfn mm/memory_hotplug: don't check for "all holes" in shrink_zone_span() mm/memory_hotplug: drop local variables in shrink_zone_span() mm/memory_hotplug: cleanup __remove_pages() mm/memory_hotplug: drop valid_start/valid_end from test_pages_in_a_zone() Subsystem: ipc Manfred Spraul <manfred@colorfullife.com>: smp_mb__{before,after}_atomic(): update Documentation Davidlohr Bueso <dave@stgolabs.net>: ipc/mqueue.c: remove duplicated code Manfred Spraul <manfred@colorfullife.com>: ipc/mqueue.c: update/document memory barriers ipc/msg.c: update and document memory barriers ipc/sem.c: document and update memory barriers Lu Shuaibing <shuaibinglu@126.com>: ipc/msg.c: consolidate all xxxctl_down() functions drivers/block/null_blk_main.c: fix layout Subsystem: misc Andrew Morton <akpm@linux-foundation.org>: drivers/block/null_blk_main.c: fix layout drivers/block/null_blk_main.c: fix uninitialized var warnings Randy Dunlap <rdunlap@infradead.org>: pinctrl: fix pxa2xx.c build warnings Subsystem: mm/cleanups Florian Westphal <fw@strlen.de>: mm: remove __krealloc Subsystem: mm/pagemap Steven Price <steven.price@arm.com>: Patch series "Generic page walk and ptdump", v17: mm: add generic p?d_leaf() macros arc: mm: add p?d_leaf() definitions arm: mm: add p?d_leaf() definitions arm64: mm: add p?d_leaf() definitions mips: mm: add p?d_leaf() definitions powerpc: mm: add p?d_leaf() definitions riscv: mm: add p?d_leaf() definitions s390: mm: add p?d_leaf() definitions sparc: mm: add p?d_leaf() definitions x86: mm: add p?d_leaf() definitions mm: pagewalk: add p4d_entry() and pgd_entry() mm: pagewalk: allow walking without vma mm: pagewalk: don't lock PTEs for walk_page_range_novma() mm: pagewalk: fix termination condition in walk_pte_range() mm: pagewalk: add 'depth' parameter to pte_hole x86: mm: point to struct seq_file from struct pg_state x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct mm: add generic ptdump x86: mm: convert dump_pagetables to use walk_page_range arm64: mm: convert mm/dump.c to use walk_page_range() arm64: mm: display non-present entries in ptdump mm: ptdump: reduce level numbers by 1 in note_page() x86: mm: avoid allocating struct mm_struct on the stack "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "Fixup page directory freeing", v4: powerpc/mmu_gather: enable RCU_TABLE_FREE even for !SMP case Peter Zijlstra <peterz@infradead.org>: mm/mmu_gather: invalidate TLB correctly on batch allocation failure and flush asm-generic/tlb: avoid potential double flush asm-gemeric/tlb: remove stray function declarations asm-generic/tlb: add missing CONFIG symbol asm-generic/tlb: rename HAVE_RCU_TABLE_FREE asm-generic/tlb: rename HAVE_MMU_GATHER_PAGE_SIZE asm-generic/tlb: rename HAVE_MMU_GATHER_NO_GATHER asm-generic/tlb: provide MMU_GATHER_TABLE_FREE Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: decouple proc from VFS with "struct proc_ops" proc: convert everything to "struct proc_ops" Subsystem: lib Yury Norov <yury.norov@gmail.com>: Patch series "lib: rework bitmap_parse", v5: lib/string: add strnchrnul() bitops: more BITS_TO_* macros lib: add test for bitmap_parse() lib: make bitmap_parse_user a wrapper on bitmap_parse lib: rework bitmap_parse() lib: new testcases for bitmap_parse{_user} include/linux/cpumask.h: don't calculate length of the input string Subsystem: cleanups Masahiro Yamada <masahiroy@kernel.org>: treewide: remove redundant IS_ERR() before error code check Subsystem: arm Chen-Yu Tsai <wens@csie.org>: ARM: dma-api: fix max_pfn off-by-one error in __dma_supported() Documentation/memory-barriers.txt | 14 arch/Kconfig | 17 arch/alpha/kernel/srm_env.c | 17 arch/arc/include/asm/pgtable.h | 1 arch/arm/Kconfig | 2 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 1 arch/arm/include/asm/tlb.h | 6 arch/arm/kernel/atags_proc.c | 8 arch/arm/mm/alignment.c | 14 arch/arm/mm/dma-mapping.c | 2 arch/arm64/Kconfig | 3 arch/arm64/Kconfig.debug | 19 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/ptdump.h | 8 arch/arm64/mm/Makefile | 4 arch/arm64/mm/dump.c | 152 ++---- arch/arm64/mm/mmu.c | 4 arch/arm64/mm/ptdump_debugfs.c | 2 arch/ia64/kernel/salinfo.c | 24 - arch/m68k/kernel/bootinfo_proc.c | 8 arch/mips/include/asm/pgtable.h | 5 arch/mips/lasat/picvue_proc.c | 31 - arch/powerpc/Kconfig | 7 arch/powerpc/include/asm/book3s/32/pgalloc.h | 8 arch/powerpc/include/asm/book3s/64/pgalloc.h | 2 arch/powerpc/include/asm/book3s/64/pgtable.h | 3 arch/powerpc/include/asm/nohash/pgalloc.h | 8 arch/powerpc/include/asm/tlb.h | 11 arch/powerpc/kernel/proc_powerpc.c | 10 arch/powerpc/kernel/rtas-proc.c | 70 +-- arch/powerpc/kernel/rtas_flash.c | 34 - arch/powerpc/kernel/rtasd.c | 14 arch/powerpc/mm/book3s64/pgtable.c | 7 arch/powerpc/mm/numa.c | 12 arch/powerpc/platforms/pseries/lpar.c | 24 - arch/powerpc/platforms/pseries/lparcfg.c | 14 arch/powerpc/platforms/pseries/reconfig.c | 8 arch/powerpc/platforms/pseries/scanlog.c | 15 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 7 arch/s390/Kconfig | 4 arch/s390/include/asm/pgtable.h | 2 arch/sh/mm/alignment.c | 17 arch/sparc/Kconfig | 3 arch/sparc/include/asm/pgtable_64.h | 2 arch/sparc/include/asm/tlb_64.h | 11 arch/sparc/kernel/led.c | 15 arch/um/drivers/mconsole_kern.c | 9 arch/um/kernel/exitcode.c | 15 arch/um/kernel/process.c | 15 arch/x86/Kconfig | 3 arch/x86/Kconfig.debug | 20 arch/x86/include/asm/pgtable.h | 10 arch/x86/include/asm/tlb.h | 4 arch/x86/kernel/cpu/mtrr/if.c | 21 arch/x86/mm/Makefile | 4 arch/x86/mm/debug_pagetables.c | 18 arch/x86/mm/dump_pagetables.c | 418 +++++------------- arch/x86/platform/efi/efi_32.c | 2 arch/x86/platform/efi/efi_64.c | 4 arch/x86/platform/uv/tlb_uv.c | 14 arch/xtensa/platforms/iss/simdisk.c | 10 crypto/af_alg.c | 2 drivers/acpi/battery.c | 15 drivers/acpi/proc.c | 15 drivers/acpi/scan.c | 2 drivers/base/memory.c | 9 drivers/block/null_blk_main.c | 58 +- drivers/char/hw_random/bcm2835-rng.c | 2 drivers/char/hw_random/omap-rng.c | 4 drivers/clk/clk.c | 2 drivers/dma/mv_xor_v2.c | 2 drivers/firmware/efi/arm-runtime.c | 2 drivers/gpio/gpiolib-devres.c | 2 drivers/gpio/gpiolib-of.c | 8 drivers/gpio/gpiolib.c | 2 drivers/hwmon/dell-smm-hwmon.c | 15 drivers/i2c/busses/i2c-mv64xxx.c | 5 drivers/i2c/busses/i2c-synquacer.c | 2 drivers/ide/ide-proc.c | 19 drivers/input/input.c | 28 - drivers/isdn/capi/kcapi_proc.c | 6 drivers/macintosh/via-pmu.c | 17 drivers/md/md.c | 15 drivers/misc/sgi-gru/gruprocfs.c | 42 - drivers/mtd/ubi/build.c | 2 drivers/net/wireless/cisco/airo.c | 126 ++--- drivers/net/wireless/intel/ipw2x00/libipw_module.c | 15 drivers/net/wireless/intersil/hostap/hostap_hw.c | 4 drivers/net/wireless/intersil/hostap/hostap_proc.c | 14 drivers/net/wireless/intersil/hostap/hostap_wlan.h | 2 drivers/net/wireless/ray_cs.c | 20 drivers/of/device.c | 2 drivers/parisc/led.c | 17 drivers/pci/controller/pci-tegra.c | 2 drivers/pci/proc.c | 25 - drivers/phy/phy-core.c | 4 drivers/pinctrl/pxa/pinctrl-pxa2xx.c | 1 drivers/platform/x86/thinkpad_acpi.c | 15 drivers/platform/x86/toshiba_acpi.c | 60 +- drivers/pnp/isapnp/proc.c | 9 drivers/pnp/pnpbios/proc.c | 17 drivers/s390/block/dasd_proc.c | 15 drivers/s390/cio/blacklist.c | 14 drivers/s390/cio/css.c | 11 drivers/scsi/esas2r/esas2r_main.c | 9 drivers/scsi/scsi_devinfo.c | 15 drivers/scsi/scsi_proc.c | 29 - drivers/scsi/sg.c | 30 - drivers/spi/spi-orion.c | 3 drivers/staging/rtl8192u/ieee80211/ieee80211_module.c | 14 drivers/tty/sysrq.c | 8 drivers/usb/gadget/function/rndis.c | 17 drivers/video/fbdev/imxfb.c | 2 drivers/video/fbdev/via/viafbdev.c | 105 ++-- drivers/zorro/proc.c | 9 fs/cifs/cifs_debug.c | 108 ++-- fs/cifs/dfs_cache.c | 13 fs/cifs/dfs_cache.h | 2 fs/ext4/super.c | 2 fs/f2fs/node.c | 2 fs/fscache/internal.h | 2 fs/fscache/object-list.c | 11 fs/fscache/proc.c | 2 fs/jbd2/journal.c | 13 fs/jfs/jfs_debug.c | 14 fs/lockd/procfs.c | 12 fs/nfsd/nfsctl.c | 13 fs/nfsd/stats.c | 12 fs/ocfs2/file.c | 14 fs/ocfs2/suballoc.c | 2 fs/proc/cpuinfo.c | 12 fs/proc/generic.c | 38 - fs/proc/inode.c | 76 +-- fs/proc/internal.h | 5 fs/proc/kcore.c | 13 fs/proc/kmsg.c | 14 fs/proc/page.c | 54 +- fs/proc/proc_net.c | 32 - fs/proc/proc_sysctl.c | 2 fs/proc/root.c | 2 fs/proc/stat.c | 12 fs/proc/task_mmu.c | 4 fs/proc/vmcore.c | 10 fs/sysfs/group.c | 2 include/asm-generic/pgtable.h | 20 include/asm-generic/tlb.h | 138 +++-- include/linux/bitmap.h | 8 include/linux/bitops.h | 4 include/linux/cpumask.h | 4 include/linux/memory_hotplug.h | 4 include/linux/mm.h | 6 include/linux/mmzone.h | 10 include/linux/pagewalk.h | 49 +- include/linux/proc_fs.h | 23 include/linux/ptdump.h | 24 - include/linux/seq_file.h | 13 include/linux/slab.h | 1 include/linux/string.h | 1 include/linux/sunrpc/stats.h | 4 ipc/mqueue.c | 123 ++++- ipc/msg.c | 62 +- ipc/sem.c | 66 +- ipc/util.c | 14 kernel/configs.c | 9 kernel/irq/proc.c | 42 - kernel/kallsyms.c | 12 kernel/latencytop.c | 14 kernel/locking/lockdep_proc.c | 15 kernel/module.c | 12 kernel/profile.c | 24 - kernel/sched/psi.c | 48 +- lib/bitmap.c | 195 ++++---- lib/string.c | 17 lib/test_bitmap.c | 105 ++++ mm/Kconfig.debug | 21 mm/Makefile | 1 mm/gup.c | 2 mm/hmm.c | 66 +- mm/memory_hotplug.c | 104 +--- mm/memremap.c | 2 mm/migrate.c | 5 mm/mincore.c | 1 mm/mmu_gather.c | 158 ++++-- mm/page_alloc.c | 75 +-- mm/pagewalk.c | 167 +++++-- mm/ptdump.c | 159 ++++++ mm/slab_common.c | 37 - mm/sparse.c | 10 mm/swapfile.c | 14 net/atm/mpoa_proc.c | 17 net/atm/proc.c | 8 net/core/dev.c | 2 net/core/filter.c | 2 net/core/pktgen.c | 44 - net/ipv4/ipconfig.c | 10 net/ipv4/netfilter/ipt_CLUSTERIP.c | 16 net/ipv4/route.c | 24 - net/netfilter/xt_recent.c | 17 net/sunrpc/auth_gss/svcauth_gss.c | 10 net/sunrpc/cache.c | 45 - net/sunrpc/stats.c | 21 net/xfrm/xfrm_policy.c | 2 samples/kfifo/bytestream-example.c | 11 samples/kfifo/inttype-example.c | 11 samples/kfifo/record-example.c | 11 scripts/coccinelle/free/devm_free.cocci | 4 sound/core/info.c | 34 - sound/soc/codecs/ak4104.c | 3 sound/soc/codecs/cs4270.c | 3 sound/soc/codecs/tlv320aic32x4.c | 6 sound/soc/sunxi/sun4i-spdif.c | 2 tools/include/linux/bitops.h | 9 214 files changed, 2589 insertions(+), 2227 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-02-04 1:33 incoming Andrew Morton @ 2020-02-04 2:27 ` Linus Torvalds 2020-02-04 2:46 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2020-02-04 2:27 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > The rest of MM and the rest of everything else. What's the base? You've changed your scripts or something, and that information is no longer in your cover letter.. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-02-04 2:27 ` incoming Linus Torvalds @ 2020-02-04 2:46 ` Andrew Morton 2020-02-04 3:11 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2020-02-04 2:46 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, Linux-MM On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > The rest of MM and the rest of everything else. > > What's the base? You've changed your scripts or something, and that > information is no longer in your cover letter.. > Crap, sorry, geriatric. d4e9056daedca3891414fe3c91de3449a5dad0f2 ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2020-02-04 2:46 ` incoming Andrew Morton @ 2020-02-04 3:11 ` Linus Torvalds 0 siblings, 0 replies; 389+ messages in thread From: Linus Torvalds @ 2020-02-04 3:11 UTC (permalink / raw) To: Andrew Morton; +Cc: mm-commits, Linux-MM On Tue, Feb 4, 2020 at 2:46 AM Andrew Morton <akpm@linux-foundation.org> wrote: > > On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > What's the base? You've changed your scripts or something, and that > > information is no longer in your cover letter.. > > Crap, sorry, geriatric. > > d4e9056daedca3891414fe3c91de3449a5dad0f2 Ok, I've tentatively applied it with the MIME decoding fixes I found, and I'll guess I'll let it build and sit for a while before merging it into my tree. I didn't find anything else odd in there. But... Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-01-31 6:10 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-01-31 6:10 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits Most of -mm and quite a number of other subsystems. MM is fairly quiet this time. Holidays, I assume. 119 patches, based on 39bed42de2e7d74686a2d5a45638d6a5d7e7d473: Subsystems affected by this patch series: hotfixes scripts ocfs2 mm/slub mm/kmemleak mm/debug mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/tracing mm/kasan mm/initialization mm/pagealloc mm/vmscan mm/tools mm/memblock mm/oom-kill mm/hugetlb mm/migration mm/mmap mm/memory-hotplug mm/zswap mm/cleanups mm/zram misc lib binfmt init reiserfs exec dma-mapping kcov Subsystem: hotfixes Andy Shevchenko <andriy.shevchenko@linux.intel.com>: lib/test_bitmap: correct test data offsets for 32-bit "Theodore Ts'o" <tytso@mit.edu>: memcg: fix a crash in wb_workfn when a device disappears Dan Carpenter <dan.carpenter@oracle.com>: mm/mempolicy.c: fix out of bounds write in mpol_parse_str() Pingfan Liu <kernelfans@gmail.com>: mm/sparse.c: reset section's mem_map when fully deactivated Wei Yang <richardw.yang@linux.intel.com>: mm/migrate.c: also overwrite error when it is bigger than zero Dan Williams <dan.j.williams@intel.com>: mm/memory_hotplug: fix remove_memory() lockdep splat Wei Yang <richardw.yang@linux.intel.com>: mm: thp: don't need care deferred split queue in memcg charge move path Yang Shi <yang.shi@linux.alibaba.com>: mm: move_pages: report the number of non-attempted pages Subsystem: scripts Xiong <xndchn@gmail.com>: scripts/spelling.txt: add more spellings to spelling.txt Luca Ceresoli <luca@lucaceresoli.net>: scripts/spelling.txt: add "issus" typo Subsystem: ocfs2 Aditya Pakki <pakki001@umn.edu>: fs: ocfs: remove unnecessary assertion in dlm_migrate_lockres zhengbin <zhengbin13@huawei.com>: ocfs2: remove unneeded semicolons Masahiro Yamada <masahiroy@kernel.org>: ocfs2: make local header paths relative to C files Colin Ian King <colin.king@canonical.com>: ocfs2/dlm: remove redundant assignment to ret Andy Shevchenko <andriy.shevchenko@linux.intel.com>: ocfs2/dlm: move BITS_TO_BYTES() to bitops.h for wider use wangyan <wangyan122@huawei.com>: ocfs2: fix a NULL pointer dereference when call ocfs2_update_inode_fsync_trans() ocfs2: use ocfs2_update_inode_fsync_trans() to access t_tid in handle->h_transaction Subsystem: mm/slub Yu Zhao <yuzhao@google.com>: mm/slub.c: avoid slub allocation while holding list_lock Subsystem: mm/kmemleak He Zhe <zhe.he@windriver.com>: mm/kmemleak: turn kmemleak_lock and object->lock to raw_spinlock_t Subsystem: mm/debug Vlastimil Babka <vbabka@suse.cz>: mm/debug.c: always print flags in dump_page() Subsystem: mm/pagecache Ira Weiny <ira.weiny@intel.com>: mm/filemap.c: clean up filemap_write_and_wait() Subsystem: mm/gup Qiujun Huang <hqjagain@gmail.com>: mm: fix gup_pud_range Wei Yang <richardw.yang@linux.intel.com>: mm/gup.c: use is_vm_hugetlb_page() to check whether to follow huge John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: prereqs to track dma-pinned pages: FOLL_PIN", v12: mm/gup: factor out duplicate code from four routines mm/gup: move try_get_compound_head() to top, fix minor issues Dan Williams <dan.j.williams@intel.com>: mm: Cleanup __put_devmap_managed_page() vs ->page_free() John Hubbard <jhubbard@nvidia.com>: mm: devmap: refactor 1-based refcounting for ZONE_DEVICE pages goldish_pipe: rename local pin_user_pages() routine mm: fix get_user_pages_remote()'s handling of FOLL_LONGTERM vfio: fix FOLL_LONGTERM use, simplify get_user_pages_remote() call mm/gup: allow FOLL_FORCE for get_user_pages_fast() IB/umem: use get_user_pages_fast() to pin DMA pages media/v4l2-core: set pages dirty upon releasing DMA buffers mm/gup: introduce pin_user_pages*() and FOLL_PIN goldish_pipe: convert to pin_user_pages() and put_user_page() IB/{core,hw,umem}: set FOLL_PIN via pin_user_pages*(), fix up ODP mm/process_vm_access: set FOLL_PIN via pin_user_pages_remote() drm/via: set FOLL_PIN via pin_user_pages_fast() fs/io_uring: set FOLL_PIN via pin_user_pages() net/xdp: set FOLL_PIN via pin_user_pages() media/v4l2-core: pin_user_pages (FOLL_PIN) and put_user_page() conversion vfio, mm: pin_user_pages (FOLL_PIN) and put_user_page() conversion powerpc: book3s64: convert to pin_user_pages() and put_user_page() mm/gup_benchmark: use proper FOLL_WRITE flags instead of hard-coding "1" mm, tree-wide: rename put_user_page*() to unpin_user_page*() Subsystem: mm/swap Vasily Averin <vvs@virtuozzo.com>: mm/swapfile.c: swap_next should increase position index Subsystem: mm/memcg Kaitao Cheng <pilgrimtao@gmail.com>: mm/memcontrol.c: cleanup some useless code Subsystem: mm/pagemap Li Xinhai <lixinhai.lxh@gmail.com>: mm/page_vma_mapped.c: explicitly compare pfn for normal, hugetlbfs and THP page Subsystem: mm/tracing Junyong Sun <sunjy516@gmail.com>: mm, tracing: print symbol name for kmem_alloc_node call_site events Subsystem: mm/kasan "Gustavo A. R. Silva" <gustavo@embeddedor.com>: lib/test_kasan.c: fix memory leak in kmalloc_oob_krealloc_more() Subsystem: mm/initialization Andy Shevchenko <andriy.shevchenko@linux.intel.com>: mm/early_ioremap.c: use %pa to print resource_size_t variables Subsystem: mm/pagealloc "Kirill A. Shutemov" <kirill@shutemov.name>: mm/page_alloc: skip non present sections on zone initialization David Hildenbrand <david@redhat.com>: mm: remove the memory isolate notifier mm: remove "count" parameter from has_unmovable_pages() Subsystem: mm/vmscan Liu Song <liu.song11@zte.com.cn>: mm/vmscan.c: remove unused return value of shrink_node Alex Shi <alex.shi@linux.alibaba.com>: mm/vmscan: remove prefetch_prev_lru_page mm/vmscan: remove unused RECLAIM_OFF/RECLAIM_ZONE Subsystem: mm/tools Daniel Wagner <dwagner@suse.de>: tools/vm/slabinfo: fix sanity checks enabling Subsystem: mm/memblock Anshuman Khandual <anshuman.khandual@arm.com>: mm/memblock: define memblock_physmem_add() memblock: Use __func__ in remaining memblock_dbg() call sites Subsystem: mm/oom-kill David Rientjes <rientjes@google.com>: mm, oom: dump stack of victim when reaping failed Subsystem: mm/hugetlb Wei Yang <richardw.yang@linux.intel.com>: mm/huge_memory.c: use head to check huge zero page mm/huge_memory.c: use head to emphasize the purpose of page mm/huge_memory.c: reduce critical section protected by split_queue_lock Subsystem: mm/migration Ralph Campbell <rcampbell@nvidia.com>: mm/migrate: remove useless mask of start address mm/migrate: clean up some minor coding style mm/migrate: add stable check in migrate_vma_insert_page() David Rientjes <rientjes@google.com>: mm, thp: fix defrag setting if newline is not used Subsystem: mm/mmap Miaohe Lin <linmiaohe@huawei.com>: mm/mmap.c: get rid of odd jump labels in find_mergeable_anon_vma() Subsystem: mm/memory-hotplug David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: pass in nid to online_pages()": mm/memory_hotplug: pass in nid to online_pages() Qian Cai <cai@lca.pw>: mm/hotplug: silence a lockdep splat with printk() mm/page_isolation: fix potential warning from user Subsystem: mm/zswap Vitaly Wool <vitaly.wool@konsulko.com>: mm/zswap.c: add allocation hysteresis if pool limit is hit Dan Carpenter <dan.carpenter@oracle.com>: zswap: potential NULL dereference on error in init_zswap() Subsystem: mm/cleanups Yu Zhao <yuzhao@google.com>: include/linux/mm.h: clean up obsolete check on space in page->flags Wei Yang <richardw.yang@linux.intel.com>: include/linux/mm.h: remove dead code totalram_pages_set() Anshuman Khandual <anshuman.khandual@arm.com>: include/linux/memory.h: drop fields 'hw' and 'phys_callback' from struct memory_block Hao Lee <haolee.swjtu@gmail.com>: mm: fix comments related to node reclaim Subsystem: mm/zram Taejoon Song <taejoon.song@lge.com>: zram: try to avoid worst-case scenario on same element pages Colin Ian King <colin.king@canonical.com>: drivers/block/zram/zram_drv.c: fix error return codes not being returned in writeback_store Subsystem: misc Akinobu Mita <akinobu.mita@gmail.com>: Patch series "add header file for kelvin to/from Celsius conversion: include/linux/units.h: add helpers for kelvin to/from Celsius conversion ACPI: thermal: switch to use <linux/units.h> helpers platform/x86: asus-wmi: switch to use <linux/units.h> helpers platform/x86: intel_menlow: switch to use <linux/units.h> helpers thermal: int340x: switch to use <linux/units.h> helpers thermal: intel_pch: switch to use <linux/units.h> helpers nvme: hwmon: switch to use <linux/units.h> helpers thermal: remove kelvin to/from Celsius conversion helpers from <linux/thermal.h> iwlegacy: use <linux/units.h> helpers iwlwifi: use <linux/units.h> helpers thermal: armada: remove unused TO_MCELSIUS macro iio: adc: qcom-vadc-common: use <linux/units.h> helpers Subsystem: lib Mikhail Zaslonko <zaslonko@linux.ibm.com>: Patch series "S390 hardware support for kernel zlib", v3: lib/zlib: add s390 hardware support for kernel zlib_deflate s390/boot: rename HEAP_SIZE due to name collision lib/zlib: add s390 hardware support for kernel zlib_inflate s390/boot: add dfltcc= kernel command line parameter lib/zlib: add zlib_deflate_dfltcc_enabled() function btrfs: use larger zlib buffer for s390 hardware compression Nathan Chancellor <natechancellor@gmail.com>: lib/scatterlist.c: adjust indentation in __sg_alloc_table Yury Norov <yury.norov@gmail.com>: uapi: rename ext2_swab() to swab() and share globally in swab.h lib/find_bit.c: join _find_next_bit{_le} lib/find_bit.c: uninline helper _find_next_bit() Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: smaller code generation around auxv vector fill fs/binfmt_elf.c: fix ->start_code calculation fs/binfmt_elf.c: don't copy ELF header around fs/binfmt_elf.c: better codegen around current->mm fs/binfmt_elf.c: make BAD_ADDR() unlikely fs/binfmt_elf.c: coredump: allocate core ELF header on stack fs/binfmt_elf.c: coredump: delete duplicated overflow check fs/binfmt_elf.c: coredump: allow process with empty address space to coredump Subsystem: init Arvind Sankar <nivedita@alum.mit.edu>: init/main.c: log arguments and environment passed to init init/main.c: remove unnecessary repair_env_string in do_initcall_level Patch series "init/main.c: minor cleanup/bugfix of envvar handling", v2: init/main.c: fix quoted value handling in unknown_bootoption Christophe Leroy <christophe.leroy@c-s.fr>: init/main.c: fix misleading "This architecture does not have kernel memory protection" message Subsystem: reiserfs Yunfeng Ye <yeyunfeng@huawei.com>: reiserfs: prevent NULL pointer dereference in reiserfs_insert_item() Subsystem: exec Alexey Dobriyan <adobriyan@gmail.com>: execve: warn if process starts with executable stack Subsystem: dma-mapping Andy Shevchenko <andriy.shevchenko@linux.intel.com>: include/linux/io-mapping.h-mapping: use PHYS_PFN() macro in io_mapping_map_atomic_wc() Subsystem: kcov Dmitry Vyukov <dvyukov@google.com>: kcov: ignore fault-inject and stacktrace Documentation/admin-guide/kernel-parameters.txt | 12 Documentation/core-api/index.rst | 1 Documentation/core-api/pin_user_pages.rst | 234 +++++ Documentation/vm/zswap.rst | 13 arch/powerpc/mm/book3s64/iommu_api.c | 14 arch/s390/boot/compressed/decompressor.c | 8 arch/s390/boot/ipl_parm.c | 14 arch/s390/include/asm/setup.h | 7 arch/s390/kernel/setup.c | 14 drivers/acpi/thermal.c | 34 drivers/base/memory.c | 25 drivers/block/zram/zram_drv.c | 10 drivers/gpu/drm/via/via_dmablit.c | 6 drivers/iio/adc/qcom-vadc-common.c | 6 drivers/iio/adc/qcom-vadc-common.h | 1 drivers/infiniband/core/umem.c | 21 drivers/infiniband/core/umem_odp.c | 13 drivers/infiniband/hw/hfi1/user_pages.c | 4 drivers/infiniband/hw/mthca/mthca_memfree.c | 8 drivers/infiniband/hw/qib/qib_user_pages.c | 4 drivers/infiniband/hw/qib/qib_user_sdma.c | 8 drivers/infiniband/hw/usnic/usnic_uiom.c | 4 drivers/infiniband/sw/siw/siw_mem.c | 4 drivers/media/v4l2-core/videobuf-dma-sg.c | 20 drivers/net/ethernet/broadcom/bnx2x/bnx2x_init.h | 1 drivers/net/wireless/intel/iwlegacy/4965-mac.c | 3 drivers/net/wireless/intel/iwlegacy/4965.c | 17 drivers/net/wireless/intel/iwlegacy/common.h | 3 drivers/net/wireless/intel/iwlwifi/dvm/dev.h | 5 drivers/net/wireless/intel/iwlwifi/dvm/devices.c | 6 drivers/nvdimm/pmem.c | 6 drivers/nvme/host/hwmon.c | 13 drivers/platform/goldfish/goldfish_pipe.c | 39 drivers/platform/x86/asus-wmi.c | 7 drivers/platform/x86/intel_menlow.c | 9 drivers/thermal/armada_thermal.c | 2 drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c | 7 drivers/thermal/intel/intel_pch_thermal.c | 3 drivers/vfio/vfio_iommu_type1.c | 39 fs/binfmt_elf.c | 154 +-- fs/btrfs/compression.c | 2 fs/btrfs/zlib.c | 135 ++ fs/exec.c | 5 fs/fs-writeback.c | 2 fs/io_uring.c | 6 fs/ocfs2/cluster/quorum.c | 2 fs/ocfs2/dlm/Makefile | 2 fs/ocfs2/dlm/dlmast.c | 8 fs/ocfs2/dlm/dlmcommon.h | 4 fs/ocfs2/dlm/dlmconvert.c | 8 fs/ocfs2/dlm/dlmdebug.c | 8 fs/ocfs2/dlm/dlmdomain.c | 8 fs/ocfs2/dlm/dlmlock.c | 8 fs/ocfs2/dlm/dlmmaster.c | 10 fs/ocfs2/dlm/dlmrecovery.c | 10 fs/ocfs2/dlm/dlmthread.c | 8 fs/ocfs2/dlm/dlmunlock.c | 8 fs/ocfs2/dlmfs/Makefile | 2 fs/ocfs2/dlmfs/dlmfs.c | 4 fs/ocfs2/dlmfs/userdlm.c | 6 fs/ocfs2/dlmglue.c | 2 fs/ocfs2/journal.h | 8 fs/ocfs2/namei.c | 3 fs/reiserfs/stree.c | 3 include/linux/backing-dev.h | 10 include/linux/bitops.h | 1 include/linux/fs.h | 6 include/linux/io-mapping.h | 5 include/linux/memblock.h | 7 include/linux/memory.h | 29 include/linux/memory_hotplug.h | 3 include/linux/mm.h | 116 +- include/linux/mmzone.h | 2 include/linux/page-isolation.h | 8 include/linux/swab.h | 1 include/linux/thermal.h | 11 include/linux/units.h | 84 + include/linux/zlib.h | 6 include/trace/events/kmem.h | 4 include/trace/events/writeback.h | 37 include/uapi/linux/swab.h | 10 include/uapi/linux/sysctl.h | 2 init/main.c | 36 kernel/Makefile | 1 lib/Kconfig | 7 lib/Makefile | 2 lib/decompress_inflate.c | 13 lib/find_bit.c | 82 - lib/scatterlist.c | 2 lib/test_bitmap.c | 9 lib/test_kasan.c | 1 lib/zlib_deflate/deflate.c | 85 + lib/zlib_deflate/deflate_syms.c | 1 lib/zlib_deflate/deftree.c | 54 - lib/zlib_deflate/defutil.h | 134 ++ lib/zlib_dfltcc/Makefile | 13 lib/zlib_dfltcc/dfltcc.c | 57 + lib/zlib_dfltcc/dfltcc.h | 155 +++ lib/zlib_dfltcc/dfltcc_deflate.c | 280 ++++++ lib/zlib_dfltcc/dfltcc_inflate.c | 149 +++ lib/zlib_dfltcc/dfltcc_syms.c | 17 lib/zlib_dfltcc/dfltcc_util.h | 123 ++ lib/zlib_inflate/inflate.c | 32 lib/zlib_inflate/inflate.h | 8 lib/zlib_inflate/infutil.h | 18 mm/Makefile | 1 mm/backing-dev.c | 1 mm/debug.c | 18 mm/early_ioremap.c | 8 mm/filemap.c | 34 mm/gup.c | 503 ++++++----- mm/gup_benchmark.c | 9 mm/huge_memory.c | 44 mm/kmemleak.c | 112 +- mm/memblock.c | 22 mm/memcontrol.c | 25 mm/memory_hotplug.c | 24 mm/mempolicy.c | 6 mm/memremap.c | 95 -- mm/migrate.c | 77 + mm/mmap.c | 30 mm/oom_kill.c | 2 mm/page_alloc.c | 83 + mm/page_isolation.c | 69 - mm/page_vma_mapped.c | 12 mm/process_vm_access.c | 32 mm/slub.c | 88 + mm/sparse.c | 2 mm/swap.c | 27 mm/swapfile.c | 2 mm/vmscan.c | 24 mm/zswap.c | 88 + net/xdp/xdp_umem.c | 4 scripts/spelling.txt | 14 tools/testing/selftests/vm/gup_benchmark.c | 6 tools/vm/slabinfo.c | 4 136 files changed, 2790 insertions(+), 1358 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-01-14 0:28 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-01-14 0:28 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 11 MM fixes, based on b3a987b0264d3ddbb24293ebff10eddfc472f653: Vlastimil Babka <vbabka@suse.cz>: mm, thp: tweak reclaim/compaction effort of local-only and all-node allocations David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't free usage map when removing a re-added early section "Kirill A. Shutemov" <kirill@shutemov.name>: Patch series "Fix two above-47bit hint address vs. THP bugs": mm/huge_memory.c: thp: fix conflict of above-47bit hint address and PMD alignment mm/shmem.c: thp, shmem: fix conflict of above-47bit hint address and PMD alignment Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix percpu slab vmstats flushing Vlastimil Babka <vbabka@suse.cz>: mm, debug_pagealloc: don't rely on static keys too early Wen Yang <wenyang@linux.alibaba.com>: Patch series "use div64_ul() instead of div_u64() if the divisor is: mm/page-writeback.c: avoid potential division by zero in wb_min_max_ratio() mm/page-writeback.c: use div64_ul() for u64-by-unsigned-long divide mm/page-writeback.c: improve arithmetic divisions Adrian Huang <ahuang12@lenovo.com>: mm: memcg/slab: call flush_memcg_workqueue() only if memcg workqueue is valid Yang Shi <yang.shi@linux.alibaba.com>: mm: khugepaged: add trace status description for SCAN_PAGE_HAS_PRIVATE include/linux/mm.h | 18 +++++++++- include/linux/mmzone.h | 5 +-- include/trace/events/huge_memory.h | 3 + init/main.c | 1 mm/huge_memory.c | 38 ++++++++++++++--------- mm/memcontrol.c | 37 +++++----------------- mm/mempolicy.c | 10 ++++-- mm/page-writeback.c | 10 +++--- mm/page_alloc.c | 61 ++++++++++--------------------------- mm/shmem.c | 7 ++-- mm/slab.c | 4 +- mm/slab_common.c | 3 + mm/slub.c | 2 - mm/sparse.c | 9 ++++- mm/vmalloc.c | 4 +- 15 files changed, 102 insertions(+), 110 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2020-01-04 20:55 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2020-01-04 20:55 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 17 fixes, base on 5613970af3f5f8372c596b138bd64f3918513515: David Hildenbrand <david@redhat.com>: mm/memory_hotplug: shrink zones when offlining memory Chanho Min <chanho.min@lge.com>: mm/zsmalloc.c: fix the migrated zspage statistics. Andrey Konovalov <andreyknvl@google.com>: kcov: fix struct layout for kcov_remote_arg Shakeel Butt <shakeelb@google.com>: memcg: account security cred as well to kmemcg Yang Shi <yang.shi@linux.alibaba.com>: mm: move_pages: return valid node id in status if the page is already on the target node Eric Biggers <ebiggers@google.com>: fs/direct-io.c: include fs/internal.h for missing prototype fs/nsfs.c: include headers for missing declarations fs/namespace.c: make to_mnt_ns() static Nick Desaulniers <ndesaulniers@google.com>: hexagon: parenthesize registers in asm predicates hexagon: work around compiler crash Randy Dunlap <rdunlap@infradead.org>: fs/posix_acl.c: fix kernel-doc warnings Ilya Dryomov <idryomov@gmail.com>: mm/oom: fix pgtables units mismatch in Killed process message Navid Emamdoost <navid.emamdoost@gmail.com>: mm/gup: fix memory leak in __gup_benchmark_ioctl Waiman Long <longman@redhat.com>: mm/hugetlb: defer freeing of huge pages if in non-task context Kai Li <li.kai4@h3c.com>: ocfs2: call journal flush to mark journal as empty after journal recovery when mount Gang He <GHe@suse.com>: ocfs2: fix the crash due to call ocfs2_get_dlm_debug once less Nick Desaulniers <ndesaulniers@google.com>: hexagon: define ioremap_uc Documentation/dev-tools/kcov.rst | 10 +++---- arch/arm64/mm/mmu.c | 4 -- arch/hexagon/include/asm/atomic.h | 8 ++--- arch/hexagon/include/asm/bitops.h | 8 ++--- arch/hexagon/include/asm/cmpxchg.h | 2 - arch/hexagon/include/asm/futex.h | 6 ++-- arch/hexagon/include/asm/io.h | 1 arch/hexagon/include/asm/spinlock.h | 20 +++++++------- arch/hexagon/kernel/stacktrace.c | 4 -- arch/hexagon/kernel/vm_entry.S | 2 - arch/ia64/mm/init.c | 4 -- arch/powerpc/mm/mem.c | 3 -- arch/s390/mm/init.c | 4 -- arch/sh/mm/init.c | 4 -- arch/x86/mm/init_32.c | 4 -- arch/x86/mm/init_64.c | 4 -- fs/direct-io.c | 2 + fs/namespace.c | 2 - fs/nsfs.c | 3 ++ fs/ocfs2/dlmglue.c | 1 fs/ocfs2/journal.c | 8 +++++ fs/posix_acl.c | 7 +++- include/linux/memory_hotplug.h | 7 +++- include/uapi/linux/kcov.h | 10 +++---- kernel/cred.c | 6 ++-- mm/gup_benchmark.c | 8 ++++- mm/hugetlb.c | 51 +++++++++++++++++++++++++++++++++++- mm/memory_hotplug.c | 31 +++++++++++---------- mm/memremap.c | 2 - mm/migrate.c | 23 ++++++++++++---- mm/oom_kill.c | 2 - mm/zsmalloc.c | 5 +++ 32 files changed, 166 insertions(+), 90 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-12-18 4:50 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-12-18 4:50 UTC (permalink / raw) To: Linus Torvalds; +Cc: linux-mm, mm-commits 6 fixes based on 2187f215ebaac73ddbd814696d7c7fa34f0c3de0: Andrey Ryabinin <aryabinin@virtuozzo.com>: kasan: fix crashes on access to memory mapped by vm_map_ram() Daniel Axtens <dja@axtens.net>: mm/memory.c: add apply_to_existing_page_range() helper kasan: use apply_to_existing_page_range() for releasing vmalloc shadow kasan: don't assume percpu shadow allocations will succeed Yang Shi <yang.shi@linux.alibaba.com>: mm: vmscan: protect shrinker idr replace with CONFIG_MEMCG Changbin Du <changbin.du@gmail.com>: lib/Kconfig.debug: fix some messed up configurations include/linux/kasan.h | 15 +++-- include/linux/mm.h | 3 + lib/Kconfig.debug | 100 ++++++++++++++++++------------------ mm/kasan/common.c | 36 ++++++++----- mm/memory.c | 136 ++++++++++++++++++++++++++++++++++---------------- mm/vmalloc.c | 133 ++++++++++++++++++++++++++++-------------------- mm/vmscan.c | 2 7 files changed, 260 insertions(+), 165 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-12-05 0:48 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-12-05 0:48 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Most of the rest of MM and various other things. Some Kconfig rework still awaits merges of dependent trees from linux-next. 86 patches, based on 63de37476ebd1e9bab6a9e17186dc5aa1da9ea99. Subsystems affected by this patch series: mm/hotfixes mm/memcg mm/vmstat mm/thp procfs sysctl misc notifiers core-kernel bitops lib checkpatch epoll binfmt init rapidio uaccess kcov ubsan ipc bitmap mm/pagemap Subsystem: mm/hotfixes zhong jiang <zhongjiang@huawei.com>: mm/kasan/common.c: fix compile error Subsystem: mm/memcg Roman Gushchin <guro@fb.com>: mm: memcg/slab: wait for !root kmem_cache refcnt killing on root kmem_cache destruction Subsystem: mm/vmstat Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/vmstat: add helpers to get vmstat item names for each enum type mm/memcontrol: use vmstat names for printing statistics Subsystem: mm/thp Yu Zhao <yuzhao@google.com>: mm/memory.c: replace is_zero_pfn with is_huge_zero_pmd for thp Subsystem: procfs Alexey Dobriyan <adobriyan@gmail.com>: proc: change ->nlink under proc_subdir_lock fs/proc/generic.c: delete useless "len" variable fs/proc/internal.h: shuffle "struct pde_opener" Miaohe Lin <linmiaohe@huawei.com>: include/linux/proc_fs.h: fix confusing macro arg name Krzysztof Kozlowski <krzk@kernel.org>: fs/proc/Kconfig: fix indentation Subsystem: sysctl Alessio Balsini <balsini@android.com>: include/linux/sysctl.h: inline braces for ctl_table and ctl_table_header Subsystem: misc Stephen Boyd <swboyd@chromium.org>: .gitattributes: use 'dts' diff driver for dts files Rikard Falkeborn <rikard.falkeborn@gmail.com>: linux/build_bug.h: change type to int Masahiro Yamada <yamada.masahiro@socionext.com>: linux/scc.h: make uapi linux/scc.h self-contained Krzysztof Kozlowski <krzk@kernel.org>: arch/Kconfig: fix indentation Joe Perches <joe@perches.com>: scripts/get_maintainer.pl: add signatures from Fixes: <badcommit> lines in commit message Andy Shevchenko <andriy.shevchenko@linux.intel.com>: kernel.h: update comment about simple_strto<foo>() functions auxdisplay: charlcd: deduplicate simple_strtoul() Subsystem: notifiers Xiaoming Ni <nixiaoming@huawei.com>: kernel/notifier.c: intercept duplicate registrations to avoid infinite loops kernel/notifier.c: remove notifier_chain_cond_register() kernel/notifier.c: remove blocking_notifier_chain_cond_register() Subsystem: core-kernel Nathan Chancellor <natechancellor@gmail.com>: kernel/profile.c: use cpumask_available to check for NULL cpumask Joe Perches <joe@perches.com>: kernel/sys.c: avoid copying possible padding bytes in copy_to_user Subsystem: bitops William Breathitt Gray <vilhelm.gray@gmail.com>: bitops: introduce the for_each_set_clump8 macro lib/test_bitmap.c: add for_each_set_clump8 test cases gpio: 104-dio-48e: utilize for_each_set_clump8 macro gpio: 104-idi-48: utilize for_each_set_clump8 macro gpio: gpio-mm: utilize for_each_set_clump8 macro gpio: ws16c48: utilize for_each_set_clump8 macro gpio: pci-idio-16: utilize for_each_set_clump8 macro gpio: pcie-idio-24: utilize for_each_set_clump8 macro gpio: uniphier: utilize for_each_set_clump8 macro gpio: 74x164: utilize the for_each_set_clump8 macro thermal: intel: intel_soc_dts_iosf: Utilize for_each_set_clump8 macro gpio: pisosr: utilize the for_each_set_clump8 macro gpio: max3191x: utilize the for_each_set_clump8 macro gpio: pca953x: utilize the for_each_set_clump8 macro Subsystem: lib Wei Yang <richardw.yang@linux.intel.com>: lib/rbtree: set successor's parent unconditionally lib/rbtree: get successor's color directly Laura Abbott <labbott@redhat.com>: lib/test_meminit.c: add bulk alloc/free tests Trent Piepho <tpiepho@gmail.com>: lib/math/rational.c: fix possible incorrect result from rational fractions helper Huang Shijie <sjhuang@iluvatar.ai>: lib/genalloc.c: export symbol addr_in_gen_pool lib/genalloc.c: rename addr_in_gen_pool to gen_pool_has_addr Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: improve ignoring CamelCase SI style variants like mA checkpatch: reduce is_maintained_obsolete lookup runtime Subsystem: epoll Jason Baron <jbaron@akamai.com>: epoll: simplify ep_poll_safewake() for CONFIG_DEBUG_LOCK_ALLOC Heiher <r@hev.cc>: fs/epoll: remove unnecessary wakeups of nested epoll selftests: add epoll selftests Subsystem: binfmt Alexey Dobriyan <adobriyan@gmail.com>: fs/binfmt_elf.c: delete unused "interp_map_addr" argument fs/binfmt_elf.c: extract elf_read() function Subsystem: init Krzysztof Kozlowski <krzk@kernel.org>: init/Kconfig: fix indentation Subsystem: rapidio "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: drivers/rapidio/rio-driver.c: fix missing include of <linux/rio_drv.h> drivers/rapidio/rio-access.c: fix missing include of <linux/rio_drv.h> Subsystem: uaccess Daniel Vetter <daniel.vetter@ffwll.ch>: drm: limit to INT_MAX in create_blob ioctl Kees Cook <keescook@chromium.org>: uaccess: disallow > INT_MAX copy sizes Subsystem: kcov Andrey Konovalov <andreyknvl@google.com>: Patch series " kcov: collect coverage from usb and vhost", v3: kcov: remote coverage support usb, kcov: collect coverage from hub_event vhost, kcov: collect coverage from vhost_worker Subsystem: ubsan Julien Grall <julien.grall@arm.com>: lib/ubsan: don't serialize UBSAN report Subsystem: ipc Masahiro Yamada <yamada.masahiro@socionext.com>: arch: ipcbuf.h: make uapi asm/ipcbuf.h self-contained arch: msgbuf.h: make uapi asm/msgbuf.h self-contained arch: sembuf.h: make uapi asm/sembuf.h self-contained Subsystem: bitmap Andy Shevchenko <andriy.shevchenko@linux.intel.com>: Patch series "gpio: pca953x: Convert to bitmap (extended) API", v2: lib/test_bitmap: force argument of bitmap_parselist_user() to proper address space lib/test_bitmap: undefine macros after use lib/test_bitmap: name EXP_BYTES properly lib/test_bitmap: rename exp to exp1 to avoid ambiguous name lib/test_bitmap: move exp1 and exp2 upper for others to use lib/test_bitmap: fix comment about this file lib/bitmap: introduce bitmap_replace() helper gpio: pca953x: remove redundant variable and check in IRQ handler gpio: pca953x: use input from regs structure in pca953x_irq_pending() gpio: pca953x: convert to use bitmap API gpio: pca953x: tighten up indentation Subsystem: mm/pagemap Mike Rapoport <rppt@linux.ibm.com>: Patch series "mm: remove __ARCH_HAS_4LEVEL_HACK", v13: alpha: use pgtable-nopud instead of 4level-fixup arm: nommu: use pgtable-nopud instead of 4level-fixup c6x: use pgtable-nopud instead of 4level-fixup m68k: nommu: use pgtable-nopud instead of 4level-fixup m68k: mm: use pgtable-nopXd instead of 4level-fixup microblaze: use pgtable-nopmd instead of 4level-fixup nds32: use pgtable-nopmd instead of 4level-fixup parisc: use pgtable-nopXd instead of 4level-fixup Helge Deller <deller@gmx.de>: parisc/hugetlb: use pgtable-nopXd instead of 4level-fixup Mike Rapoport <rppt@linux.ibm.com>: sparc32: use pgtable-nopud instead of 4level-fixup um: remove unused pxx_offset_proc() and addr_pte() functions um: add support for folded p4d page tables mm: remove __ARCH_HAS_4LEVEL_HACK and include/asm-generic/4level-fixup.h .gitattributes | 2 Documentation/core-api/genalloc.rst | 2 Documentation/dev-tools/kcov.rst | 129 arch/Kconfig | 22 arch/alpha/include/asm/mmzone.h | 1 arch/alpha/include/asm/pgalloc.h | 4 arch/alpha/include/asm/pgtable.h | 24 arch/alpha/mm/init.c | 12 arch/arm/include/asm/pgtable.h | 2 arch/arm/mm/dma-mapping.c | 2 arch/c6x/include/asm/pgtable.h | 2 arch/m68k/include/asm/mcf_pgalloc.h | 7 arch/m68k/include/asm/mcf_pgtable.h | 28 arch/m68k/include/asm/mmu_context.h | 12 arch/m68k/include/asm/motorola_pgalloc.h | 4 arch/m68k/include/asm/motorola_pgtable.h | 32 arch/m68k/include/asm/page.h | 9 arch/m68k/include/asm/pgtable_mm.h | 11 arch/m68k/include/asm/pgtable_no.h | 2 arch/m68k/include/asm/sun3_pgalloc.h | 5 arch/m68k/include/asm/sun3_pgtable.h | 18 arch/m68k/kernel/sys_m68k.c | 10 arch/m68k/mm/init.c | 6 arch/m68k/mm/kmap.c | 39 arch/m68k/mm/mcfmmu.c | 16 arch/m68k/mm/motorola.c | 17 arch/m68k/sun3x/dvma.c | 7 arch/microblaze/include/asm/page.h | 3 arch/microblaze/include/asm/pgalloc.h | 16 arch/microblaze/include/asm/pgtable.h | 32 arch/microblaze/kernel/signal.c | 10 arch/microblaze/mm/init.c | 7 arch/microblaze/mm/pgtable.c | 13 arch/mips/include/uapi/asm/msgbuf.h | 1 arch/mips/include/uapi/asm/sembuf.h | 2 arch/nds32/include/asm/page.h | 3 arch/nds32/include/asm/pgalloc.h | 3 arch/nds32/include/asm/pgtable.h | 12 arch/nds32/include/asm/tlb.h | 1 arch/nds32/kernel/pm.c | 4 arch/nds32/mm/fault.c | 16 arch/nds32/mm/init.c | 11 arch/nds32/mm/mm-nds32.c | 6 arch/nds32/mm/proc.c | 26 arch/parisc/include/asm/page.h | 30 arch/parisc/include/asm/pgalloc.h | 41 arch/parisc/include/asm/pgtable.h | 52 arch/parisc/include/asm/tlb.h | 2 arch/parisc/include/uapi/asm/msgbuf.h | 1 arch/parisc/include/uapi/asm/sembuf.h | 1 arch/parisc/kernel/cache.c | 13 arch/parisc/kernel/pci-dma.c | 9 arch/parisc/mm/fixmap.c | 10 arch/parisc/mm/hugetlbpage.c | 18 arch/powerpc/include/uapi/asm/msgbuf.h | 2 arch/powerpc/include/uapi/asm/sembuf.h | 2 arch/s390/include/uapi/asm/ipcbuf.h | 2 arch/sparc/include/asm/pgalloc_32.h | 6 arch/sparc/include/asm/pgtable_32.h | 28 arch/sparc/include/uapi/asm/ipcbuf.h | 2 arch/sparc/include/uapi/asm/msgbuf.h | 2 arch/sparc/include/uapi/asm/sembuf.h | 2 arch/sparc/mm/fault_32.c | 11 arch/sparc/mm/highmem.c | 6 arch/sparc/mm/io-unit.c | 6 arch/sparc/mm/iommu.c | 6 arch/sparc/mm/srmmu.c | 51 arch/um/include/asm/pgtable-2level.h | 1 arch/um/include/asm/pgtable-3level.h | 1 arch/um/include/asm/pgtable.h | 3 arch/um/kernel/mem.c | 8 arch/um/kernel/skas/mmu.c | 12 arch/um/kernel/skas/uaccess.c | 7 arch/um/kernel/tlb.c | 85 arch/um/kernel/trap.c | 4 arch/x86/include/uapi/asm/msgbuf.h | 3 arch/x86/include/uapi/asm/sembuf.h | 2 arch/xtensa/include/uapi/asm/ipcbuf.h | 2 arch/xtensa/include/uapi/asm/msgbuf.h | 2 arch/xtensa/include/uapi/asm/sembuf.h | 1 drivers/auxdisplay/charlcd.c | 34 drivers/base/node.c | 9 drivers/gpio/gpio-104-dio-48e.c | 75 drivers/gpio/gpio-104-idi-48.c | 36 drivers/gpio/gpio-74x164.c | 19 drivers/gpio/gpio-gpio-mm.c | 75 drivers/gpio/gpio-max3191x.c | 19 drivers/gpio/gpio-pca953x.c | 209 drivers/gpio/gpio-pci-idio-16.c | 75 drivers/gpio/gpio-pcie-idio-24.c | 111 drivers/gpio/gpio-pisosr.c | 12 drivers/gpio/gpio-uniphier.c | 13 drivers/gpio/gpio-ws16c48.c | 73 drivers/gpu/drm/drm_property.c | 2 drivers/misc/sram-exec.c | 2 drivers/rapidio/rio-access.c | 2 drivers/rapidio/rio-driver.c | 1 drivers/thermal/intel/intel_soc_dts_iosf.c | 31 drivers/thermal/intel/intel_soc_dts_iosf.h | 2 drivers/usb/core/hub.c | 5 drivers/vhost/vhost.c | 6 drivers/vhost/vhost.h | 1 fs/binfmt_elf.c | 56 fs/eventpoll.c | 52 fs/proc/Kconfig | 8 fs/proc/generic.c | 37 fs/proc/internal.h | 2 include/asm-generic/4level-fixup.h | 39 include/asm-generic/bitops/find.h | 17 include/linux/bitmap.h | 51 include/linux/bitops.h | 12 include/linux/build_bug.h | 4 include/linux/genalloc.h | 2 include/linux/kcov.h | 23 include/linux/kernel.h | 19 include/linux/mm.h | 10 include/linux/notifier.h | 4 include/linux/proc_fs.h | 4 include/linux/rbtree_augmented.h | 6 include/linux/sched.h | 8 include/linux/sysctl.h | 6 include/linux/thread_info.h | 2 include/linux/vmstat.h | 54 include/uapi/asm-generic/ipcbuf.h | 2 include/uapi/asm-generic/msgbuf.h | 2 include/uapi/asm-generic/sembuf.h | 1 include/uapi/linux/kcov.h | 28 include/uapi/linux/scc.h | 1 init/Kconfig | 78 kernel/dma/remap.c | 2 kernel/kcov.c | 547 + kernel/notifier.c | 45 kernel/profile.c | 6 kernel/sys.c | 4 lib/bitmap.c | 12 lib/find_bit.c | 14 lib/genalloc.c | 7 lib/math/rational.c | 63 lib/test_bitmap.c | 206 lib/test_meminit.c | 20 lib/ubsan.c | 64 mm/kasan/common.c | 1 mm/memcontrol.c | 52 mm/memory.c | 10 mm/slab_common.c | 12 mm/vmstat.c | 60 net/sunrpc/rpc_pipe.c | 2 scripts/checkpatch.pl | 13 scripts/get_maintainer.pl | 38 tools/testing/selftests/Makefile | 1 tools/testing/selftests/filesystems/epoll/.gitignore | 1 tools/testing/selftests/filesystems/epoll/Makefile | 7 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 3074 ++++++++++ usr/include/Makefile | 4 154 files changed, 5270 insertions(+), 1360 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-12-01 1:47 Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 0 siblings, 2 replies; 389+ messages in thread From: Andrew Morton @ 2019-12-01 1:47 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a small number of updates to scripts/, ocfs2 and fs/buffer.c - most of MM. I still have quite a lot of material (mostly not MM) staged after linux-next due to -next dependencies. I'll send thos across next week as the preprequisites get merged up. 158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646. Subsystems affected by this patch series: scripts ocfs2 vfs mm/slab mm/slub mm/pagecache mm/gup mm/swap mm/memcg mm/pagemap mm/memfd mm/memory-failure mm/memory-hotplug mm/sparsemem mm/vmalloc mm/kasan mm/pagealloc mm/vmscan mm/proc mm/z3fold mm/mempolicy mm/memblock mm/hugetlbfs mm/hugetlb mm/migration mm/thp mm/cma mm/autonuma mm/page-poison mm/mmap mm/madvise mm/userfaultfd mm/shmem mm/cleanups mm/support Subsystem: scripts Colin Ian King <colin.king@canonical.com>: scripts/spelling.txt: add more spellings to spelling.txt Subsystem: ocfs2 Ding Xiang <dingxiang@cmss.chinamobile.com>: ocfs2: fix passing zero to 'PTR_ERR' warning Subsystem: vfs Saurav Girepunje <saurav.girepunje@gmail.com>: fs/buffer.c: fix use true/false for bool type Ben Dooks <ben.dooks@codethink.co.uk>: fs/buffer.c: include internal.h for missing declarations Subsystem: mm/slab Pengfei Li <lpf.vector@gmail.com>: Patch series "mm, slab: Make kmalloc_info[] contain all types of names", v6: mm, slab: make kmalloc_info[] contain all types of names mm, slab: remove unused kmalloc_size() mm, slab_common: use enum kmalloc_cache_type to iterate over kmalloc caches Subsystem: mm/slub Miles Chen <miles.chen@mediatek.com>: mm: slub: print the offset of fault addresses Yu Zhao <yuzhao@google.com>: mm/slub.c: update comments mm/slub.c: clean up validate_slab() Subsystem: mm/pagecache Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/filemap.c: remove redundant cache invalidation after async direct-io write fs/direct-io.c: keep dio_warn_stale_pagecache() when CONFIG_BLOCK=n mm/filemap.c: warn if stale pagecache is left after direct write Subsystem: mm/gup zhong jiang <zhongjiang@huawei.com>: mm/gup.c: allow CMA migration to propagate errors back to caller Liu Xiang <liuxiang_1999@126.com>: mm/gup.c: fix comments of __get_user_pages() and get_user_pages_remote() Subsystem: mm/swap Naohiro Aota <naohiro.aota@wdc.com>: mm, swap: disallow swapon() on zoned block devices Fengguang Wu <fengguang.wu@intel.com>: mm/swap.c: trivial mark_page_accessed() cleanup Subsystem: mm/memcg Yafang Shao <laoar.shao@gmail.com>: mm, memcg: clean up reclaim iter array Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: remove dead code from memory_max_write() mm: memcontrol: try harder to set a new memory.high Hao Lee <haolee.swjtu@gmail.com>: include/linux/memcontrol.h: fix comments based on per-node memcg Shakeel Butt <shakeelb@google.com>: mm: vmscan: memcontrol: remove mem_cgroup_select_victim_node() Chris Down <chris@chrisdown.name>: Documentation/admin-guide/cgroup-v2.rst: document why inactive_X + active_X may not equal X Subsystem: mm/pagemap Johannes Weiner <hannes@cmpxchg.org>: mm: drop mmap_sem before calling balance_dirty_pages() in write fault "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: shmem: pin the file in shmem_fault() if mmap_sem is dropped "Joel Fernandes (Google)" <joel@joelfernandes.org>: mm: emit tracepoint when RSS changes rss_stat: add support to detect RSS updates of external mm Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: remove a never-triggered warning in __vma_adjust() Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/swap.c: piggyback lru_add_drain_all() calls Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: prev could be retrieved from vma->vm_prev mm/mmap.c: __vma_unlink_prev() is not necessary now mm/mmap.c: extract __vma_unlink_list() as counterpart for __vma_link_list() mm/mmap.c: rb_parent is not necessary in __vma_link_list() mm/rmap.c: don't reuse anon_vma if we just want a copy mm/rmap.c: reuse mergeable anon_vma as parent when fork Gaowei Pu <pugaowei@gmail.com>: mm/mmap.c: use IS_ERR_VALUE to check return value of get_unmapped_area Vineet Gupta <Vineet.Gupta1@synopsys.com>: Patch series "elide extraneous generated code for folded p4d/pud/pmd", v3: ARC: mm: remove __ARCH_USE_5LEVEL_HACK asm-generic/tlb: stub out pud_free_tlb() if nopud ... asm-generic/tlb: stub out p4d_free_tlb() if nop4d ... asm-generic/tlb: stub out pmd_free_tlb() if nopmd asm-generic/mm: stub out p{4,u}d_clear_bad() if __PAGETABLE_P{4,U}D_FOLDED Miles Chen <miles.chen@mediatek.com>: mm/rmap.c: fix outdated comment in page_get_anon_vma() Yang Shi <yang.shi@linux.alibaba.com>: mm/rmap.c: use VM_BUG_ON_PAGE() in __page_check_anon_rmap() Thomas Hellstrom <thellstrom@vmware.com>: mm: move the backup x_devmap() functions to asm-generic/pgtable.h mm/memory.c: fix a huge pud insertion race during faulting Steven Price <steven.price@arm.com>: Patch series "Generic page walk and ptdump", v15: mm: add generic p?d_leaf() macros arc: mm: add p?d_leaf() definitions arm: mm: add p?d_leaf() definitions arm64: mm: add p?d_leaf() definitions mips: mm: add p?d_leaf() definitions powerpc: mm: add p?d_leaf() definitions riscv: mm: add p?d_leaf() definitions s390: mm: add p?d_leaf() definitions sparc: mm: add p?d_leaf() definitions x86: mm: add p?d_leaf() definitions mm: pagewalk: add p4d_entry() and pgd_entry() mm: pagewalk: allow walking without vma mm: pagewalk: add test_p?d callbacks mm: pagewalk: add 'depth' parameter to pte_hole x86: mm: point to struct seq_file from struct pg_state x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct mm: add generic ptdump x86: mm: convert dump_pagetables to use walk_page_range arm64: mm: convert mm/dump.c to use walk_page_range() arm64: mm: display non-present entries in ptdump mm: ptdump: reduce level numbers by 1 in note_page() Subsystem: mm/memfd Nicolas Geoffray <ngeoffray@google.com>: mm, memfd: fix COW issue on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings "Joel Fernandes (Google)" <joel@joelfernandes.org>: memfd: add test for COW on MAP_PRIVATE and F_SEAL_FUTURE_WRITE mappings Subsystem: mm/memory-failure Jane Chu <jane.chu@oracle.com>: mm/memory-failure.c clean up around tk pre-allocation Naoya Horiguchi <nao.horiguchi@gmail.com>: mm, soft-offline: convert parameter to pfn Yunfeng Ye <yeyunfeng@huawei.com>: mm/memory-failure.c: use page_shift() in add_to_kill() Subsystem: mm/memory-hotplug Anshuman Khandual <anshuman.khandual@arm.com>: mm/hotplug: reorder memblock_[free|remove]() calls in try_remove_memory() Alastair D'Silva <alastair@d-silva.org>: mm/memory_hotplug.c: add a bounds check to __add_pages() David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: Export generic_online_page()": mm/memory_hotplug: export generic_online_page() hv_balloon: use generic_online_page() mm/memory_hotplug: remove __online_page_free() and __online_page_increment_counters() Patch series "mm: Memory offlining + page isolation cleanups", v2: mm/page_alloc.c: don't set pages PageReserved() when offlining mm/page_isolation.c: convert SKIP_HWPOISON to MEMORY_OFFLINE "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: include/linux/memory_hotplug.h: move definitions of {set,clear}_zone_contiguous David Hildenbrand <david@redhat.com>: drivers/base/memory.c: drop the mem_sysfs_mutex mm/memory_hotplug.c: don't allow to online/offline memory blocks with holes Subsystem: mm/sparsemem Vincent Whitchurch <vincent.whitchurch@axis.com>: mm/sparse: consistently do not zero memmap Ilya Leoshkevich <iii@linux.ibm.com>: mm/sparse.c: mark populate_section_memmap as __meminit Michal Hocko <mhocko@suse.com>: mm/sparse.c: do not waste pre allocated memmap space Subsystem: mm/vmalloc Liu Xiang <liuxiang_1999@126.com>: mm/vmalloc.c: remove unnecessary highmem_mask from parameter of gfpflags_allow_blocking() "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: remove preempt_disable/enable when doing preloading mm/vmalloc: respect passed gfp_mask when doing preloading mm/vmalloc: add more comments to the adjust_va_to_fit_type() Anders Roxell <anders.roxell@linaro.org>: selftests: vm: add fragment CONFIG_TEST_VMALLOC "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: rework vmap_area_lock Subsystem: mm/kasan Daniel Axtens <dja@axtens.net>: Patch series "kasan: support backing vmalloc space with real shadow: kasan: support backing vmalloc space with real shadow memory kasan: add test for vmalloc fork: support VMAP_STACK with KASAN_VMALLOC x86/kasan: support KASAN_VMALLOC Subsystem: mm/pagealloc Anshuman Khandual <anshuman.khandual@arm.com>: mm/page_alloc: add alloc_contig_pages() Mel Gorman <mgorman@techsingularity.net>: mm, pcp: share common code between memory hotplug and percpu sysctl handler mm, pcpu: make zone pcp updates and reset internal to the mm Hao Lee <haolee.swjtu@gmail.com>: include/linux/mmzone.h: fix comment for ISOLATE_UNMAPPED macro lijiazi <jqqlijiazi@gmail.com>: mm/page_alloc.c: print reserved_highatomic info Subsystem: mm/vmscan Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/vmscan: remove unused lru_pages argument Yang Shi <yang.shi@linux.alibaba.com>: mm/vmscan.c: remove unused scan_control parameter from pageout() Johannes Weiner <hannes@cmpxchg.org>: Patch series "mm: vmscan: cgroup-related cleanups": mm: vmscan: simplify lruvec_lru_size() mm: clean up and clarify lruvec lookup procedure mm: vmscan: move inactive_list_is_low() swap check to the caller mm: vmscan: naming fixes: global_reclaim() and sane_reclaim() mm: vmscan: replace shrink_node() loop with a retry jump mm: vmscan: turn shrink_node_memcg() into shrink_lruvec() mm: vmscan: split shrink_node() into node part and memcgs part mm: vmscan: harmonize writeback congestion tracking for nodes & memcgs Patch series "mm: fix page aging across multiple cgroups": mm: vmscan: move file exhaustion detection to the node level mm: vmscan: detect file thrashing at the reclaim root mm: vmscan: enforce inactive:active ratio at the reclaim root Xianting Tian <xianting_tian@126.com>: mm/vmscan.c: fix typo in comment Subsystem: mm/proc Johannes Weiner <hannes@cmpxchg.org>: kernel: sysctl: make drop_caches write-only Subsystem: mm/z3fold Vitaly Wool <vitaly.wool@konsulko.com>: mm/z3fold.c: add inter-page compaction Subsystem: mm/mempolicy Li Xinhai <lixinhai.lxh@gmail.com>: Patch series "mm: Fix checking unmapped holes for mbind", v4: mm/mempolicy.c: check range first in queue_pages_test_walk mm/mempolicy.c: fix checking unmapped holes for mbind Subsystem: mm/memblock Cao jin <caoj.fnst@cn.fujitsu.com>: mm/memblock.c: cleanup doc mm/memblock: correct doc for function Yunfeng Ye <yeyunfeng@huawei.com>: mm: support memblock alloc on the exact node for sparse_buffer_init() Subsystem: mm/hugetlbfs Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: hugetlb_fault_mutex_hash() cleanup mm/hugetlbfs: fix error handling when setting up mounts Patch series "hugetlbfs: convert macros to static inline, fix sparse warning": powerpc/mm: remove pmd_huge/pud_huge stubs and include hugetlb.h hugetlbfs: convert macros to static inline, fix sparse warning Piotr Sarna <p.sarna@tlen.pl>: hugetlbfs: add O_TMPFILE support Waiman Long <longman@redhat.com>: hugetlbfs: take read_lock on i_mmap for PMD sharing Subsystem: mm/hugetlb Mina Almasry <almasrymina@google.com>: hugetlb: region_chg provides only cache entry hugetlb: remove duplicated code Wei Yang <richardw.yang@linux.intel.com>: hugetlb: remove unused hstate in hugetlb_fault_mutex_hash() Zhigang Lu <tonnylu@tencent.com>: mm/hugetlb: avoid looping to the same hugepage if !pages and !vmas zhong jiang <zhongjiang@huawei.com>: mm/huge_memory.c: split_huge_pages_fops should be defined with DEFINE_DEBUGFS_ATTRIBUTE Subsystem: mm/migration Yang Shi <yang.shi@linux.alibaba.com>: mm/migrate.c: handle freed page at the first place Subsystem: mm/thp "Kirill A. Shutemov" <kirill@shutemov.name>: mm, thp: do not queue fully unmapped pages for deferred split Song Liu <songliubraving@fb.com>: mm/thp: flush file for !is_shmem PageDirty() case in collapse_file() Subsystem: mm/cma Yunfeng Ye <yeyunfeng@huawei.com>: mm/cma.c: switch to bitmap_zalloc() for cma bitmap allocation zhong jiang <zhongjiang@huawei.com>: mm/cma_debug.c: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops Subsystem: mm/autonuma Huang Ying <ying.huang@intel.com>: autonuma: fix watermark checking in migrate_balanced_pgdat() autonuma: reduce cache footprint when scanning page tables Subsystem: mm/page-poison zhong jiang <zhongjiang@huawei.com>: mm/hwpoison-inject: use DEFINE_DEBUGFS_ATTRIBUTE to define debugfs fops Subsystem: mm/mmap Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: make vma_merge() comment more easy to understand Subsystem: mm/madvise Yunfeng Ye <yeyunfeng@huawei.com>: mm/madvise.c: replace with page_size() in madvise_inject_error() Wei Yang <richardw.yang@linux.intel.com>: mm/madvise.c: use PAGE_ALIGN[ED] for range checking Subsystem: mm/userfaultfd Wei Yang <richardw.yang@linux.intel.com>: userfaultfd: use vma_pagesize for all huge page size calculation userfaultfd: remove unnecessary WARN_ON() in __mcopy_atomic_hugetlb() userfaultfd: wrap the common dst_vma check into an inlined function Andrea Arcangeli <aarcange@redhat.com>: fs/userfaultfd.c: wp: clear VM_UFFD_MISSING or VM_UFFD_WP during userfaultfd_register() Mike Rapoport <rppt@linux.ibm.com>: userfaultfd: require CAP_SYS_PTRACE for UFFD_FEATURE_EVENT_FORK Subsystem: mm/shmem Colin Ian King <colin.king@canonical.com>: mm/shmem.c: make array 'values' static const, makes object smaller Yang Shi <yang.shi@linux.alibaba.com>: mm: shmem: use proper gfp flags for shmem_writepage() Chen Jun <chenjun102@huawei.com>: mm/shmem.c: cast the type of unmap_start to u64 Subsystem: mm/cleanups Hao Lee <haolee.swjtu@gmail.com>: mm: fix struct member name in function comments Wei Yang <richardw.yang@linux.intel.com>: mm: fix typos in comments when calling __SetPageUptodate() Souptick Joarder <jrdr.linux@gmail.com>: mm/memory_hotplug.c: remove __online_page_set_limits() Krzysztof Kozlowski <krzk@kernel.org>: mm/Kconfig: fix indentation Randy Dunlap <rdunlap@infradead.org>: mm/Kconfig: fix trivial help text punctuation Subsystem: mm/support Minchan Kim <minchan@google.com>: mm/page_io.c: annotate refault stalls from swap_readpage Documentation/admin-guide/cgroup-v2.rst | 7 Documentation/dev-tools/kasan.rst | 63 + arch/Kconfig | 9 arch/arc/include/asm/pgtable.h | 2 arch/arc/mm/fault.c | 10 arch/arc/mm/highmem.c | 4 arch/arm/include/asm/pgtable-2level.h | 1 arch/arm/include/asm/pgtable-3level.h | 1 arch/arm64/Kconfig | 1 arch/arm64/Kconfig.debug | 19 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/ptdump.h | 8 arch/arm64/mm/Makefile | 4 arch/arm64/mm/dump.c | 148 +--- arch/arm64/mm/mmu.c | 4 arch/arm64/mm/ptdump_debugfs.c | 2 arch/mips/include/asm/pgtable.h | 5 arch/powerpc/include/asm/book3s/64/pgtable-4k.h | 3 arch/powerpc/include/asm/book3s/64/pgtable-64k.h | 3 arch/powerpc/include/asm/book3s/64/pgtable.h | 30 arch/powerpc/mm/book3s64/radix_pgtable.c | 1 arch/riscv/include/asm/pgtable-64.h | 7 arch/riscv/include/asm/pgtable.h | 7 arch/s390/include/asm/pgtable.h | 2 arch/sparc/include/asm/pgtable_64.h | 2 arch/x86/Kconfig | 2 arch/x86/Kconfig.debug | 20 arch/x86/include/asm/pgtable.h | 10 arch/x86/mm/Makefile | 4 arch/x86/mm/debug_pagetables.c | 8 arch/x86/mm/dump_pagetables.c | 431 +++--------- arch/x86/mm/kasan_init_64.c | 61 + arch/x86/platform/efi/efi_32.c | 2 arch/x86/platform/efi/efi_64.c | 4 drivers/base/memory.c | 40 - drivers/firmware/efi/arm-runtime.c | 2 drivers/hv/hv_balloon.c | 4 drivers/xen/balloon.c | 1 fs/buffer.c | 6 fs/direct-io.c | 21 fs/hugetlbfs/inode.c | 67 + fs/ocfs2/acl.c | 4 fs/proc/task_mmu.c | 4 fs/userfaultfd.c | 21 include/asm-generic/4level-fixup.h | 1 include/asm-generic/5level-fixup.h | 1 include/asm-generic/pgtable-nop4d.h | 2 include/asm-generic/pgtable-nopmd.h | 2 include/asm-generic/pgtable-nopud.h | 2 include/asm-generic/pgtable.h | 71 ++ include/asm-generic/tlb.h | 4 include/linux/fs.h | 6 include/linux/gfp.h | 2 include/linux/hugetlb.h | 142 +++- include/linux/kasan.h | 31 include/linux/memblock.h | 3 include/linux/memcontrol.h | 51 - include/linux/memory_hotplug.h | 11 include/linux/mm.h | 42 - include/linux/mmzone.h | 34 include/linux/moduleloader.h | 2 include/linux/page-isolation.h | 4 include/linux/pagewalk.h | 42 - include/linux/ptdump.h | 22 include/linux/slab.h | 20 include/linux/string.h | 2 include/linux/swap.h | 2 include/linux/vmalloc.h | 12 include/trace/events/kmem.h | 53 + kernel/events/uprobes.c | 2 kernel/fork.c | 4 kernel/sysctl.c | 2 lib/Kconfig.kasan | 16 lib/test_kasan.c | 26 lib/vsprintf.c | 40 - mm/Kconfig | 40 - mm/Kconfig.debug | 21 mm/Makefile | 1 mm/cma.c | 6 mm/cma_debug.c | 10 mm/filemap.c | 56 - mm/gup.c | 40 - mm/hmm.c | 8 mm/huge_memory.c | 2 mm/hugetlb.c | 298 ++------ mm/hwpoison-inject.c | 4 mm/internal.h | 27 mm/kasan/common.c | 233 ++++++ mm/kasan/generic_report.c | 3 mm/kasan/kasan.h | 1 mm/khugepaged.c | 18 mm/madvise.c | 14 mm/memblock.c | 113 ++- mm/memcontrol.c | 167 ---- mm/memory-failure.c | 61 - mm/memory.c | 56 + mm/memory_hotplug.c | 86 +- mm/mempolicy.c | 59 + mm/migrate.c | 21 mm/mincore.c | 1 mm/mmap.c | 75 -- mm/mprotect.c | 8 mm/mremap.c | 4 mm/nommu.c | 10 mm/page_alloc.c | 137 +++ mm/page_io.c | 15 mm/page_isolation.c | 12 mm/pagewalk.c | 126 ++- mm/pgtable-generic.c | 9 mm/ptdump.c | 167 ++++ mm/rmap.c | 65 + mm/shmem.c | 29 mm/slab.c | 7 mm/slab.h | 6 mm/slab_common.c | 101 +- mm/slub.c | 36 - mm/sparse.c | 22 mm/swap.c | 29 mm/swapfile.c | 7 mm/userfaultfd.c | 77 +- mm/util.c | 22 mm/vmalloc.c | 196 +++-- mm/vmscan.c | 798 +++++++++++------------ mm/workingset.c | 75 +- mm/z3fold.c | 375 ++++++++-- scripts/spelling.txt | 28 tools/testing/selftests/memfd/memfd_test.c | 36 + tools/testing/selftests/vm/config | 1 128 files changed, 3409 insertions(+), 2121 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-12-01 1:47 incoming Andrew Morton @ 2019-12-01 5:17 ` James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 1 sibling, 0 replies; 389+ messages in thread From: James Bottomley @ 2019-12-01 5:17 UTC (permalink / raw) To: Andrew Morton, Linus Torvalds; +Cc: mm-commits, linux-mm On Sat, 2019-11-30 at 17:47 -0800, Andrew Morton wrote: > - a small number of updates to scripts/, ocfs2 and fs/buffer.c > > - most of MM. I still have quite a lot of material (mostly not MM) > staged after linux-next due to -next dependencies. I'll send thos > across next week as the preprequisites get merged up. > > 158 patches, based on 32ef9553635ab1236c33951a8bd9b5af1c3b1646. Hey, Andrew, would it be at all possible for you to thread these patches under something like this incoming message? The selfish reason I'm asking is so I can mark the thread as read instead of having to do it individually for 158 messages ... my thumb would thank you for this. Regards, James ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-12-01 1:47 incoming Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley @ 2019-12-01 21:07 ` Linus Torvalds 2019-12-02 8:21 ` incoming Steven Price 1 sibling, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2019-12-01 21:07 UTC (permalink / raw) To: Andrew Morton, Steven Price; +Cc: mm-commits, Linux-MM On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > Steven Price <steven.price@arm.com>: > Patch series "Generic page walk and ptdump", v15: > mm: add generic p?d_leaf() macros > arc: mm: add p?d_leaf() definitions > arm: mm: add p?d_leaf() definitions > arm64: mm: add p?d_leaf() definitions > mips: mm: add p?d_leaf() definitions > powerpc: mm: add p?d_leaf() definitions > riscv: mm: add p?d_leaf() definitions > s390: mm: add p?d_leaf() definitions > sparc: mm: add p?d_leaf() definitions > x86: mm: add p?d_leaf() definitions > mm: pagewalk: add p4d_entry() and pgd_entry() > mm: pagewalk: allow walking without vma > mm: pagewalk: add test_p?d callbacks > mm: pagewalk: add 'depth' parameter to pte_hole > x86: mm: point to struct seq_file from struct pg_state > x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct > x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct > x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct > mm: add generic ptdump > x86: mm: convert dump_pagetables to use walk_page_range > arm64: mm: convert mm/dump.c to use walk_page_range() > arm64: mm: display non-present entries in ptdump > mm: ptdump: reduce level numbers by 1 in note_page() I've dropped these, and since they clearly weren't ready I don't want to see them re-sent for 5.5. If somebody figures out the bug, trying again for 5.6 sounds fine. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-12-01 21:07 ` incoming Linus Torvalds @ 2019-12-02 8:21 ` Steven Price 0 siblings, 0 replies; 389+ messages in thread From: Steven Price @ 2019-12-02 8:21 UTC (permalink / raw) To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM On Sun, Dec 01, 2019 at 09:07:47PM +0000, Linus Torvalds wrote: > On Sat, Nov 30, 2019 at 5:47 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > Steven Price <steven.price@arm.com>: > > Patch series "Generic page walk and ptdump", v15: > > mm: add generic p?d_leaf() macros > > arc: mm: add p?d_leaf() definitions > > arm: mm: add p?d_leaf() definitions > > arm64: mm: add p?d_leaf() definitions > > mips: mm: add p?d_leaf() definitions > > powerpc: mm: add p?d_leaf() definitions > > riscv: mm: add p?d_leaf() definitions > > s390: mm: add p?d_leaf() definitions > > sparc: mm: add p?d_leaf() definitions > > x86: mm: add p?d_leaf() definitions > > mm: pagewalk: add p4d_entry() and pgd_entry() > > mm: pagewalk: allow walking without vma > > mm: pagewalk: add test_p?d callbacks > > mm: pagewalk: add 'depth' parameter to pte_hole > > x86: mm: point to struct seq_file from struct pg_state > > x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct > > x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct > > x86: mm: convert ptdump_walk_pgd_level_core() to take an mm_struct > > mm: add generic ptdump > > x86: mm: convert dump_pagetables to use walk_page_range > > arm64: mm: convert mm/dump.c to use walk_page_range() > > arm64: mm: display non-present entries in ptdump > > mm: ptdump: reduce level numbers by 1 in note_page() > > I've dropped these, and since they clearly weren't ready I don't want > to see them re-sent for 5.5. Sorry about this, I'll try to track down the cause of this and hopefully resubmit for 5.6. Thanks, Steve > If somebody figures out the bug, trying again for 5.6 sounds fine. > > Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-11-22 1:53 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-11-22 1:53 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 4 fixes, based on 81429eb8d9ca40b0c65bb739d29fa856c5d5e958: Vincent Whitchurch <vincent.whitchurch@axis.com>: mm/sparse: consistently do not zero memmap Joseph Qi <joseph.qi@linux.alibaba.com>: Revert "fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry()" David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't access uninitialized memmaps in shrink_zone_span() Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/ksm.c: don't WARN if page is still mapped in remove_stable_node() fs/ocfs2/xattr.c | 56 ++++++++++++++++++++++++++++++---------------------- mm/ksm.c | 14 ++++++------- mm/memory_hotplug.c | 16 ++++++++++++-- mm/sparse.c | 2 - 4 files changed, 54 insertions(+), 34 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-11-16 1:34 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-11-16 1:34 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 875fef493f21e54d20d71a581687990aaa50268c: Yang Shi <yang.shi@linux.alibaba.com>: mm: mempolicy: fix the wrong return value and potential pages leak of mbind zhong jiang <zhongjiang@huawei.com>: mm: fix trying to reclaim unevictable lru page when calling madvise_pageout Lasse Collin <lasse.collin@tukaani.org>: lib/xz: fix XZ_DYNALLOC to avoid useless memory reallocations Roman Gushchin <guro@fb.com>: mm: memcg: switch to css_tryget() in get_mem_cgroup_from_mm() mm: hugetlb: switch to css_tryget() in hugetlb_cgroup_charge_cgroup() Laura Abbott <labbott@redhat.com>: mm: slub: really fix slab walking for init_on_free Song Liu <songliubraving@fb.com>: mm,thp: recheck each page before collapsing file THP David Hildenbrand <david@redhat.com>: mm/memory_hotplug: fix try_offline_node() Vinayak Menon <vinmenon@codeaurora.org>: mm/page_io.c: do not free shared swap slots Ralph Campbell <rcampbell@nvidia.com>: mm/debug.c: __dump_page() prints an extra line mm/debug.c: PageAnon() is true for PageKsm() pages drivers/base/memory.c | 36 ++++++++++++++++++++++++++++++++++++ include/linux/memory.h | 1 + lib/xz/xz_dec_lzma2.c | 1 + mm/debug.c | 33 ++++++++++++++++++--------------- mm/hugetlb_cgroup.c | 2 +- mm/khugepaged.c | 28 ++++++++++++++++------------ mm/madvise.c | 16 ++++++++++++---- mm/memcontrol.c | 2 +- mm/memory_hotplug.c | 47 +++++++++++++++++++++++++++++------------------ mm/mempolicy.c | 14 +++++++++----- mm/page_io.c | 6 +++--- mm/slub.c | 39 +++++++++------------------------------ 12 files changed, 136 insertions(+), 89 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-11-06 5:16 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-11-06 5:16 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 17 fixes, based on 26bc672134241a080a83b2ab9aa8abede8d30e1c: Shakeel Butt <shakeelb@google.com>: mm: memcontrol: fix NULL-ptr deref in percpu stats flush John Hubbard <jhubbard@nvidia.com>: mm/gup_benchmark: fix MAP_HUGETLB case Mel Gorman <mgorman@techsingularity.net>: mm, meminit: recalculate pcpu batch and high limits after init completes Yang Shi <yang.shi@linux.alibaba.com>: mm: thp: handle page cache THP correctly in PageTransCompoundMap Shuning Zhang <sunny.s.zhang@oracle.com>: ocfs2: protect extent tree in ocfs2_prepare_inode_for_write() Jason Gunthorpe <jgg@mellanox.com>: mm/mmu_notifiers: use the right return code for WARN_ON Michal Hocko <mhocko@suse.com>: mm, vmstat: hide /proc/pagetypeinfo from normal users mm, vmstat: reduce zone->lock holding time by /proc/pagetypeinfo Ville Syrjälä <ville.syrjala@linux.intel.com>: mm/khugepaged: fix might_sleep() warn with CONFIG_HIGHPTE=y Johannes Weiner <hannes@cmpxchg.org>: mm/page_alloc.c: ratelimit allocation failure warnings more aggressively Vitaly Wool <vitaly.wool@konsulko.com>: zswap: add Vitaly to the maintainers list Kevin Hao <haokexin@gmail.com>: dump_stack: avoid the livelock of the dump_lock Song Liu <songliubraving@fb.com>: MAINTAINERS: update information for "MEMORY MANAGEMENT" Roman Gushchin <guro@fb.com>: mm: slab: make page_cgroup_ino() to recognize non-compound slab pages properly Ilya Leoshkevich <iii@linux.ibm.com>: scripts/gdb: fix debugging modules compiled with hot/cold partitioning David Hildenbrand <david@redhat.com>: mm/memory_hotplug: fix updating the node span Johannes Weiner <hannes@cmpxchg.org>: mm: memcontrol: fix network errors from failing __GFP_ATOMIC charges MAINTAINERS | 5 + fs/ocfs2/file.c | 125 ++++++++++++++++++++++------- include/linux/mm.h | 5 - include/linux/mm_types.h | 5 + include/linux/page-flags.h | 20 ++++ lib/dump_stack.c | 7 + mm/khugepaged.c | 7 - mm/memcontrol.c | 23 +++-- mm/memory_hotplug.c | 8 + mm/mmu_notifier.c | 2 mm/page_alloc.c | 17 ++- mm/slab.h | 4 mm/vmstat.c | 25 ++++- scripts/gdb/linux/symbols.py | 3 tools/testing/selftests/vm/gup_benchmark.c | 2 15 files changed, 197 insertions(+), 61 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-10-19 3:19 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-10-19 3:19 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm Rather a lot of fixes, almost all affecting mm/. 26 patches, based on b9959c7a347d6adbb558fba7e36e9fef3cba3b07: David Hildenbrand <david@redhat.com>: drivers/base/memory.c: don't access uninitialized memmaps in soft_offline_page_store() fs/proc/page.c: don't access uninitialized memmaps in fs/proc/page.c mm/memory-failure.c: don't access uninitialized memmaps in memory_failure() Joel Colledge <joel.colledge@linbit.com>: scripts/gdb: fix lx-dmesg when CONFIG_PRINTK_CALLER is set Qian Cai <cai@lca.pw>: mm/page_owner: don't access uninitialized memmaps when reading /proc/pagetypeinfo David Hildenbrand <david@redhat.com>: mm/memory_hotplug: don't access uninitialized memmaps in shrink_pgdat_span() "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>: Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6: mm/memunmap: don't access uninitialized memmap in memunmap_pages() Roman Gushchin <guro@fb.com>: mm: memcg/slab: fix panic in __free_slab() caused by premature memcg pointer release Chengguang Xu <cgxu519@mykernel.net>: ocfs2: fix error handling in ocfs2_setattr() John Hubbard <jhubbard@nvidia.com>: mm/gup_benchmark: add a missing "w" to getopt string mm/gup: fix a misnamed "write" argument, and a related bug Honglei Wang <honglei.wang@oracle.com>: mm: memcg: get number of pages on the LRU list in memcgroup base on lru_zone_size Mike Rapoport <rppt@linux.ibm.com>: mm: memblock: do not enforce current limit for memblock_phys* family David Hildenbrand <david@redhat.com>: hugetlbfs: don't access uninitialized memmaps in pfn_range_valid_gigantic() Yi Li <yilikernel@gmail.com>: ocfs2: fix panic due to ocfs2_wq is null Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/memcontrol: update lruvec counters in mem_cgroup_move_account Chenwandun <chenwandun@huawei.com>: zram: fix race between backing_dev_show and backing_dev_store Ben Dooks <ben.dooks@codethink.co.uk>: mm: include <linux/huge_mm.h> for is_vma_temporary_stack mm/filemap.c: include <linux/ramfs.h> for generic_file_vm_ops definition "Ben Dooks (Codethink)" <ben.dooks@codethink.co.uk>: mm/init-mm.c: include <linux/mman.h> for vm_committed_as_batch "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: Patch series "Fixes for THP in page cache", v2: proc/meminfo: fix output alignment mm/thp: fix node page state in split_huge_page_to_list() William Kucharski <william.kucharski@oracle.com>: mm/vmscan.c: support removing arbitrary sized pages from mapping "Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>: mm/thp: allow dropping THP from page cache Song Liu <songliubraving@fb.com>: kernel/events/uprobes.c: only do FOLL_SPLIT_PMD for uprobe register Ilya Leoshkevich <iii@linux.ibm.com>: scripts/gdb: fix debugging modules on s390 drivers/base/memory.c | 3 + drivers/block/zram/zram_drv.c | 5 + fs/ocfs2/file.c | 2 fs/ocfs2/journal.c | 3 - fs/ocfs2/localalloc.c | 3 - fs/proc/meminfo.c | 4 - fs/proc/page.c | 28 ++++++---- kernel/events/uprobes.c | 13 ++++- mm/filemap.c | 1 mm/gup.c | 14 +++-- mm/huge_memory.c | 9 ++- mm/hugetlb.c | 5 - mm/init-mm.c | 1 mm/memblock.c | 6 +- mm/memcontrol.c | 18 ++++--- mm/memory-failure.c | 14 +++-- mm/memory_hotplug.c | 74 ++++++----------------------- mm/memremap.c | 11 ++-- mm/page_owner.c | 5 + mm/rmap.c | 1 mm/slab_common.c | 9 +-- mm/truncate.c | 12 ++++ mm/vmscan.c | 14 ++--- scripts/gdb/linux/dmesg.py | 16 ++++-- scripts/gdb/linux/symbols.py | 8 ++- scripts/gdb/linux/utils.py | 25 +++++---- tools/testing/selftests/vm/gup_benchmark.c | 2 27 files changed, 166 insertions(+), 140 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-10-14 21:11 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-10-14 21:11 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The usual shower of hotfixes and some followups to the recently merged page_owner enhancements. 16 patches, based on 2abd839aa7e615f2bbc50c8ba7deb9e40d186768. Subsystems affected by this patch series: Vlastimil Babka <vbabka@suse.cz>: Patch series "followups to debug_pagealloc improvements through page_owner", v3: mm, page_owner: fix off-by-one error in __set_page_owner_handle() mm, page_owner: decouple freeing stack trace from debug_pagealloc mm, page_owner: rename flag indicating that page is allocated Qian Cai <cai@lca.pw>: mm/slub: fix a deadlock in show_slab_objects() Eric Biggers <ebiggers@google.com>: lib/generic-radix-tree.c: add kmemleak annotations Alexander Potapenko <glider@google.com>: mm/slub.c: init_on_free=1 should wipe freelist ptr for bulk allocations lib/test_meminit: add a kmem_cache_alloc_bulk() test David Rientjes <rientjes@google.com>: mm, hugetlb: allow hugepage allocations to reclaim as needed Vlastimil Babka <vbabka@suse.cz>: mm, compaction: fix wrong pfn handling in __reset_isolation_pfn() Randy Dunlap <rdunlap@infradead.org>: fs/direct-io.c: fix kernel-doc warning fs/libfs.c: fix kernel-doc warning fs/fs-writeback.c: fix kernel-doc warning bitmap.h: fix kernel-doc warning and typo xarray.h: fix kernel-doc warning mm/slab.c: fix kernel-doc warning for __ksize() Jane Chu <jane.chu@oracle.com>: mm/memory-failure: poison read receives SIGKILL instead of SIGBUS if mmaped more than once Documentation/dev-tools/kasan.rst | 3 ++ fs/direct-io.c | 3 -- fs/fs-writeback.c | 2 - fs/libfs.c | 3 -- include/linux/bitmap.h | 3 +- include/linux/page_ext.h | 10 ++++++ include/linux/xarray.h | 4 +- lib/generic-radix-tree.c | 32 +++++++++++++++++----- lib/test_meminit.c | 27 ++++++++++++++++++ mm/compaction.c | 7 ++-- mm/memory-failure.c | 22 ++++++++------- mm/page_alloc.c | 6 ++-- mm/page_ext.c | 23 ++++++--------- mm/page_owner.c | 55 +++++++++++++------------------------- mm/slab.c | 3 ++ mm/slub.c | 35 ++++++++++++++++++------ 16 files changed, 152 insertions(+), 86 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-10-07 0:57 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-10-07 0:57 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm The usual shower of hotfixes. Chris's memcg patches aren't actually fixes - they're mature but a few niggling review issues were late to arrive. The ocfs2 fixes are quite old - those took some time to get reviewer attention. 18 patches, based on 4ea655343ce4180fe9b2c7ec8cb8ef9884a47901. Subsystems affected by this patch series: ocfs2 hotfixes mm/memcg mm/slab-generic Subsystem: ocfs2 Jia Guo <guojia12@huawei.com>: ocfs2: clear zero in unaligned direct IO Jia-Ju Bai <baijiaju1990@gmail.com>: fs: ocfs2: fix possible null-pointer dereferences in ocfs2_xa_prepare_entry() fs: ocfs2: fix a possible null-pointer dereference in ocfs2_write_end_nolock() fs: ocfs2: fix a possible null-pointer dereference in ocfs2_info_scan_inode_alloc() Subsystem: hotfixes Will Deacon <will@kernel.org>: panic: ensure preemption is disabled during panic() Anshuman Khandual <anshuman.khandual@arm.com>: mm/memremap: drop unused SECTION_SIZE and SECTION_MASK Tejun Heo <tj@kernel.org>: writeback: fix use-after-free in finish_writeback_work() Yi Wang <wang.yi59@zte.com.cn>: mm: fix -Wmissing-prototypes warnings Baoquan He <bhe@redhat.com>: memcg: only record foreign writebacks with dirty pages when memcg is not disabled Michal Hocko <mhocko@suse.com>: kernel/sysctl.c: do not override max_threads provided by userspace Vitaly Wool <vitalywool@gmail.com>: mm/z3fold.c: claim page in the beginning of free Qian Cai <cai@lca.pw>: mm/page_alloc.c: fix a crash in free_pages_prepare() Dan Carpenter <dan.carpenter@oracle.com>: mm/vmpressure.c: fix a signedness bug in vmpressure_register_event() Subsystem: mm/memcg Chris Down <chris@chrisdown.name>: mm, memcg: proportional memory.{low,min} reclaim mm, memcg: make memory.emin the baseline for utilisation determination mm, memcg: make scan aggression always exclude protection Subsystem: mm/slab-generic Vlastimil Babka <vbabka@suse.cz>: Patch series "guarantee natural alignment for kmalloc()", v2: mm, sl[ou]b: improve memory accounting mm, sl[aou]b: guarantee natural alignment for kmalloc(power-of-two) Documentation/admin-guide/cgroup-v2.rst | 20 +- Documentation/core-api/memory-allocation.rst | 4 fs/fs-writeback.c | 9 - fs/ocfs2/aops.c | 25 +++ fs/ocfs2/ioctl.c | 2 fs/ocfs2/xattr.c | 56 +++---- include/linux/memcontrol.h | 67 ++++++--- include/linux/slab.h | 4 kernel/fork.c | 4 kernel/panic.c | 1 mm/memcontrol.c | 5 mm/memremap.c | 2 mm/page_alloc.c | 8 - mm/shuffle.c | 2 mm/slab_common.c | 19 ++ mm/slob.c | 62 ++++++-- mm/slub.c | 14 + mm/sparse.c | 2 mm/vmpressure.c | 20 +- mm/vmscan.c | 198 +++++++++++++++++---------- mm/z3fold.c | 10 + 21 files changed, 363 insertions(+), 171 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-09-25 23:45 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-09-25 23:45 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - almost all of the rest of -mm - various other subsystems 76 patches, based on 351c8a09b00b5c51c8f58b016fffe51f87e2d820: Subsystems affected by this patch series: memcg misc core-kernel lib checkpatch reiserfs fat fork cpumask kexec uaccess kconfig kgdb bug ipc lzo kasan madvise cleanups pagemap Subsystem: memcg Michal Hocko <mhocko@suse.com>: memcg, kmem: do not fail __GFP_NOFAIL charges Subsystem: misc Masahiro Yamada <yamada.masahiro@socionext.com>: linux/coff.h: add include guard Subsystem: core-kernel Valdis Kletnieks <valdis.kletnieks@vt.edu>: kernel/elfcore.c: include proper prototypes Subsystem: lib Michel Lespinasse <walken@google.com>: rbtree: avoid generating code twice for the cached versions (tools copy) Patch series "make RB_DECLARE_CALLBACKS more generic", v3: augmented rbtree: add comments for RB_DECLARE_CALLBACKS macro augmented rbtree: add new RB_DECLARE_CALLBACKS_MAX macro augmented rbtree: rework the RB_DECLARE_CALLBACKS macro definition Joe Perches <joe@perches.com>: kernel-doc: core-api: include string.h into core-api Qian Cai <cai@lca.pw>: include/trace/events/writeback.h: fix -Wstringop-truncation warnings Kees Cook <keescook@chromium.org>: strscpy: reject buffer sizes larger than INT_MAX Valdis Kletnieks <valdis.kletnieks@vt.edu>: lib/generic-radix-tree.c: make 2 functions static inline lib/extable.c: add missing prototypes Stephen Boyd <swboyd@chromium.org>: lib/hexdump: make print_hex_dump_bytes() a nop on !DEBUG builds Subsystem: checkpatch Joe Perches <joe@perches.com>: checkpatch: don't interpret stack dumps as commit IDs checkpatch: improve SPDX license checking Matteo Croce <mcroce@redhat.com>: checkpatch.pl: warn on invalid commit id Brendan Jackman <brendan.jackman@bluwireless.co.uk>: checkpatch: exclude sizeof sub-expressions from MACRO_ARG_REUSE Joe Perches <joe@perches.com>: checkpatch: prefer __section over __attribute__((section(...))) checkpatch: allow consecutive close braces Sean Christopherson <sean.j.christopherson@intel.com>: checkpatch: remove obsolete period from "ambiguous SHA1" query Joe Perches <joe@perches.com>: checkpatch: make git output use LANGUAGE=en_US.utf8 Subsystem: reiserfs Jia-Ju Bai <baijiaju1990@gmail.com>: fs: reiserfs: remove unnecessary check of bh in remove_from_transaction() zhengbin <zhengbin13@huawei.com>: fs/reiserfs/journal.c: remove set but not used variables fs/reiserfs/stree.c: remove set but not used variables fs/reiserfs/lbalance.c: remove set but not used variables fs/reiserfs/objectid.c: remove set but not used variables fs/reiserfs/prints.c: remove set but not used variables fs/reiserfs/fix_node.c: remove set but not used variables fs/reiserfs/do_balan.c: remove set but not used variables Jason Yan <yanaijie@huawei.com>: fs/reiserfs/journal.c: remove set but not used variable fs/reiserfs/do_balan.c: remove set but not used variable Subsystem: fat Markus Elfring <elfring@users.sourceforge.net>: fat: delete an unnecessary check before brelse() Subsystem: fork Sai Praneeth Prakhya <sai.praneeth.prakhya@intel.com>: fork: improve error message for corrupted page tables Subsystem: cpumask Alexey Dobriyan <adobriyan@gmail.com>: cpumask: nicer for_each_cpumask_and() signature Subsystem: kexec Tetsuo Handa <penguin-kernel@I-love.SAKURA.ne.jp>: kexec: bail out upon SIGKILL when allocating memory. Vasily Gorbik <gor@linux.ibm.com>: kexec: restore arch_kexec_kernel_image_probe declaration Subsystem: uaccess Kees Cook <keescook@chromium.org>: uaccess: add missing __must_check attributes Subsystem: kconfig Masahiro Yamada <yamada.masahiro@socionext.com>: compiler: enable CONFIG_OPTIMIZE_INLINING forcibly Subsystem: kgdb Douglas Anderson <dianders@chromium.org>: kgdb: don't use a notifier to enter kgdb at panic; call directly scripts/gdb: handle split debug Subsystem: bug Kees Cook <keescook@chromium.org>: Patch series "Clean up WARN() "cut here" handling", v2: bug: refactor away warn_slowpath_fmt_taint() bug: rename __WARN_printf_taint() to __WARN_printf() bug: consolidate warn_slowpath_fmt() usage bug: lift "cut here" out of __warn() bug: clean up helper macros to remove __WARN_TAINT() bug: consolidate __WARN_FLAGS usage bug: move WARN_ON() "cut here" into exception handler Subsystem: ipc Markus Elfring <elfring@users.sourceforge.net>: ipc/mqueue.c: delete an unnecessary check before the macro call dev_kfree_skb() ipc/mqueue: improve exception handling in do_mq_notify() "Joel Fernandes (Google)" <joel@joelfernandes.org>: ipc/sem.c: convert to use built-in RCU list checking Subsystem: lzo Dave Rodgman <dave.rodgman@arm.com>: lib/lzo/lzo1x_compress.c: fix alignment bug in lzo-rle Subsystem: kasan Andrey Konovalov <andreyknvl@google.com>: Patch series "arm64: untag user pointers passed to the kernel", v19: lib: untag user pointers in strn*_user mm: untag user pointers passed to memory syscalls mm: untag user pointers in mm/gup.c mm: untag user pointers in get_vaddr_frames fs/namespace: untag user pointers in copy_mount_options userfaultfd: untag user pointers drm/amdgpu: untag user pointers drm/radeon: untag user pointers in radeon_gem_userptr_ioctl media/v4l2-core: untag user pointers in videobuf_dma_contig_user_get tee/shm: untag user pointers in tee_shm_register vfio/type1: untag user pointers in vaddr_get_pfn Catalin Marinas <catalin.marinas@arm.com>: mm: untag user pointers in mmap/munmap/mremap/brk Subsystem: madvise Minchan Kim <minchan@kernel.org>: Patch series "Introduce MADV_COLD and MADV_PAGEOUT", v7: mm: introduce MADV_COLD mm: change PAGEREF_RECLAIM_CLEAN with PAGE_REFRECLAIM mm: introduce MADV_PAGEOUT mm: factor out common parts between MADV_COLD and MADV_PAGEOUT Subsystem: cleanups Mike Rapoport <rppt@linux.ibm.com>: hexagon: drop empty and unused free_initrd_mem Denis Efremov <efremov@linux.com>: checkpatch: check for nested (un)?likely() calls xen/events: remove unlikely() from WARN() condition fs: remove unlikely() from WARN_ON() condition wimax/i2400m: remove unlikely() from WARN*() condition xfs: remove unlikely() from WARN_ON() condition IB/hfi1: remove unlikely() from IS_ERR*() condition ntfs: remove (un)?likely() from IS_ERR() conditions Subsystem: pagemap Mark Rutland <mark.rutland@arm.com>: mm: treewide: clarify pgtable_page_{ctor,dtor}() naming Documentation/core-api/kernel-api.rst | 3 Documentation/vm/split_page_table_lock.rst | 10 arch/alpha/include/uapi/asm/mman.h | 3 arch/arc/include/asm/pgalloc.h | 4 arch/arm/include/asm/tlb.h | 2 arch/arm/mm/mmu.c | 2 arch/arm64/include/asm/tlb.h | 2 arch/arm64/mm/mmu.c | 2 arch/csky/include/asm/pgalloc.h | 2 arch/hexagon/include/asm/pgalloc.h | 2 arch/hexagon/mm/init.c | 13 arch/m68k/include/asm/mcf_pgalloc.h | 6 arch/m68k/include/asm/motorola_pgalloc.h | 6 arch/m68k/include/asm/sun3_pgalloc.h | 2 arch/mips/include/asm/pgalloc.h | 2 arch/mips/include/uapi/asm/mman.h | 3 arch/nios2/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgalloc.h | 6 arch/parisc/include/uapi/asm/mman.h | 3 arch/powerpc/mm/pgtable-frag.c | 6 arch/riscv/include/asm/pgalloc.h | 2 arch/s390/mm/pgalloc.c | 6 arch/sh/include/asm/pgalloc.h | 2 arch/sparc/include/asm/pgtable_64.h | 5 arch/sparc/mm/init_64.c | 4 arch/sparc/mm/srmmu.c | 4 arch/um/include/asm/pgalloc.h | 2 arch/unicore32/include/asm/tlb.h | 2 arch/x86/mm/pat_rbtree.c | 19 arch/x86/mm/pgtable.c | 2 arch/xtensa/include/asm/pgalloc.h | 4 arch/xtensa/include/uapi/asm/mman.h | 3 drivers/block/drbd/drbd_interval.c | 29 - drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 2 drivers/gpu/drm/amd/amdgpu/amdgpu_gem.c | 2 drivers/gpu/drm/radeon/radeon_gem.c | 2 drivers/infiniband/hw/hfi1/verbs.c | 2 drivers/media/v4l2-core/videobuf-dma-contig.c | 9 drivers/net/wimax/i2400m/tx.c | 3 drivers/tee/tee_shm.c | 1 drivers/vfio/vfio_iommu_type1.c | 2 drivers/xen/events/events_base.c | 2 fs/fat/dir.c | 4 fs/namespace.c | 2 fs/ntfs/mft.c | 12 fs/ntfs/namei.c | 2 fs/ntfs/runlist.c | 2 fs/ntfs/super.c | 2 fs/open.c | 2 fs/reiserfs/do_balan.c | 15 fs/reiserfs/fix_node.c | 6 fs/reiserfs/journal.c | 22 fs/reiserfs/lbalance.c | 3 fs/reiserfs/objectid.c | 3 fs/reiserfs/prints.c | 3 fs/reiserfs/stree.c | 4 fs/userfaultfd.c | 22 fs/xfs/xfs_buf.c | 4 include/asm-generic/bug.h | 71 +- include/asm-generic/pgalloc.h | 8 include/linux/cpumask.h | 14 include/linux/interval_tree_generic.h | 22 include/linux/kexec.h | 2 include/linux/kgdb.h | 2 include/linux/mm.h | 4 include/linux/mm_types_task.h | 4 include/linux/printk.h | 22 include/linux/rbtree_augmented.h | 114 +++- include/linux/string.h | 5 include/linux/swap.h | 2 include/linux/thread_info.h | 2 include/linux/uaccess.h | 21 include/trace/events/writeback.h | 38 - include/uapi/asm-generic/mman-common.h | 3 include/uapi/linux/coff.h | 5 ipc/mqueue.c | 22 ipc/sem.c | 3 kernel/debug/debug_core.c | 31 - kernel/elfcore.c | 1 kernel/fork.c | 16 kernel/kexec_core.c | 2 kernel/panic.c | 48 - lib/Kconfig.debug | 4 lib/bug.c | 11 lib/extable.c | 1 lib/generic-radix-tree.c | 4 lib/hexdump.c | 21 lib/lzo/lzo1x_compress.c | 14 lib/rbtree_test.c | 37 - lib/string.c | 12 lib/strncpy_from_user.c | 3 lib/strnlen_user.c | 3 mm/frame_vector.c | 2 mm/gup.c | 4 mm/internal.h | 2 mm/madvise.c | 562 ++++++++++++++++------- mm/memcontrol.c | 10 mm/mempolicy.c | 3 mm/migrate.c | 2 mm/mincore.c | 2 mm/mlock.c | 4 mm/mmap.c | 34 - mm/mprotect.c | 2 mm/mremap.c | 13 mm/msync.c | 2 mm/oom_kill.c | 2 mm/swap.c | 42 + mm/vmalloc.c | 5 mm/vmscan.c | 62 ++ scripts/checkpatch.pl | 69 ++ scripts/gdb/linux/symbols.py | 4 tools/include/linux/rbtree.h | 71 +- tools/include/linux/rbtree_augmented.h | 145 +++-- tools/lib/rbtree.c | 37 - 114 files changed, 1195 insertions(+), 754 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-09-23 22:31 Andrew Morton 2019-09-24 0:55 ` incoming Linus Torvalds 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2019-09-23 22:31 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm - a few hot fixes - ocfs2 updates - almost all of -mm, as below. 134 patches, based on 619e17cf75dd58905aa67ccd494a6ba5f19d6cc6: Subsystems affected by this patch series: hotfixes ocfs2 slab-generic slab slub kmemleak kasan cleanups debug pagecache memcg gup pagemap memory-hotplug sparsemem vmalloc initialization z3fold compaction mempolicy oom-kill hugetlb migration thp mmap madvise shmem zswap zsmalloc Subsystem: hotfixes OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>: fat: work around race with userspace's read via blockdev while mounting Vitaly Wool <vitalywool@gmail.com>: Revert "mm/z3fold.c: fix race between migration and destruction" Arnd Bergmann <arnd@arndb.de>: mm: add dummy can_do_mlock() helper Vitaly Wool <vitalywool@gmail.com>: z3fold: fix retry mechanism in page reclaim Greg Thelen <gthelen@google.com>: kbuild: clean compressed initramfs image Subsystem: ocfs2 Joseph Qi <joseph.qi@linux.alibaba.com>: ocfs2: use jbd2_inode dirty range scoping jbd2: remove jbd2_journal_inode_add_[write|wait] Greg Kroah-Hartman <gregkh@linuxfoundation.org>: ocfs2: further debugfs cleanups Guozhonghua <guozhonghua@h3c.com>: ocfs2: remove unused ocfs2_calc_tree_trunc_credits() ocfs2: remove unused ocfs2_orphan_scan_exit() declaration zhengbin <zhengbin13@huawei.com>: fs/ocfs2/namei.c: remove set but not used variables fs/ocfs2/file.c: remove set but not used variables fs/ocfs2/dir.c: remove set but not used variables Markus Elfring <elfring@users.sourceforge.net>: ocfs2: delete unnecessary checks before brelse() Changwei Ge <gechangwei@live.cn>: ocfs2: wait for recovering done after direct unlock request ocfs2: checkpoint appending truncate log transaction before flushing Colin Ian King <colin.king@canonical.com>: ocfs2: fix spelling mistake "ambigous" -> "ambiguous" Subsystem: slab-generic Waiman Long <longman@redhat.com>: mm, slab: extend slab/shrink to shrink all memcg caches Subsystem: slab Waiman Long <longman@redhat.com>: mm, slab: move memcg_cache_params structure to mm/slab.h Subsystem: slub Qian Cai <cai@lca.pw>: mm/slub.c: fix -Wunused-function compiler warnings Subsystem: kmemleak Nicolas Boichat <drinkcat@chromium.org>: kmemleak: increase DEBUG_KMEMLEAK_EARLY_LOG_SIZE default to 16K Catalin Marinas <catalin.marinas@arm.com>: Patch series "mm: kmemleak: Use a memory pool for kmemleak object: mm: kmemleak: make the tool tolerant to struct scan_area allocation failures mm: kmemleak: simple memory allocation pool for kmemleak objects mm: kmemleak: use the memory pool for early allocations Qian Cai <cai@lca.pw>: mm/kmemleak.c: record the current memory pool size mm/kmemleak: increase the max mem pool to 1M Subsystem: kasan Walter Wu <walter-zh.wu@mediatek.com>: kasan: add memory corruption identification for software tag-based mode Mark Rutland <mark.rutland@arm.com>: lib/test_kasan.c: add roundtrip tests Subsystem: cleanups Christophe JAILLET <christophe.jaillet@wanadoo.fr>: mm/page_poison.c: fix a typo in a comment YueHaibing <yuehaibing@huawei.com>: mm/rmap.c: remove set but not used variable 'cstart' Matthew Wilcox (Oracle) <willy@infradead.org>: Patch series "Make working with compound pages easier", v2: mm: introduce page_size() "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: introduce page_shift() Matthew Wilcox (Oracle) <willy@infradead.org>: mm: introduce compound_nr() Yu Zhao <yuzhao@google.com>: mm: replace list_move_tail() with add_page_to_lru_list_tail() Subsystem: debug Vlastimil Babka <vbabka@suse.cz>: Patch series "debug_pagealloc improvements through page_owner", v2: mm, page_owner: record page owner for each subpage mm, page_owner: keep owner info when freeing the page mm, page_owner, debug_pagealloc: save and dump freeing stack trace Subsystem: pagecache Konstantin Khlebnikov <khlebnikov@yandex-team.ru>: mm/filemap.c: don't initiate writeback if mapping has no dirty pages mm/filemap.c: rewrite mapping_needs_writeback in less fancy manner "Matthew Wilcox (Oracle)" <willy@infradead.org>: mm: page cache: store only head pages in i_pages Subsystem: memcg Chris Down <chris@chrisdown.name>: mm, memcg: throttle allocators when failing reclaim over memory.high Roman Gushchin <guro@fb.com>: mm: memcontrol: switch to rcu protection in drain_all_stock() Johannes Weiner <hannes@cmpxchg.org>: mm: vmscan: do not share cgroup iteration between reclaimers Subsystem: gup [11~From: John Hubbard <jhubbard@nvidia.com>: Patch series "mm/gup: add make_dirty arg to put_user_pages_dirty_lock()",: mm/gup: add make_dirty arg to put_user_pages_dirty_lock() John Hubbard <jhubbard@nvidia.com>: drivers/gpu/drm/via: convert put_page() to put_user_page*() net/xdp: convert put_page() to put_user_page*() Subsystem: pagemap Wei Yang <richardw.yang@linux.intel.com>: mm: remove redundant assignment of entry Minchan Kim <minchan@kernel.org>: mm: release the spinlock on zap_pte_range Nicholas Piggin <npiggin@gmail.com>: Patch series "mm: remove quicklist page table caches": mm: remove quicklist page table caches Mike Rapoport <rppt@linux.ibm.com>: ia64: switch to generic version of pte allocation sh: switch to generic version of pte allocation microblaze: switch to generic version of pte allocation mm: consolidate pgtable_cache_init() and pgd_cache_init() Kefeng Wang <wangkefeng.wang@huawei.com>: mm: do not hash address in print_bad_pte() Subsystem: memory-hotplug David Hildenbrand <david@redhat.com>: mm/memory_hotplug: remove move_pfn_range() drivers/base/node.c: simplify unregister_memory_block_under_nodes() drivers/base/memory.c: fixup documentation of removable/phys_index/block_size_bytes driver/base/memory.c: validate memory block size early drivers/base/memory.c: don't store end_section_nr in memory blocks Wei Yang <richardw.yang@linux.intel.com>: mm/memory_hotplug.c: prevent memory leak when reusing pgdat David Hildenbrand <david@redhat.com>: Patch series "mm/memory_hotplug: online_pages() cleanups", v2: mm/memory_hotplug.c: use PFN_UP / PFN_DOWN in walk_system_ram_range() mm/memory_hotplug: drop PageReserved() check in online_pages_range() mm/memory_hotplug: simplify online_pages_range() mm/memory_hotplug: make sure the pfn is aligned to the order when onlining mm/memory_hotplug: online_pages cannot be 0 in online_pages() Alastair D'Silva <alastair@d-silva.org>: Patch series "Add bounds check for Hotplugged memory", v3: mm/memory_hotplug.c: add a bounds check to check_hotplug_memory_range() mm/memremap.c: add a bounds check in devm_memremap_pages() Souptick Joarder <jrdr.linux@gmail.com>: mm/memory_hotplug.c: s/is/if Subsystem: sparsemem Lecopzer Chen <lecopzer.chen@mediatek.com>: mm/sparse.c: fix memory leak of sparsemap_buf in aligned memory mm/sparse.c: fix ALIGN() without power of 2 in sparse_buffer_alloc() Wei Yang <richardw.yang@linux.intel.com>: mm/sparse.c: use __nr_to_section(section_nr) to get mem_section Alastair D'Silva <alastair@d-silva.org>: mm/sparse.c: don't manually decrement num_poisoned_pages "Alastair D'Silva" <alastair@d-silva.org>: mm/sparse.c: remove NULL check in clear_hwpoisoned_pages() Subsystem: vmalloc "Uladzislau Rezki (Sony)" <urezki@gmail.com>: mm/vmalloc: do not keep unpurged areas in the busy tree Pengfei Li <lpf.vector@gmail.com>: mm/vmalloc: modify struct vmap_area to reduce its size Austin Kim <austindh.kim@gmail.com>: mm/vmalloc.c: move 'area->pages' after if statement Subsystem: initialization Mike Rapoport <rppt@linux.ibm.com>: mm: use CPU_BITS_NONE to initialize init_mm.cpu_bitmask Qian Cai <cai@lca.pw>: mm: silence -Woverride-init/initializer-overrides Subsystem: z3fold Vitaly Wool <vitalywool@gmail.com>: z3fold: fix memory leak in kmem cache Subsystem: compaction Yafang Shao <laoar.shao@gmail.com>: mm/compaction.c: clear total_{migrate,free}_scanned before scanning a new zone Pengfei Li <lpf.vector@gmail.com>: mm/compaction.c: remove unnecessary zone parameter in isolate_migratepages() Subsystem: mempolicy Kefeng Wang <wangkefeng.wang@huawei.com>: mm/mempolicy.c: remove unnecessary nodemask check in kernel_migrate_pages() Subsystem: oom-kill Joel Savitz <jsavitz@redhat.com>: mm/oom_kill.c: add task UID to info message on an oom kill Tetsuo Handa <penguin-kernel@i-love.sakura.ne.jp>: memcg, oom: don't require __GFP_FS when invoking memcg OOM killer Edward Chron <echron@arista.com>: mm/oom: add oom_score_adj and pgtables to Killed process message Yi Wang <wang.yi59@zte.com.cn>: mm/oom_kill.c: fix oom_cpuset_eligible() comment Michal Hocko <mhocko@suse.com>: mm, oom: consider present pages for the node size Qian Cai <cai@lca.pw>: mm/memcontrol.c: fix a -Wunused-function warning Michal Hocko <mhocko@suse.com>: memcg, kmem: deprecate kmem.limit_in_bytes Subsystem: hugetlb Hillf Danton <hdanton@sina.com>: Patch series "address hugetlb page allocation stalls", v2: mm, reclaim: make should_continue_reclaim perform dryrun detection Vlastimil Babka <vbabka@suse.cz>: mm, reclaim: cleanup should_continue_reclaim() mm, compaction: raise compaction priority after it withdrawns Mike Kravetz <mike.kravetz@oracle.com>: hugetlbfs: don't retry when pool page allocations start to fail Subsystem: migration Pingfan Liu <kernelfans@gmail.com>: mm/migrate.c: clean up useless code in migrate_vma_collect_pmd() Subsystem: thp Kefeng Wang <wangkefeng.wang@huawei.com>: thp: update split_huge_page_pmd() comment Song Liu <songliubraving@fb.com>: Patch series "Enable THP for text section of non-shmem files", v10;: filemap: check compound_head(page)->mapping in filemap_fault() filemap: check compound_head(page)->mapping in pagecache_get_page() filemap: update offset check in filemap_fault() mm,thp: stats for file backed THP khugepaged: rename collapse_shmem() and khugepaged_scan_shmem() mm,thp: add read-only THP support for (non-shmem) FS mm,thp: avoid writes to file with THP in pagecache Yang Shi <yang.shi@linux.alibaba.com>: Patch series "Make deferred split shrinker memcg aware", v6: mm: thp: extract split_queue_* into a struct mm: move mem_cgroup_uncharge out of __page_cache_release() mm: shrinker: make shrinker not depend on memcg kmem mm: thp: make deferred split shrinker memcg aware Song Liu <songliubraving@fb.com>: Patch series "THP aware uprobe", v13: mm: move memcmp_pages() and pages_identical() uprobe: use original page when all uprobes are removed mm, thp: introduce FOLL_SPLIT_PMD uprobe: use FOLL_SPLIT_PMD instead of FOLL_SPLIT khugepaged: enable collapse pmd for pte-mapped THP uprobe: collapse THP pmd after removing all uprobes Subsystem: mmap Alexandre Ghiti <alex@ghiti.fr>: Patch series "Provide generic top-down mmap layout functions", v6: mm, fs: move randomize_stack_top from fs to mm arm64: make use of is_compat_task instead of hardcoding this test arm64: consider stack randomization for mmap base only when necessary arm64, mm: move generic mmap layout functions to mm arm64, mm: make randomization selected by generic topdown mmap layout arm: properly account for stack randomization and stack guard gap arm: use STACK_TOP when computing mmap base address arm: use generic mmap top-down layout and brk randomization mips: properly account for stack randomization and stack guard gap mips: use STACK_TOP when computing mmap base address mips: adjust brk randomization offset to fit generic version mips: replace arch specific way to determine 32bit task with generic version mips: use generic mmap top-down layout and brk randomization riscv: make mmap allocation top-down by default Wei Yang <richardw.yang@linux.intel.com>: mm/mmap.c: refine find_vma_prev() with rb_last() Ivan Khoronzhuk <ivan.khoronzhuk@linaro.org>: mm: mmap: increase sockets maximum memory size pgoff for 32bits Subsystem: madvise Mike Rapoport <rppt@linux.ibm.com>: mm/madvise: reduce code duplication in error handling paths Subsystem: shmem Miles Chen <miles.chen@mediatek.com>: shmem: fix obsolete comment in shmem_getpage_gfp() Subsystem: zswap Hui Zhu <teawaterz@linux.alibaba.com>: zpool: add malloc_support_movable to zpool_driver zswap: use movable memory if zpool support allocate movable memory Vitaly Wool <vitalywool@gmail.com>: zswap: do not map same object twice Subsystem: zsmalloc Qian Cai <cai@lca.pw>: mm/zsmalloc.c: fix a -Wunused-function warning Documentation/ABI/testing/sysfs-kernel-slab | 13 Documentation/admin-guide/cgroup-v1/memory.rst | 4 Documentation/admin-guide/kernel-parameters.txt | 2 arch/Kconfig | 11 arch/alpha/include/asm/pgalloc.h | 2 arch/alpha/include/asm/pgtable.h | 5 arch/arc/include/asm/pgalloc.h | 1 arch/arc/include/asm/pgtable.h | 5 arch/arm/Kconfig | 1 arch/arm/include/asm/pgalloc.h | 2 arch/arm/include/asm/pgtable-nommu.h | 5 arch/arm/include/asm/pgtable.h | 2 arch/arm/include/asm/processor.h | 2 arch/arm/kernel/process.c | 5 arch/arm/mm/flush.c | 7 arch/arm/mm/mmap.c | 80 ----- arch/arm64/Kconfig | 2 arch/arm64/include/asm/pgalloc.h | 2 arch/arm64/include/asm/pgtable.h | 2 arch/arm64/include/asm/processor.h | 2 arch/arm64/kernel/process.c | 8 arch/arm64/mm/flush.c | 3 arch/arm64/mm/mmap.c | 84 ----- arch/arm64/mm/pgd.c | 2 arch/c6x/include/asm/pgtable.h | 5 arch/csky/include/asm/pgalloc.h | 2 arch/csky/include/asm/pgtable.h | 5 arch/h8300/include/asm/pgtable.h | 6 arch/hexagon/include/asm/pgalloc.h | 2 arch/hexagon/include/asm/pgtable.h | 3 arch/hexagon/mm/Makefile | 2 arch/hexagon/mm/pgalloc.c | 10 arch/ia64/Kconfig | 4 arch/ia64/include/asm/pgalloc.h | 64 ---- arch/ia64/include/asm/pgtable.h | 5 arch/ia64/mm/init.c | 2 arch/m68k/include/asm/pgtable_mm.h | 7 arch/m68k/include/asm/pgtable_no.h | 7 arch/microblaze/include/asm/pgalloc.h | 128 -------- arch/microblaze/include/asm/pgtable.h | 7 arch/microblaze/mm/pgtable.c | 4 arch/mips/Kconfig | 2 arch/mips/include/asm/pgalloc.h | 2 arch/mips/include/asm/pgtable.h | 5 arch/mips/include/asm/processor.h | 5 arch/mips/mm/mmap.c | 124 +------- arch/nds32/include/asm/pgalloc.h | 2 arch/nds32/include/asm/pgtable.h | 2 arch/nios2/include/asm/pgalloc.h | 2 arch/nios2/include/asm/pgtable.h | 2 arch/openrisc/include/asm/pgalloc.h | 2 arch/openrisc/include/asm/pgtable.h | 5 arch/parisc/include/asm/pgalloc.h | 2 arch/parisc/include/asm/pgtable.h | 2 arch/powerpc/include/asm/pgalloc.h | 2 arch/powerpc/include/asm/pgtable.h | 1 arch/powerpc/mm/book3s64/hash_utils.c | 2 arch/powerpc/mm/book3s64/iommu_api.c | 7 arch/powerpc/mm/hugetlbpage.c | 2 arch/riscv/Kconfig | 12 arch/riscv/include/asm/pgalloc.h | 4 arch/riscv/include/asm/pgtable.h | 5 arch/s390/include/asm/pgtable.h | 6 arch/sh/include/asm/pgalloc.h | 56 --- arch/sh/include/asm/pgtable.h | 5 arch/sh/mm/Kconfig | 3 arch/sh/mm/nommu.c | 4 arch/sparc/include/asm/pgalloc_32.h | 2 arch/sparc/include/asm/pgalloc_64.h | 2 arch/sparc/include/asm/pgtable_32.h | 5 arch/sparc/include/asm/pgtable_64.h | 1 arch/sparc/mm/init_32.c | 1 arch/um/include/asm/pgalloc.h | 2 arch/um/include/asm/pgtable.h | 2 arch/unicore32/include/asm/pgalloc.h | 2 arch/unicore32/include/asm/pgtable.h | 2 arch/x86/include/asm/pgtable_32.h | 2 arch/x86/include/asm/pgtable_64.h | 3 arch/x86/mm/pgtable.c | 6 arch/xtensa/include/asm/pgtable.h | 1 arch/xtensa/include/asm/tlbflush.h | 3 drivers/base/memory.c | 44 +- drivers/base/node.c | 55 +-- drivers/crypto/chelsio/chtls/chtls_io.c | 5 drivers/gpu/drm/via/via_dmablit.c | 10 drivers/infiniband/core/umem.c | 5 drivers/infiniband/hw/hfi1/user_pages.c | 5 drivers/infiniband/hw/qib/qib_user_pages.c | 5 drivers/infiniband/hw/usnic/usnic_uiom.c | 5 drivers/infiniband/sw/siw/siw_mem.c | 10 drivers/staging/android/ion/ion_system_heap.c | 4 drivers/target/tcm_fc/tfc_io.c | 3 drivers/vfio/vfio_iommu_spapr_tce.c | 8 fs/binfmt_elf.c | 20 - fs/fat/dir.c | 13 fs/fat/fatent.c | 3 fs/inode.c | 3 fs/io_uring.c | 2 fs/jbd2/journal.c | 2 fs/jbd2/transaction.c | 12 fs/ocfs2/alloc.c | 20 + fs/ocfs2/aops.c | 13 fs/ocfs2/blockcheck.c | 26 - fs/ocfs2/cluster/heartbeat.c | 109 +------ fs/ocfs2/dir.c | 3 fs/ocfs2/dlm/dlmcommon.h | 1 fs/ocfs2/dlm/dlmdebug.c | 55 --- fs/ocfs2/dlm/dlmdebug.h | 16 - fs/ocfs2/dlm/dlmdomain.c | 7 fs/ocfs2/dlm/dlmunlock.c | 23 + fs/ocfs2/dlmglue.c | 29 - fs/ocfs2/extent_map.c | 3 fs/ocfs2/file.c | 13 fs/ocfs2/inode.c | 2 fs/ocfs2/journal.h | 42 -- fs/ocfs2/namei.c | 2 fs/ocfs2/ocfs2.h | 3 fs/ocfs2/super.c | 10 fs/open.c | 8 fs/proc/meminfo.c | 8 fs/proc/task_mmu.c | 6 include/asm-generic/pgalloc.h | 5 include/asm-generic/pgtable.h | 7 include/linux/compaction.h | 22 + include/linux/fs.h | 32 ++ include/linux/huge_mm.h | 9 include/linux/hugetlb.h | 2 include/linux/jbd2.h | 2 include/linux/khugepaged.h | 12 include/linux/memcontrol.h | 23 - include/linux/memory.h | 7 include/linux/memory_hotplug.h | 1 include/linux/mm.h | 37 ++ include/linux/mm_types.h | 1 include/linux/mmzone.h | 14 include/linux/page_ext.h | 1 include/linux/pagemap.h | 10 include/linux/quicklist.h | 94 ------ include/linux/shrinker.h | 7 include/linux/slab.h | 62 ---- include/linux/vmalloc.h | 20 - include/linux/zpool.h | 3 init/main.c | 6 kernel/events/uprobes.c | 81 ++++- kernel/resource.c | 4 kernel/sched/idle.c | 1 kernel/sysctl.c | 6 lib/Kconfig.debug | 15 lib/Kconfig.kasan | 8 lib/iov_iter.c | 2 lib/show_mem.c | 5 lib/test_kasan.c | 41 ++ mm/Kconfig | 16 - mm/Kconfig.debug | 4 mm/Makefile | 4 mm/compaction.c | 50 +-- mm/filemap.c | 168 ++++------ mm/gup.c | 125 +++----- mm/huge_memory.c | 129 ++++++-- mm/hugetlb.c | 89 +++++ mm/hugetlb_cgroup.c | 2 mm/init-mm.c | 2 mm/kasan/common.c | 32 +- mm/kasan/kasan.h | 14 mm/kasan/report.c | 44 ++ mm/kasan/tags_report.c | 24 + mm/khugepaged.c | 372 ++++++++++++++++++++---- mm/kmemleak.c | 338 +++++---------------- mm/ksm.c | 18 - mm/madvise.c | 52 +-- mm/memcontrol.c | 188 ++++++++++-- mm/memfd.c | 2 mm/memory.c | 21 + mm/memory_hotplug.c | 120 ++++--- mm/mempolicy.c | 4 mm/memremap.c | 5 mm/migrate.c | 13 mm/mmap.c | 12 mm/mmu_gather.c | 2 mm/nommu.c | 2 mm/oom_kill.c | 30 + mm/page_alloc.c | 27 + mm/page_owner.c | 127 +++++--- mm/page_poison.c | 2 mm/page_vma_mapped.c | 3 mm/quicklist.c | 103 ------ mm/rmap.c | 25 - mm/shmem.c | 12 mm/slab.h | 64 ++++ mm/slab_common.c | 37 ++ mm/slob.c | 2 mm/slub.c | 22 - mm/sparse.c | 25 + mm/swap.c | 16 - mm/swap_state.c | 6 mm/util.c | 126 +++++++- mm/vmalloc.c | 84 +++-- mm/vmscan.c | 163 ++++------ mm/vmstat.c | 2 mm/z3fold.c | 154 ++------- mm/zpool.c | 16 + mm/zsmalloc.c | 23 - mm/zswap.c | 15 net/xdp/xdp_umem.c | 9 net/xdp/xsk.c | 2 usr/Makefile | 3 206 files changed, 2385 insertions(+), 2533 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-09-23 22:31 incoming Andrew Morton @ 2019-09-24 0:55 ` Linus Torvalds 2019-09-24 4:31 ` incoming Andrew Morton 0 siblings, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2019-09-24 0:55 UTC (permalink / raw) To: Andrew Morton, David Rientjes, Vlastimil Babka, Michal Hocko, Andrea Arcangeli Cc: mm-commits, Linux-MM On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > - almost all of -mm, as below. I was hoping that we could at least test the THP locality thing? Is it in your queue at all, or am I supposed to just do it myself? Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-09-24 0:55 ` incoming Linus Torvalds @ 2019-09-24 4:31 ` Andrew Morton 2019-09-24 7:48 ` incoming Michal Hocko 0 siblings, 1 reply; 389+ messages in thread From: Andrew Morton @ 2019-09-24 4:31 UTC (permalink / raw) To: Linus Torvalds Cc: David Rientjes, Vlastimil Babka, Michal Hocko, Andrea Arcangeli, mm-commits, Linux-MM On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > - almost all of -mm, as below. > > I was hoping that we could at least test the THP locality thing? Is it > in your queue at all, or am I supposed to just do it myself? > Confused. I saw a privately emailed patch from David which nobody seems to have tested yet. I parked that for consideration after -rc1. Or are you referring to something else? This thing keeps stalling. It would be nice to push this along and get something nailed down which we can at least get into 5.4-rc, perhaps with a backport-this tag? ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-09-24 4:31 ` incoming Andrew Morton @ 2019-09-24 7:48 ` Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds 2019-09-24 19:55 ` incoming Vlastimil Babka 0 siblings, 2 replies; 389+ messages in thread From: Michal Hocko @ 2019-09-24 7:48 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Mon 23-09-19 21:31:53, Andrew Morton wrote: > On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote: > > > On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton <akpm@linux-foundation.org> wrote: > > > > > > - almost all of -mm, as below. > > > > I was hoping that we could at least test the THP locality thing? Is it > > in your queue at all, or am I supposed to just do it myself? > > > > Confused. I saw a privately emailed patch from David which nobody > seems to have tested yet. I parked that for consideration after -rc1. > Or are you referring to something else? > > This thing keeps stalling. It would be nice to push this along and get > something nailed down which we can at least get into 5.4-rc, perhaps > with a backport-this tag? The patch proposed by David is really non trivial wrt. potential side effects. I have provided my review feedback [1] and it didn't get any reaction. I really believe that we need to debug this properly. A reproducer would be useful for others to work on that. There is a more fundamental problem here and we need to address it rather than to duck tape it and whack a mole afterwards. [1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz -- Michal Hocko SUSE Labs ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-09-24 7:48 ` incoming Michal Hocko @ 2019-09-24 15:34 ` Linus Torvalds 2019-09-25 6:36 ` incoming Michal Hocko 2019-09-24 19:55 ` incoming Vlastimil Babka 1 sibling, 1 reply; 389+ messages in thread From: Linus Torvalds @ 2019-09-24 15:34 UTC (permalink / raw) To: Michal Hocko Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote: > > The patch proposed by David is really non trivial wrt. potential side > effects. The thing is, that's not an argument when we know that the current state is garbage and has a lot of these non-trivial side effects that are bad. So the patch by David _fixes_ a non-trivial bad side effect. You can't then say "there may be other non-trivial side effects that I don't even know about" as an argument for saying it's bad. David at least has numbers and an argument for his patch. Linus ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-09-24 15:34 ` incoming Linus Torvalds @ 2019-09-25 6:36 ` Michal Hocko 0 siblings, 0 replies; 389+ messages in thread From: Michal Hocko @ 2019-09-25 6:36 UTC (permalink / raw) To: Linus Torvalds Cc: Andrew Morton, David Rientjes, Vlastimil Babka, Andrea Arcangeli, mm-commits, Linux-MM On Tue 24-09-19 08:34:20, Linus Torvalds wrote: > On Tue, Sep 24, 2019 at 12:48 AM Michal Hocko <mhocko@kernel.org> wrote: > > > > The patch proposed by David is really non trivial wrt. potential side > > effects. > > The thing is, that's not an argument when we know that the current > state is garbage and has a lot of these non-trivial side effects that > are bad. > > So the patch by David _fixes_ a non-trivial bad side effect. > > You can't then say "there may be other non-trivial side effects that I > don't even know about" as an argument for saying it's bad. David at > least has numbers and an argument for his patch. All I am saying is that I am not able to wrap my head around this patch to provide a competent Ack. I also believe that the fix is targetting a wrong layer of the problem as explained in my review feedback. Appart from reclaim/compaction interaction mentioned by Vlastimil, it seems that it is an overly eager fallback to a remote node in the fast path that is causing a large part of the problem as well. Kcompactd is not eager enough to keep high order allocations ready for the fast path. This is not specific to THP we have many other high order allocations which are going to follow the same pattern, likely not visible in any counters but still having performance implications. Let's discuss technical details in the respective email thread -- Michal Hocko SUSE Labs ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-09-24 7:48 ` incoming Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds @ 2019-09-24 19:55 ` Vlastimil Babka 1 sibling, 0 replies; 389+ messages in thread From: Vlastimil Babka @ 2019-09-24 19:55 UTC (permalink / raw) To: Michal Hocko, Andrew Morton Cc: Linus Torvalds, David Rientjes, Andrea Arcangeli, mm-commits, Linux-MM On 9/24/19 9:48 AM, Michal Hocko wrote: > On Mon 23-09-19 21:31:53, Andrew Morton wrote: >> On Mon, 23 Sep 2019 17:55:24 -0700 Linus Torvalds >> <torvalds@linux-foundation.org> wrote: >> >>> On Mon, Sep 23, 2019 at 3:31 PM Andrew Morton >>> <akpm@linux-foundation.org> wrote: >>>> >>>> - almost all of -mm, as below. >>> >>> I was hoping that we could at least test the THP locality thing? >>> Is it in your queue at all, or am I supposed to just do it >>> myself? >>> >> >> Confused. I saw a privately emailed patch from David which nobody >> seems to have tested yet. I parked that for consideration after >> -rc1. Or are you referring to something else? >> >> This thing keeps stalling. It would be nice to push this along and >> get something nailed down which we can at least get into 5.4-rc, >> perhaps with a backport-this tag? > > The patch proposed by David is really non trivial wrt. potential > side effects. I have provided my review feedback [1] and it didn't > get any reaction. I really believe that we need to debug this > properly. A reproducer would be useful for others to work on that. > > There is a more fundamental problem here and we need to address it > rather than to duck tape it and whack a mole afterwards. I believe we found a problem when investigating over-reclaim in this thread [1] where it seems madvised THP allocation attempt can result in 4MB reclaimed, if there is a small zone such as ZONE_DMA on the node. As it happens, the patch "[patch 090/134] mm, reclaim: make should_continue_reclaim perform dryrun detection" in Andrew's pile should change this 4MB to 32 pages reclaimed (as a side-effect), but that has to be tested. I'm also working on a patch to not reclaim even those few pages. Of course there might be more fundamental issues with reclaim/compaction interaction, but this one seems to become hopefully clear now. [1] https://lore.kernel.org/linux-mm/4b4ba042-3741-7b16-2292-198c569da2aa@profihost.ag/ > [1] http://lkml.kernel.org/r/20190909193020.GD2063@dhcp22.suse.cz > ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-08-30 23:04 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-08-30 23:04 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 7 fixes, based on 846d2db3e00048da3f650e0cfb0b8d67669cec3e: Roman Gushchin <guro@fb.com>: mm: memcontrol: flush percpu slab vmstats on kmem offlining Andrew Morton <akpm@linux-foundation.org>: mm/zsmalloc.c: fix build when CONFIG_COMPACTION=n Roman Gushchin <guro@fb.com>: mm, memcg: partially revert "mm/memcontrol.c: keep local VM counters in sync with the hierarchical ones" "Gustavo A. R. Silva" <gustavo@embeddedor.com>: mm/z3fold.c: fix lock/unlock imbalance in z3fold_page_isolate Dmitry Safonov <dima@arista.com>: mailmap: add aliases for Dmitry Safonov Michal Hocko <mhocko@suse.com>: mm, memcg: do not set reclaim_state on soft limit reclaim Shakeel Butt <shakeelb@google.com>: mm: memcontrol: fix percpu vmstats and vmevents flush .mailmap | 3 ++ include/linux/mmzone.h | 5 ++-- mm/memcontrol.c | 53 ++++++++++++++++++++++++++++++++----------------- mm/vmscan.c | 5 ++-- mm/z3fold.c | 1 mm/zsmalloc.c | 2 + 6 files changed, 47 insertions(+), 22 deletions(-) ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2019-08-25 0:54 Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2019-08-25 0:54 UTC (permalink / raw) To: Linus Torvalds; +Cc: mm-commits, linux-mm 11 fixes, based on 361469211f876e67d7ca3d3d29e6d1c3e313d0f1: Henry Burns <henryburns@google.com>: mm/z3fold.c: fix race between migration and destruction David Rientjes <rientjes@google.com>: mm, page_alloc: move_freepages should not examine struct page of reserved memory Qian Cai <cai@lca.pw>: parisc: fix compilation errrors Roman Gushchin <guro@fb.com>: mm: memcontrol: flush percpu vmstats before releasing memcg mm: memcontrol: flush percpu vmevents before releasing memcg Jason Xing <kerneljasonxing@linux.alibaba.com>: psi: get poll_work to run when calling poll syscall next time Oleg Nesterov <oleg@redhat.com>: userfaultfd_release: always remove uffd flags and clear vm_userfaultfd_ctx Vlastimil Babka <vbabka@suse.cz>: mm, page_owner: handle THP splits correctly Henry Burns <henryburns@google.com>: mm/zsmalloc.c: migration can leave pages in ZS_EMPTY indefinitely mm/zsmalloc.c: fix race condition in zs_destroy_pool Andrey Ryabinin <aryabinin@virtuozzo.com>: mm/kasan: fix false positive invalid-free reports with CONFIG_KASAN_SW_TAGS=y ^ permalink raw reply [flat|nested] 389+ messages in thread
[parent not found: <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org>]
* Re: incoming [not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org> @ 2019-07-17 8:47 ` Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 0 siblings, 2 replies; 389+ messages in thread From: Vlastimil Babka @ 2019-07-17 8:47 UTC (permalink / raw) To: linux-kernel, Linus Torvalds Cc: linux-mm, Jonathan Corbet, Thorsten Leemhuis, LKML On 7/17/19 1:25 AM, Andrew Morton wrote: > > Most of the rest of MM and just about all of the rest of everything > else. Hi, as I've mentioned at LSF/MM [1], I think it would be nice if mm pull requests had summaries similar to other subsystems. I see they are now more structured (thanks!), but they are now probably hitting the limit of what scripting can do to produce a high-level summary for human readers (unless patch authors themselves provide a blurb that can be extracted later?). So I've tried now to provide an example what I had in mind, below. Maybe it's too concise - if there were "larger" features in this pull request, they would probably benefit from more details. I'm CCing the known (to me) consumers of these mails to judge :) Note I've only covered mm, and core stuff that I think will be interesting to wide audience (change in LIST_POISON2 value? I'm sure as hell glad to know about that one :) Feel free to include this in the merge commit, if you find it useful. Thanks, Vlastimil [1] https://lwn.net/Articles/787705/ ----- - z3fold fixes and enhancements by Henry Burns and Vitaly Wool - more accurate reclaimed slab caches calculations by Yafang Shao - fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by Christoph Hellwig - !CONFIG_MMU fixes by Christoph Hellwig - new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song - new test_meminit module for testing heap and pagealloc initialization, by Alexander Potapenko - ioremap improvements for huge mappings, by Anshuman Khandual - generalize kprobe page fault handling, by Anshuman Khandual - device-dax hotplug fixes and improvements, by Pavel Tatashin - enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V - add pte_devmap() support for arm64, by Robin Murphy - unify locked_vm accounting with a helper, by Daniel Jordan - several misc fixes core/lib - new typeof_member() macro including some users, by Alexey Dobriyan - make BIT() and GENMASK() available in asm, by Masahiro Yamada - changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code generation, by Alexey Dobriyan - rbtree code size optimizations, by Michel Lespinasse - convert struct pid count to refcount_t, by Joel Fernandes get_maintainer.pl - add --no-moderated switch to skip moderated ML's, by Joe Perches ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-07-17 8:47 ` incoming Vlastimil Babka @ 2019-07-17 8:57 ` Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 1 sibling, 0 replies; 389+ messages in thread From: Bhaskar Chowdhury @ 2019-07-17 8:57 UTC (permalink / raw) To: Vlastimil Babka Cc: linux-kernel, Linus Torvalds, linux-mm, Jonathan Corbet, Thorsten Leemhuis [-- Attachment #1: Type: text/plain, Size: 2496 bytes --] Cool !! On 10:47 Wed 17 Jul , Vlastimil Babka wrote: >On 7/17/19 1:25 AM, Andrew Morton wrote: >> >> Most of the rest of MM and just about all of the rest of everything >> else. > >Hi, > >as I've mentioned at LSF/MM [1], I think it would be nice if mm pull >requests had summaries similar to other subsystems. I see they are now >more structured (thanks!), but they are now probably hitting the limit >of what scripting can do to produce a high-level summary for human >readers (unless patch authors themselves provide a blurb that can be >extracted later?). > >So I've tried now to provide an example what I had in mind, below. Maybe >it's too concise - if there were "larger" features in this pull request, >they would probably benefit from more details. I'm CCing the known (to >me) consumers of these mails to judge :) Note I've only covered mm, and >core stuff that I think will be interesting to wide audience (change in >LIST_POISON2 value? I'm sure as hell glad to know about that one :) > >Feel free to include this in the merge commit, if you find it useful. > >Thanks, >Vlastimil > >[1] https://lwn.net/Articles/787705/ > >----- > >- z3fold fixes and enhancements by Henry Burns and Vitaly Wool >- more accurate reclaimed slab caches calculations by Yafang Shao >- fix MAP_UNINITIALIZED UAPI symbol to not depend on config, by >Christoph Hellwig >- !CONFIG_MMU fixes by Christoph Hellwig >- new novmcoredd parameter to omit device dumps from vmcore, by Kairui Song >- new test_meminit module for testing heap and pagealloc initialization, >by Alexander Potapenko >- ioremap improvements for huge mappings, by Anshuman Khandual >- generalize kprobe page fault handling, by Anshuman Khandual >- device-dax hotplug fixes and improvements, by Pavel Tatashin >- enable synchronous DAX fault on powerpc, by Aneesh Kumar K.V >- add pte_devmap() support for arm64, by Robin Murphy >- unify locked_vm accounting with a helper, by Daniel Jordan >- several misc fixes > >core/lib >- new typeof_member() macro including some users, by Alexey Dobriyan >- make BIT() and GENMASK() available in asm, by Masahiro Yamada >- changed LIST_POISON2 on x86_64 to 0xdead000000000122 for better code >generation, by Alexey Dobriyan >- rbtree code size optimizations, by Michel Lespinasse >- convert struct pid count to refcount_t, by Joel Fernandes > >get_maintainer.pl >- add --no-moderated switch to skip moderated ML's, by Joe Perches > > [-- Attachment #2: signature.asc --] [-- Type: application/pgp-signature, Size: 488 bytes --] ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-07-17 8:47 ` incoming Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury @ 2019-07-17 16:13 ` Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 1 sibling, 2 replies; 389+ messages in thread From: Linus Torvalds @ 2019-07-17 16:13 UTC (permalink / raw) To: Vlastimil Babka Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: > > So I've tried now to provide an example what I had in mind, below. I'll take it as a trial. I added one-line notes about coda and the PTRACE_GET_SYSCALL_INFO interface too. I do hope that eventually I'll just get pull requests, and they'll have more of a "theme" than this all (*) Linus (*) Although in many ways, the theme for Andrew is "falls through the cracks otherwise" so I'm not really complaining. This has been working for years and years. ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-07-17 16:13 ` incoming Linus Torvalds @ 2019-07-17 17:09 ` Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 1 sibling, 0 replies; 389+ messages in thread From: Christian Brauner @ 2019-07-17 17:09 UTC (permalink / raw) To: Linus Torvalds Cc: Vlastimil Babka, Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On Wed, Jul 17, 2019 at 09:13:26AM -0700, Linus Torvalds wrote: > On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: > > > > So I've tried now to provide an example what I had in mind, below. > > I'll take it as a trial. I added one-line notes about coda and the > PTRACE_GET_SYSCALL_INFO interface too. > > I do hope that eventually I'll just get pull requests, and they'll > have more of a "theme" than this all (*) > > Linus > > (*) Although in many ways, the theme for Andrew is "falls through the > cracks otherwise" so I'm not really complaining. This has been working I put all pid{fd}/clone{3} which is mostly related to pid.c, exit.c, fork.c into my tree and try to give it a consistent theme for the prs I sent. And that at least from my perspective that worked and was pretty easy to coordinate with Andrew. That should hopefully make it a little easier to theme the -mm tree overall going forward. ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2019-07-17 16:13 ` incoming Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner @ 2019-07-17 18:13 ` Vlastimil Babka 1 sibling, 0 replies; 389+ messages in thread From: Vlastimil Babka @ 2019-07-17 18:13 UTC (permalink / raw) To: Linus Torvalds Cc: Linux List Kernel Mailing, linux-mm, Jonathan Corbet, Thorsten Leemhuis On 7/17/19 6:13 PM, Linus Torvalds wrote: > On Wed, Jul 17, 2019 at 1:47 AM Vlastimil Babka <vbabka@suse.cz> wrote: >> >> So I've tried now to provide an example what I had in mind, below. > > I'll take it as a trial. I added one-line notes about coda and the > PTRACE_GET_SYSCALL_INFO interface too. Thanks. > I do hope that eventually I'll just get pull requests, Very much agree, that was also discussed at length in the LSF/MM mm process session I've linked. > and they'll > have more of a "theme" than this all (*) I'll check if the first patch bomb would be more amenable to that, as I plan to fill in the mm part for 5.3 on LinuxChanges wiki, but for a merge commit it's too late. > Linus > > (*) Although in many ways, the theme for Andrew is "falls through the > cracks otherwise" so I'm not really complaining. This has been working > for years and years. Nevermind the misc stuff that much, but I think mm itself is more important and deserves what other subsystems have. ^ permalink raw reply [flat|nested] 389+ messages in thread
* incoming @ 2007-05-02 22:02 Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt ` (2 more replies) 0 siblings, 3 replies; 389+ messages in thread From: Andrew Morton @ 2007-05-02 22:02 UTC (permalink / raw) To: Linus Torvalds Cc: Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm So this is what I have lined up for the first mm->2.6.22 batch. I won't be sending it off for another 12-24 hours yet. To give people time for final comment and to give me time to see if it actually works. - A few serial bits. - A few pcmcia bits. - Some of the MM queue. Includes: - An enhancement to /proc/pid/smaps to permit monitoring of a running program's working set. There's another patchset which builds on this quite a lot from Matt Mackall, but it's not quite ready yet. - The SLUB allocator. It's pretty green but I do want to push ahead with this pretty aggressively with a view to replacing slab altogether. If it ends up not working out then we should remove slub altogether again, but I doubt if that will occur. If SLUB isn't in good shape by 2.6.22 we should hide it in Kconfig to prevent people from hitting known problems. It'll remain EXPERIMENTAL. - generic pagetable quicklist management. We have x86_64 and ia64 and sparc64 implementations, but I'll only include David's sparc64 implementation here. I'll send the x86_64 and ia64 implementations through maintainers. - Various random MM bits - Benh's teach-get_unmapped_area-about-MAP_FIXED changes - madvise(MADV_FREE) This means I'm holding back Mel's page allocator work, and Andy's lumpy-reclaim. A shame in a way - I have high hopes for lumpy reclaim against the moveable zone, but these things are not to be done lightly. A few MM things have been held back awaiting subsystem tree merges (probably x86 - I didn't check). - One little security patch - the blackfin architecture - small h8300 update - small alpha update - swsusp updates - m68k bits - cris udpates - Lots of UML updates - v850, xtensa slab-introduce-krealloc.patch at91_cf-minor-fix.patch add-new_id-to-pcmcia-drivers.patch ide-cs-recognize-2gb-compactflash-from-transcend.patch serial-driver-pmc-msp71xx.patch rm9000-serial-driver.patch serial-define-fixed_port-flag-for-serial_core.patch serial-use-resource_size_t-for-serial-port-io-addresses.patch mpsc-serial-driver-tx-locking.patch 8250_pci-fix-pci-must_checks.patch serial-serial_core-use-pr_debug.patch add-apply_to_page_range-which-applies-a-function-to-a-pte-range.patch safer-nr_node_ids-and-nr_node_ids-determination-and-initial.patch use-zvc-counters-to-establish-exact-size-of-dirtyable-pages.patch proper-prototype-for-hugetlb_get_unmapped_area.patch mm-remove-gcc-workaround.patch slab-ensure-cache_alloc_refill-terminates.patch mm-make-read_cache_page-synchronous.patch fs-buffer-dont-pageuptodate-without-page-locked.patch allow-oom_adj-of-saintly-processes.patch introduce-config_has_dma.patch mm-slabc-proper-prototypes.patch add-pfn_valid_within-helper-for-sub-max_order-hole-detection.patch mm-simplify-filemap_nopage.patch add-unitialized_var-macro-for-suppressing-gcc-warnings.patch i386-add-ptep_test_and_clear_dirtyyoung.patch i386-use-pte_update_defer-in-ptep_test_and_clear_dirtyyoung.patch smaps-extract-pmd-walker-from-smaps-code.patch smaps-add-pages-referenced-count-to-smaps.patch smaps-add-clear_refs-file-to-clear-reference.patch readahead-improve-heuristic-detecting-sequential-reads.patch readahead-code-cleanup.patch slab-use-num_possible_cpus-in-enable_cpucache.patch slab-dont-allocate-empty-shared-caches.patch slab-numa-kmem_cache-diet.patch do-not-disable-interrupts-when-reading-min_free_kbytes.patch slab-mark-set_up_list3s-__init.patch cpusets-allow-tif_memdie-threads-to-allocate-anywhere.patch i386-use-page-allocator-to-allocate-thread_info-structure.patch slub-core.patch make-page-private-usable-in-compound-pages-v1.patch optimize-compound_head-by-avoiding-a-shared-page.patch add-virt_to_head_page-and-consolidate-code-in-slab-and-slub.patch slub-fix-object-tracking.patch slub-enable-tracking-of-full-slabs.patch slub-validation-of-slabs-metadata-and-guard-zones.patch slub-add-min_partial.patch slub-add-ability-to-list-alloc--free-callers-per-slab.patch slub-free-slabs-and-sort-partial-slab-lists-in-kmem_cache_shrink.patch slub-remove-object-activities-out-of-checking-functions.patch slub-user-documentation.patch slub-add-slabinfo-tool.patch quicklists-for-page-table-pages.patch quicklist-support-for-sparc64.patch slob-handle-slab_panic-flag.patch include-kern_-constant-in-printk-calls-in-mm-slabc.patch mm-madvise-avoid-exclusive-mmap_sem.patch mm-remove-destroy_dirty_buffers-from-invalidate_bdev.patch mm-optimize-kill_bdev.patch mm-optimize-acorn-partition-truncate.patch slab-allocators-remove-obsolete-slab_must_hwcache_align.patch kmem_cache-simplify-slab-cache-creation.patch slab-allocators-remove-multiple-alignment-specifications.patch fault-injection-fix-failslab-with-config_numa.patch mm-fix-handling-of-panic_on_oom-when-cpusets-are-in-use.patch oom-fix-constraint-deadlock.patch get_unmapped_area-handles-map_fixed-on-powerpc.patch get_unmapped_area-handles-map_fixed-on-alpha.patch get_unmapped_area-handles-map_fixed-on-arm.patch get_unmapped_area-handles-map_fixed-on-frv.patch get_unmapped_area-handles-map_fixed-on-i386.patch get_unmapped_area-handles-map_fixed-on-ia64.patch get_unmapped_area-handles-map_fixed-on-parisc.patch get_unmapped_area-handles-map_fixed-on-sparc64.patch get_unmapped_area-handles-map_fixed-on-x86_64.patch get_unmapped_area-handles-map_fixed-in-hugetlbfs.patch get_unmapped_area-handles-map_fixed-in-generic-code.patch get_unmapped_area-doesnt-need-hugetlbfs-hacks-anymore.patch slab-allocators-remove-slab_debug_initial-flag.patch slab-allocators-remove-slab_ctor_atomic.patch slab-allocators-remove-useless-__gfp_no_grow-flag.patch lazy-freeing-of-memory-through-madv_free.patch restore-madv_dontneed-to-its-original-linux-behaviour.patch hugetlbfs-add-null-check-in-hugetlb_zero_setup.patch slob-fix-page-order-calculation-on-not-4kb-page.patch page-migration-only-migrate-pages-if-allocation-in-the-highest-zone-is-possible.patch return-eperm-not-echild-on-security_task_wait-failure.patch blackfin-arch.patch driver_bfin_serial_core.patch blackfin-on-chip-ethernet-mac-controller-driver.patch blackfin-patch-add-blackfin-support-in-smc91x.patch blackfin-on-chip-rtc-controller-driver.patch blackfin-blackfin-on-chip-spi-controller-driver.patch convert-h8-300-to-generic-timekeeping.patch h8300-generic-irq.patch h8300-add-zimage-support.patch round_up-macro-cleanup-in-arch-alpha-kernel-osf_sysc.patch alpha-fix-bootp-image-creation.patch alpha-prctl-macros.patch srmcons-fix-kmallocgfp_kernel-inside-spinlock.patch arm26-remove-useless-config-option-generic_bust_spinlock.patch fix-refrigerator-vs-thaw_process-race.patch swsusp-use-inline-functions-for-changing-page-flags.patch swsusp-do-not-use-page-flags.patch mm-remove-unused-page-flags.patch swsusp-fix-error-paths-in-snapshot_open.patch swsusp-use-gfp_kernel-for-creating-basic-data-structures.patch freezer-remove-pf_nofreeze-from-handle_initrd.patch swsusp-use-rbtree-for-tracking-allocated-swap.patch freezer-fix-racy-usage-of-try_to_freeze-in-kswapd.patch remove-software_suspend.patch power-management-change-sys-power-disk-display.patch kconfig-mentioneds-hibernation-not-just-swsusp.patch swsusp-fix-snapshot_release.patch swsusp-free-more-memory.patch remove-unused-header-file-arch-m68k-atari-atasoundh.patch spin_lock_unlocked-cleanup-in-arch-m68k.patch remove-unused-header-file-drivers-serial-crisv10h.patch cris-check-for-memory-allocation.patch cris-remove-code-related-to-pre-22-kernel.patch uml-delete-unused-code.patch uml-formatting-fixes.patch uml-host_info-tidying.patch uml-mark-tt-mode-code-for-future-removal.patch uml-print-coredump-limits.patch uml-handle-block-device-hotplug-errors.patch uml-driver-formatting-fixes.patch uml-driver-formatting-fixes-fix.patch uml-network-interface-hotplug-error-handling.patch array_size-check-for-type.patch uml-move-sigio-testing-to-sigioc.patch uml-create-archh.patch uml-create-as-layouth.patch uml-move-remaining-useful-contents-of-user_utilh.patch uml-remove-user_utilh.patch uml-add-missing-__init-declarations.patch remove-unused-header-file-arch-um-kernel-tt-include-mode_kern-tth.patch uml-improve-checking-and-diagnostics-of-ethernet-macs.patch uml-eliminate-temporary-buffer-in-eth_configure.patch uml-replace-one-element-array-with-zero-element-array.patch uml-fix-umid-in-xterm-titles.patch uml-speed-up-exec.patch uml-no-locking-needed-in-tlsc.patch uml-tidy-processc.patch uml-remove-page_size.patch uml-kernel_thread-shouldnt-panic.patch uml-tidy-fault-code.patch uml-kernel-segfaults-should-dump-proper-registers.patch uml-comment-early-boot-locking.patch uml-irq-locking-commentary.patch uml-delete-host_frame_size.patch uml-drivers-get-release-methods.patch uml-dump-registers-on-ptrace-or-wait-failure.patch uml-speed-up-page-table-walking.patch uml-remove-unused-x86_64-code.patch uml-start-fixing-os_read_file-and-os_write_file.patch uml-tidy-libc-code.patch uml-convert-libc-layer-to-call-read-and-write.patch uml-batch-i-o-requests.patch uml-send-pointers-instead-of-structures-to-i-o-thread.patch uml-send-pointers-instead-of-structures-to-i-o-thread-fix.patch uml-dump-core-on-panic.patch uml-dont-try-to-handle-signals-on-initial-process-stack.patch uml-change-remaining-callers-of-os_read_write_file.patch uml-formatting-fixes-around-os_read_write_file-callers.patch uml-remove-debugging-remnants.patch uml-rename-os_read_write_file_k-back-to-os_read_write_file.patch uml-aio-deadlock-avoidance.patch uml-speed-page-fault-path.patch uml-eliminate-a-piece-of-debugging-code.patch uml-more-page-fault-path-trimming.patch uml-only-flush-areas-covered-by-vma.patch uml-out-of-tmpfs-space-error-clarification.patch uml-virtualized-time-fix.patch uml-fix-prototypes.patch v850-generic-timekeeping-conversion.patch xtensa-strlcpy-is-smart-enough.patch -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton @ 2007-05-02 22:31 ` Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King 2007-05-04 13:37 ` incoming Greg KH 2 siblings, 0 replies; 389+ messages in thread From: Benjamin Herrenschmidt @ 2007-05-02 22:31 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, linux-kernel, linux-mm On Wed, 2007-05-02 at 15:02 -0700, Andrew Morton wrote: > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > sending it off for another 12-24 hours yet. To give people time for final > comment and to give me time to see if it actually works. Thanks. I have some powerpc bits that depend on that stuff that will go through Paulus after these show up in git and I've rebased. Cheers, Ben. -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt @ 2007-05-03 7:55 ` Russell King 2007-05-03 8:05 ` incoming Andrew Morton 2007-05-04 13:37 ` incoming Greg KH 2 siblings, 1 reply; 389+ messages in thread From: Russell King @ 2007-05-03 7:55 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > sending it off for another 12-24 hours yet. To give people time for final > comment and to give me time to see if it actually works. I assume you're going to update this list with my comments I sent yesterday? -- Russell King Linux kernel 2.6 ARM Linux - http://www.arm.linux.org.uk/ maintainer of: -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-03 7:55 ` incoming Russell King @ 2007-05-03 8:05 ` Andrew Morton 0 siblings, 0 replies; 389+ messages in thread From: Andrew Morton @ 2007-05-03 8:05 UTC (permalink / raw) To: Russell King Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Thu, 3 May 2007 08:55:43 +0100 Russell King <rmk+lkml@arm.linux.org.uk> wrote: > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > So this is what I have lined up for the first mm->2.6.22 batch. I won't be > > sending it off for another 12-24 hours yet. To give people time for final > > comment and to give me time to see if it actually works. > > I assume you're going to update this list with my comments I sent > yesterday? > Serial drivers? Well you saw me drop a bunch of them. I now have: serial-driver-pmc-msp71xx.patch rm9000-serial-driver.patch serial-define-fixed_port-flag-for-serial_core.patch mpsc-serial-driver-tx-locking.patch serial-serial_core-use-pr_debug.patch I'll also be holding off on MADV_FREE - Nick has some performance things to share and I'm assuming they're not as good as he'd like. -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King @ 2007-05-04 13:37 ` Greg KH 2007-05-04 16:14 ` incoming Andrew Morton 2 siblings, 1 reply; 389+ messages in thread From: Greg KH @ 2007-05-04 13:37 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > - One little security patch Care to cc: linux-stable with it so we can do a new 2.6.21 release with it if needed? thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-04 13:37 ` incoming Greg KH @ 2007-05-04 16:14 ` Andrew Morton 2007-05-04 17:02 ` incoming Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 0 siblings, 2 replies; 389+ messages in thread From: Andrew Morton @ 2007-05-04 16:14 UTC (permalink / raw) To: Greg KH Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Roland McGrath, Stephen Smalley On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote: > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > - One little security patch > > Care to cc: linux-stable with it so we can do a new 2.6.21 release with > it if needed? > Ah. The patch affects security code, but it doesn't actually address any insecurity. I didn't think it was needed for -stable? From: Roland McGrath <roland@redhat.com> wait* syscalls return -ECHILD even when an individual PID of a live child was requested explicitly, when security_task_wait denies the operation. This means that something like a broken SELinux policy can produce an unexpected failure that looks just like a bug with wait or ptrace or something. This patch makes do_wait return -EACCES (or other appropriate error returned from security_task_wait() instead of -ECHILD if some children were ruled out solely because security_task_wait failed. [jmorris@namei.org: switch error code to EACCES] Signed-off-by: Roland McGrath <roland@redhat.com> Cc: Stephen Smalley <sds@tycho.nsa.gov> Cc: Chris Wright <chrisw@sous-sol.org> Cc: James Morris <jmorris@namei.org> Signed-off-by: Andrew Morton <akpm@linux-foundation.org> --- kernel/exit.c | 17 +++++++++++++++-- 1 files changed, 15 insertions(+), 2 deletions(-) diff -puN kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure kernel/exit.c --- a/kernel/exit.c~return-eperm-not-echild-on-security_task_wait-failure +++ a/kernel/exit.c @@ -1033,6 +1033,8 @@ asmlinkage void sys_exit_group(int error static int eligible_child(pid_t pid, int options, struct task_struct *p) { + int err; + if (pid > 0) { if (p->pid != pid) return 0; @@ -1066,8 +1068,9 @@ static int eligible_child(pid_t pid, int if (delay_group_leader(p)) return 2; - if (security_task_wait(p)) - return 0; + err = security_task_wait(p); + if (err) + return err; return 1; } @@ -1449,6 +1452,7 @@ static long do_wait(pid_t pid, int optio DECLARE_WAITQUEUE(wait, current); struct task_struct *tsk; int flag, retval; + int allowed, denied; add_wait_queue(¤t->signal->wait_chldexit,&wait); repeat: @@ -1457,6 +1461,7 @@ repeat: * match our criteria, even if we are not able to reap it yet. */ flag = 0; + allowed = denied = 0; current->state = TASK_INTERRUPTIBLE; read_lock(&tasklist_lock); tsk = current; @@ -1472,6 +1477,12 @@ repeat: if (!ret) continue; + if (unlikely(ret < 0)) { + denied = ret; + continue; + } + allowed = 1; + switch (p->state) { case TASK_TRACED: /* @@ -1570,6 +1581,8 @@ check_continued: goto repeat; } retval = -ECHILD; + if (unlikely(denied) && !allowed) + retval = denied; end: current->state = TASK_RUNNING; remove_wait_queue(¤t->signal->wait_chldexit,&wait); _ -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-04 16:14 ` incoming Andrew Morton @ 2007-05-04 17:02 ` Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 1 sibling, 0 replies; 389+ messages in thread From: Greg KH @ 2007-05-04 17:02 UTC (permalink / raw) To: Andrew Morton Cc: Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Roland McGrath, Stephen Smalley On Fri, May 04, 2007 at 09:14:34AM -0700, Andrew Morton wrote: > On Fri, 4 May 2007 06:37:28 -0700 Greg KH <greg@kroah.com> wrote: > > > On Wed, May 02, 2007 at 03:02:52PM -0700, Andrew Morton wrote: > > > - One little security patch > > > > Care to cc: linux-stable with it so we can do a new 2.6.21 release with > > it if needed? > > > > Ah. The patch affects security code, but it doesn't actually address any > insecurity. I didn't think it was needed for -stable? Ah, ok, I read "security" as fixing a insecure problem, my mistake :) thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-04 16:14 ` incoming Andrew Morton 2007-05-04 17:02 ` incoming Greg KH @ 2007-05-04 18:57 ` Roland McGrath 2007-05-04 19:24 ` incoming Greg KH 1 sibling, 1 reply; 389+ messages in thread From: Roland McGrath @ 2007-05-04 18:57 UTC (permalink / raw) To: Andrew Morton Cc: Greg KH, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley > Ah. The patch affects security code, but it doesn't actually address any > insecurity. I didn't think it was needed for -stable? I would not recommend it for -stable. It is an ABI change for the case of a security refusal. Thanks, Roland -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-04 18:57 ` incoming Roland McGrath @ 2007-05-04 19:24 ` Greg KH 2007-05-04 19:29 ` incoming Roland McGrath 0 siblings, 1 reply; 389+ messages in thread From: Greg KH @ 2007-05-04 19:24 UTC (permalink / raw) To: Roland McGrath Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley On Fri, May 04, 2007 at 11:57:21AM -0700, Roland McGrath wrote: > > Ah. The patch affects security code, but it doesn't actually address any > > insecurity. I didn't think it was needed for -stable? > > I would not recommend it for -stable. > It is an ABI change for the case of a security refusal. ABI changes are not a problem for -stable, so don't let that stop anyone :) thanks, greg k-h -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
* Re: incoming 2007-05-04 19:24 ` incoming Greg KH @ 2007-05-04 19:29 ` Roland McGrath 0 siblings, 0 replies; 389+ messages in thread From: Roland McGrath @ 2007-05-04 19:29 UTC (permalink / raw) To: Greg KH Cc: Andrew Morton, Linus Torvalds, Hugh Dickins, Christoph Lameter, David S. Miller, Andi Kleen, Luck, Tony, Rik van Riel, Benjamin Herrenschmidt, linux-kernel, linux-mm, Stephen Smalley > ABI changes are not a problem for -stable, so don't let that stop anyone > :) In fact this is the harmless sort (changes only the error code of a failure case) that might actually go in if there were any important reason. But the smiley stands. Thanks, Roland -- To unsubscribe, send a message with 'unsubscribe linux-mm' in the body to majordomo@kvack.org. For more info on Linux MM, see: http://www.linux-mm.org/ . Don't email: <a href=mailto:"dont@kvack.org"> email@kvack.org </a> ^ permalink raw reply [flat|nested] 389+ messages in thread
end of thread, other threads:[~2022-04-27 19:41 UTC | newest] Thread overview: 389+ messages (download: mbox.gz / follow: Atom feed) -- links below jump to the message on this page -- 2020-10-13 23:46 incoming Andrew Morton 2020-10-13 23:47 ` [patch 001/181] compiler-clang: add build check for clang 10.0.1 Andrew Morton 2020-10-13 23:47 ` [patch 002/181] Revert "kbuild: disable clang's default use of -fmerge-all-constants" Andrew Morton 2020-10-13 23:47 ` [patch 003/181] Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support" Andrew Morton 2020-10-13 23:47 ` [patch 004/181] Revert "arm64: vdso: Fix compilation with clang older than 8" Andrew Morton 2020-10-13 23:47 ` [patch 005/181] Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer" Andrew Morton 2020-10-13 23:47 ` [patch 006/181] kasan: remove mentions of unsupported Clang versions Andrew Morton 2020-10-13 23:47 ` [patch 007/181] compiler-gcc: improve version error Andrew Morton 2020-10-13 23:47 ` [patch 008/181] compiler.h: avoid escaped section names Andrew Morton 2020-10-13 23:48 ` [patch 009/181] export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang Andrew Morton 2020-10-13 23:48 ` [patch 010/181] kbuild: doc: describe proper script invocation Andrew Morton 2020-10-13 23:48 ` [patch 011/181] scripts/spelling.txt: increase error-prone spell checking Andrew Morton 2020-10-13 23:48 ` [patch 012/181] scripts/spelling.txt: add "arbitrary" typo Andrew Morton 2020-10-13 23:48 ` [patch 013/181] scripts/decodecode: add the capability to supply the program counter Andrew Morton 2020-10-13 23:48 ` [patch 014/181] ntfs: add check for mft record size in superblock Andrew Morton 2020-10-13 23:48 ` [patch 015/181] ocfs2: delete repeated words in comments Andrew Morton 2020-10-13 23:48 ` [patch 016/181] ocfs2: fix potential soft lockup during fstrim Andrew Morton 2020-10-13 23:48 ` [patch 017/181] fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr Andrew Morton 2020-10-13 23:48 ` [patch 018/181] fs_parse: mark fs_param_bad_value() as static Andrew Morton 2020-10-13 23:48 ` [patch 019/181] mm/slab.c: clean code by removing redundant if condition Andrew Morton 2020-10-13 23:48 ` [patch 020/181] include/linux/slab.h: fix a typo error in comment Andrew Morton 2020-10-13 23:48 ` [patch 021/181] mm/slub.c: branch optimization in free slowpath Andrew Morton 2020-10-13 23:48 ` [patch 022/181] mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc Andrew Morton 2020-10-13 23:48 ` [patch 023/181] mm/slub: make add_full() condition more explicit Andrew Morton 2020-10-13 23:48 ` [patch 024/181] mm/kmemleak: rely on rcu for task stack scanning Andrew Morton 2020-10-13 23:48 ` [patch 025/181] mm,kmemleak-test.c: move kmemleak-test.c to samples dir Andrew Morton 2020-10-13 23:48 ` [patch 026/181] x86/numa: cleanup configuration dependent command-line options Andrew Morton 2020-10-13 23:49 ` [patch 027/181] x86/numa: add 'nohmat' option Andrew Morton 2020-10-13 23:49 ` [patch 028/181] efi/fake_mem: arrange for a resource entry per efi_fake_mem instance Andrew Morton 2020-10-13 23:49 ` [patch 029/181] ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device Andrew Morton 2020-10-13 23:49 ` [patch 030/181] resource: report parent to walk_iomem_res_desc() callback Andrew Morton 2020-10-13 23:49 ` [patch 031/181] mm/memory_hotplug: introduce default phys_to_target_node() implementation Andrew Morton 2020-10-13 23:49 ` [patch 032/181] ACPI: HMAT: attach a device for each soft-reserved range Andrew Morton 2020-10-13 23:49 ` [patch 033/181] device-dax: drop the dax_region.pfn_flags attribute Andrew Morton 2020-10-13 23:49 ` [patch 034/181] device-dax: move instance creation parameters to 'struct dev_dax_data' Andrew Morton 2020-10-13 23:49 ` [patch 035/181] device-dax: make pgmap optional for instance creation Andrew Morton 2020-10-13 23:49 ` [patch 036/181] device-dax/kmem: introduce dax_kmem_range() Andrew Morton 2020-10-13 23:49 ` [patch 037/181] device-dax/kmem: move resource name tracking to drvdata Andrew Morton 2020-10-13 23:49 ` [patch 038/181] device-dax/kmem: replace release_resource() with release_mem_region() Andrew Morton 2020-10-13 23:50 ` [patch 039/181] device-dax: add an allocation interface for device-dax instances Andrew Morton 2020-10-13 23:50 ` [patch 040/181] device-dax: introduce 'struct dev_dax' typed-driver operations Andrew Morton 2020-10-13 23:50 ` [patch 041/181] device-dax: introduce 'seed' devices Andrew Morton 2020-10-13 23:50 ` [patch 042/181] drivers/base: make device_find_child_by_name() compatible with sysfs inputs Andrew Morton 2020-10-13 23:50 ` [patch 043/181] device-dax: add resize support Andrew Morton 2020-10-13 23:50 ` [patch 044/181] mm/memremap_pages: convert to 'struct range' Andrew Morton 2020-10-13 23:50 ` [patch 045/181] mm/memremap_pages: support multiple ranges per invocation Andrew Morton 2020-10-13 23:50 ` [patch 046/181] device-dax: add dis-contiguous resource support Andrew Morton 2020-10-13 23:50 ` [patch 047/181] device-dax: introduce 'mapping' devices Andrew Morton 2020-10-13 23:50 ` [patch 048/181] device-dax: make align a per-device property Andrew Morton 2020-10-13 23:50 ` [patch 049/181] device-dax: add an 'align' attribute Andrew Morton 2020-10-13 23:51 ` [patch 050/181] dax/hmem: introduce dax_hmem.region_idle parameter Andrew Morton 2020-10-13 23:51 ` [patch 051/181] device-dax: add a range mapping allocation attribute Andrew Morton 2020-10-13 23:51 ` [patch 052/181] mm/debug.c: do not dereference i_ino blindly Andrew Morton 2020-10-13 23:51 ` [patch 053/181] mm, dump_page: rename head_mapcount() --> head_compound_mapcount() Andrew Morton 2020-10-13 23:51 ` [patch 054/181] mm: factor find_get_incore_page out of mincore_page Andrew Morton 2020-10-13 23:51 ` [patch 055/181] mm: use find_get_incore_page in memcontrol Andrew Morton 2020-10-13 23:51 ` [patch 056/181] mm: optimise madvise WILLNEED Andrew Morton 2020-10-13 23:51 ` [patch 057/181] proc: optimise smaps for shmem entries Andrew Morton 2020-10-13 23:51 ` [patch 058/181] i915: use find_lock_page instead of find_lock_entry Andrew Morton 2020-10-13 23:51 ` [patch 059/181] mm: convert find_get_entry to return the head page Andrew Morton 2020-10-13 23:51 ` [patch 060/181] mm/shmem: return head page from find_lock_entry Andrew Morton 2020-10-13 23:51 ` [patch 061/181] mm: add find_lock_head Andrew Morton 2020-10-13 23:51 ` [patch 062/181] mm/filemap: fix filemap_map_pages for THP Andrew Morton 2020-10-13 23:51 ` [patch 063/181] mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED Andrew Morton 2020-10-13 23:51 ` [patch 064/181] mm/gup_benchmark: update the documentation in Kconfig Andrew Morton 2020-10-13 23:51 ` [patch 065/181] mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag Andrew Morton 2020-10-13 23:51 ` [patch 066/181] mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM Andrew Morton 2020-10-13 23:52 ` [patch 067/181] mm/gup: protect unpin_user_pages() against npages==-ERRNO Andrew Morton 2020-10-13 23:52 ` [patch 068/181] swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity Andrew Morton 2020-10-13 23:52 ` [patch 069/181] mm: remove activate_page() from unuse_pte() Andrew Morton 2020-10-13 23:52 ` [patch 070/181] mm: remove superfluous __ClearPageActive() Andrew Morton 2020-10-13 23:52 ` [patch 071/181] mm/swap.c: fix confusing comment in release_pages() Andrew Morton 2020-10-13 23:52 ` [patch 072/181] mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache() Andrew Morton 2020-10-13 23:52 ` [patch 073/181] mm/page_io.c: remove useless out label in __swap_writepage() Andrew Morton 2020-10-13 23:52 ` [patch 074/181] mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable() Andrew Morton 2020-10-13 23:52 ` [patch 075/181] mm/swapfile.c: remove unnecessary goto out in _swap_info_get() Andrew Morton 2020-10-13 23:52 ` [patch 076/181] mm/swapfile.c: fix potential memory leak in sys_swapon Andrew Morton 2020-10-13 23:52 ` [patch 077/181] mm/memremap.c: convert devmap static branch to {inc,dec} Andrew Morton 2020-10-13 23:52 ` [patch 078/181] mm: memcontrol: use flex_array_size() helper in memcpy() Andrew Morton 2020-10-13 23:52 ` [patch 079/181] mm: memcontrol: use the preferred form for passing the size of a structure type Andrew Morton 2020-10-13 23:52 ` [patch 080/181] mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj() Andrew Morton 2020-10-13 23:52 ` [patch 081/181] mm: memcontrol: correct the comment of mem_cgroup_iter() Andrew Morton 2020-10-13 23:52 ` [patch 082/181] mm/memcg: clean up obsolete enum charge_type Andrew Morton 2020-10-13 23:52 ` [patch 083/181] mm/memcg: simplify mem_cgroup_get_max() Andrew Morton 2020-10-13 23:52 ` [patch 084/181] mm/memcg: unify swap and memsw page counters Andrew Morton 2020-10-13 23:52 ` [patch 085/181] mm: memcontrol: add the missing numa_stat interface for cgroup v2 Andrew Morton 2020-10-13 23:53 ` [patch 086/181] mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge() Andrew Morton 2020-10-13 23:53 ` [patch 087/181] mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom() Andrew Morton 2020-10-13 23:53 ` [patch 088/181] mm: memcg/slab: uncharge during kmem_cache_free_bulk() Andrew Morton 2020-10-13 23:53 ` [patch 089/181] mm/memcg: fix device private memcg accounting Andrew Morton 2020-10-13 23:53 ` [patch 090/181] selftests/vm: fix false build success on the second and later attempts Andrew Morton 2020-10-13 23:53 ` [patch 091/181] selftests/vm: fix incorrect gcc invocation in some cases Andrew Morton 2020-10-13 23:53 ` [patch 092/181] mm: account PMD tables like PTE tables Andrew Morton 2020-10-13 23:53 ` [patch 093/181] mm/memory.c: fix typo in __do_fault() comment Andrew Morton 2020-10-13 23:53 ` [patch 094/181] mm/memory.c: replace vmf->vma with variable vma Andrew Morton 2020-10-13 23:53 ` [patch 095/181] mm/mmap: rename __vma_unlink_common() to __vma_unlink() Andrew Morton 2020-10-13 23:53 ` [patch 096/181] mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase() Andrew Morton 2020-10-13 23:53 ` [patch 097/181] mmap locking API: add mmap_lock_is_contended() Andrew Morton 2020-10-13 23:53 ` [patch 098/181] mm: smaps*: extend smap_gather_stats to support specified beginning Andrew Morton 2020-10-13 23:53 ` [patch 099/181] mm: proc: smaps_rollup: do not stall write attempts on mmap_lock Andrew Morton 2020-10-13 23:53 ` [patch 100/181] mm: move PageDoubleMap bit Andrew Morton 2020-10-13 23:53 ` [patch 101/181] mm: simplify PageDoubleMap with PF_SECOND policy Andrew Morton 2020-10-13 23:53 ` [patch 102/181] mm/mmap: leave adjust_next as virtual address instead of page frame number Andrew Morton 2020-10-13 23:54 ` [patch 103/181] mm/memory.c: fix spello of "function" Andrew Morton 2020-10-13 23:54 ` [patch 104/181] mm/mmap: not necessary to check mapping separately Andrew Morton 2020-10-13 23:54 ` [patch 105/181] mm/mmap: check on file instead of the rb_root_cached of its address_space Andrew Morton 2020-10-13 23:54 ` [patch 106/181] mm: use helper function mapping_allow_writable() Andrew Morton 2020-10-13 23:54 ` [patch 107/181] mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct() Andrew Morton 2020-10-13 23:54 ` [patch 108/181] mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct() Andrew Morton 2020-10-13 23:54 ` [patch 109/181] mm: remove src/dst mm parameter in copy_page_range() Andrew Morton 2020-10-13 23:54 ` [patch 110/181] include/linux/huge_mm.h: remove mincore_huge_pmd declaration Andrew Morton 2020-10-13 23:54 ` [patch 111/181] tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro Andrew Morton 2020-10-13 23:54 ` [patch 112/181] lib/test_hmm.c: remove unused dmirror_zero_page Andrew Morton 2020-10-13 23:54 ` [patch 113/181] mm/dmapool.c: replace open-coded list_for_each_entry_safe() Andrew Morton 2020-10-13 23:54 ` [patch 114/181] mm/dmapool.c: replace hard coded function name with __func__ Andrew Morton 2020-10-13 23:54 ` [patch 115/181] mm/memory-failure: do pgoff calculation before for_each_process() Andrew Morton 2020-10-13 23:54 ` [patch 116/181] mm/memory-failure.c: remove unused macro `writeback' Andrew Morton 2020-10-13 23:54 ` [patch 117/181] mm/vmalloc.c: update the comment in __vmalloc_area_node() Andrew Morton 2020-10-13 23:54 ` [patch 118/181] mm/vmalloc.c: fix the comment of find_vm_area Andrew Morton 2020-10-13 23:54 ` [patch 119/181] docs/vm: fix 'mm_count' vs 'mm_users' counter confusion Andrew Morton 2020-10-13 23:54 ` [patch 120/181] kasan/kunit: add KUnit Struct to Current Task Andrew Morton 2020-10-13 23:55 ` [patch 121/181] KUnit: KASAN Integration Andrew Morton 2020-10-13 23:55 ` [patch 122/181] KASAN: port KASAN Tests to KUnit Andrew Morton 2020-10-13 23:55 ` [patch 123/181] KASAN: Testing Documentation Andrew Morton 2020-10-13 23:55 ` [patch 124/181] mm: kasan: do not panic if both panic_on_warn and kasan_multishot set Andrew Morton 2020-10-13 23:55 ` [patch 125/181] mm/page_alloc: tweak comments in has_unmovable_pages() Andrew Morton 2020-10-13 23:55 ` [patch 126/181] mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate() Andrew Morton 2020-10-13 23:55 ` [patch 127/181] mm/page_isolation: drop WARN_ON_ONCE() " Andrew Morton 2020-10-13 23:55 ` [patch 128/181] mm/page_isolation: cleanup set_migratetype_isolate() Andrew Morton 2020-10-13 23:55 ` [patch 129/181] virtio-mem: don't special-case ZONE_MOVABLE Andrew Morton 2020-10-13 23:55 ` [patch 130/181] mm: document semantics of ZONE_MOVABLE Andrew Morton 2020-10-13 23:55 ` [patch 131/181] mm, isolation: avoid checking unmovable pages across pageblock boundary Andrew Morton 2020-10-13 23:55 ` [patch 132/181] mm/page_alloc.c: clean code by removing unnecessary initialization Andrew Morton 2020-10-13 23:55 ` [patch 133/181] mm/page_alloc.c: micro-optimization remove unnecessary branch Andrew Morton 2020-10-13 23:55 ` [patch 134/181] mm/page_alloc.c: fix early params garbage value accesses Andrew Morton 2020-10-13 23:55 ` [patch 135/181] mm/page_alloc.c: clean code by merging two functions Andrew Morton 2020-10-13 23:55 ` [patch 136/181] mm/page_alloc.c: __perform_reclaim should return 'unsigned long' Andrew Morton 2020-10-13 23:55 ` [patch 137/181] mmzone: clean code by removing unused macro parameter Andrew Morton 2020-10-13 23:56 ` [patch 138/181] mm: move call to compound_head() in release_pages() Andrew Morton 2020-10-13 23:56 ` [patch 139/181] mm/page_alloc.c: fix freeing non-compound pages Andrew Morton 2020-10-13 23:56 ` [patch 140/181] include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts Andrew Morton 2020-10-13 23:56 ` [patch 141/181] mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool Andrew Morton 2020-10-13 23:56 ` [patch 142/181] mm/hugetlb.c: remove the unnecessary non_swap_entry() Andrew Morton 2020-10-13 23:56 ` [patch 143/181] doc/vm: fix typo in the hugetlb admin documentation Andrew Morton 2020-10-13 23:56 ` [patch 144/181] mm/hugetlb: not necessary to coalesce regions recursively Andrew Morton 2020-10-13 23:56 ` [patch 145/181] mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache() Andrew Morton 2020-10-13 23:56 ` [patch 146/181] mm/hugetlb: use list_splice to merge two list at once Andrew Morton 2020-10-13 23:56 ` [patch 147/181] mm/hugetlb: count file_region to be added when regions_needed != NULL Andrew Morton 2020-10-13 23:56 ` [patch 148/181] mm/hugetlb: a page from buddy is not on any list Andrew Morton 2020-10-13 23:56 ` [patch 149/181] mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page Andrew Morton 2020-10-13 23:56 ` [patch 150/181] mm/hugetlb: take the free hpage during the iteration directly Andrew Morton 2020-10-13 23:56 ` [patch 151/181] hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share Andrew Morton 2020-10-13 23:56 ` [patch 152/181] mm/vmscan: fix infinite loop in drop_slab_node Andrew Morton 2020-10-13 23:56 ` [patch 153/181] mm/vmscan: fix comments for isolate_lru_page() Andrew Morton 2020-10-13 23:56 ` [patch 154/181] mm/z3fold.c: use xx_zalloc instead xx_alloc and memset Andrew Morton 2020-10-13 23:56 ` [patch 155/181] mm/zbud: remove redundant initialization Andrew Morton 2020-10-13 23:56 ` [patch 156/181] mm/compaction.c: micro-optimization remove unnecessary branch Andrew Morton 2020-10-13 23:57 ` [patch 157/181] include/linux/compaction.h: clean code by removing unused enum value Andrew Morton 2020-10-13 23:57 ` [patch 158/181] selftests/vm: 8x compaction_test speedup Andrew Morton 2020-10-13 23:57 ` [patch 159/181] mm/mempolicy: remove or narrow the lock on current Andrew Morton 2020-10-13 23:57 ` [patch 160/181] mm: remove unused alloc_page_vma_node() Andrew Morton 2020-10-13 23:57 ` [patch 161/181] mm/mempool: add 'else' to split mutually exclusive case Andrew Morton 2020-10-13 23:57 ` [patch 162/181] KVM: PPC: Book3S HV: simplify kvm_cma_reserve() Andrew Morton 2020-10-13 23:57 ` [patch 163/181] dma-contiguous: simplify cma_early_percent_memory() Andrew Morton 2020-10-13 23:57 ` [patch 164/181] arm, xtensa: simplify initialization of high memory pages Andrew Morton 2020-10-13 23:57 ` [patch 165/181] arm64: numa: simplify dummy_numa_init() Andrew Morton 2020-10-13 23:57 ` [patch 166/181] h8300, nds32, openrisc: simplify detection of memory extents Andrew Morton 2020-10-13 23:57 ` [patch 167/181] riscv: drop unneeded node initialization Andrew Morton 2020-10-13 23:57 ` [patch 168/181] mircoblaze: drop unneeded NUMA and sparsemem initializations Andrew Morton 2020-10-13 23:57 ` [patch 169/181] memblock: make for_each_memblock_type() iterator private Andrew Morton 2020-10-13 23:57 ` [patch 170/181] memblock: make memblock_debug and related functionality private Andrew Morton 2020-10-13 23:57 ` [patch 171/181] memblock: reduce number of parameters in for_each_mem_range() Andrew Morton 2020-10-13 23:58 ` [patch 172/181] arch, mm: replace for_each_memblock() with for_each_mem_pfn_range() Andrew Morton 2020-10-13 23:58 ` [patch 173/181] arch, drivers: replace for_each_membock() with for_each_mem_range() Andrew Morton 2020-10-13 23:58 ` [patch 174/181] x86/setup: simplify initrd relocation and reservation Andrew Morton 2020-10-13 23:58 ` [patch 175/181] x86/setup: simplify reserve_crashkernel() Andrew Morton 2020-10-13 23:58 ` [patch 176/181] memblock: remove unused memblock_mem_size() Andrew Morton 2020-10-13 23:58 ` [patch 177/181] memblock: implement for_each_reserved_mem_region() using __next_mem_region() Andrew Morton 2020-10-13 23:58 ` [patch 178/181] memblock: use separate iterators for memory and reserved regions Andrew Morton 2020-10-13 23:58 ` [patch 179/181] mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary Andrew Morton 2020-10-13 23:58 ` [patch 180/181] mm/migrate: remove cpages-- in migrate_vma_finalize() Andrew Morton 2020-10-13 23:58 ` [patch 181/181] mm/migrate: remove obsolete comment about device public Andrew Morton -- strict thread matches above, loose matches on Subject: below -- 2022-04-27 19:41 incoming Andrew Morton 2022-04-21 23:35 incoming Andrew Morton 2022-04-15 2:12 incoming Andrew Morton 2022-04-08 20:08 incoming Andrew Morton 2022-04-01 18:27 incoming Andrew Morton 2022-04-01 18:20 incoming Andrew Morton 2022-04-01 18:27 ` incoming Andrew Morton 2022-03-25 1:07 incoming Andrew Morton 2022-03-23 23:04 incoming Andrew Morton 2022-03-22 21:38 incoming Andrew Morton 2022-03-16 23:14 incoming Andrew Morton 2022-03-05 4:28 incoming Andrew Morton 2022-02-26 3:10 incoming Andrew Morton 2022-02-12 0:27 incoming Andrew Morton 2022-02-12 2:02 ` incoming Linus Torvalds 2022-02-12 5:24 ` incoming Andrew Morton 2022-02-04 4:48 incoming Andrew Morton 2022-01-29 21:40 incoming Andrew Morton 2022-01-29 2:13 incoming Andrew Morton 2022-01-29 4:25 ` incoming Matthew Wilcox 2022-01-29 6:23 ` incoming Andrew Morton 2022-01-22 6:10 incoming Andrew Morton 2022-01-20 2:07 incoming Andrew Morton 2022-01-14 22:02 incoming Andrew Morton 2021-12-31 4:12 incoming Andrew Morton 2021-12-25 5:11 incoming Andrew Morton 2021-12-10 22:45 incoming Andrew Morton 2021-11-20 0:42 incoming Andrew Morton 2021-11-11 4:32 incoming Andrew Morton 2021-11-09 2:30 incoming Andrew Morton 2021-11-05 20:34 incoming Andrew Morton 2021-10-28 21:35 incoming Andrew Morton 2021-10-18 22:14 incoming Andrew Morton 2021-09-24 22:42 incoming Andrew Morton 2021-09-10 3:09 incoming Andrew Morton 2021-09-10 17:11 ` incoming Kees Cook 2021-09-10 20:13 ` incoming Kees Cook 2021-09-09 1:08 incoming Andrew Morton 2021-09-08 22:17 incoming Andrew Morton 2021-09-08 2:52 incoming Andrew Morton 2021-09-08 8:57 ` incoming Vlastimil Babka 2021-09-02 21:48 incoming Andrew Morton 2021-09-02 21:49 ` incoming Andrew Morton 2021-08-25 19:17 incoming Andrew Morton 2021-08-20 2:03 incoming Andrew Morton 2021-08-13 23:53 incoming Andrew Morton 2021-07-29 21:52 incoming Andrew Morton 2021-07-23 22:49 incoming Andrew Morton 2021-07-15 4:26 incoming Andrew Morton 2021-07-08 0:59 incoming Andrew Morton 2021-07-01 1:46 incoming Andrew Morton 2021-07-03 0:28 ` incoming Linus Torvalds 2021-07-03 1:06 ` incoming Linus Torvalds 2021-06-29 2:32 incoming Andrew Morton 2021-06-25 1:38 incoming Andrew Morton 2021-06-16 1:22 incoming Andrew Morton 2021-06-05 3:00 incoming Andrew Morton 2021-05-23 0:41 incoming Andrew Morton 2021-05-15 0:26 incoming Andrew Morton 2021-05-07 1:01 incoming Andrew Morton 2021-05-07 7:12 ` incoming Linus Torvalds 2021-05-05 1:32 incoming Andrew Morton 2021-05-05 1:47 ` incoming Linus Torvalds 2021-05-05 3:16 ` incoming Andrew Morton 2021-05-05 17:10 ` incoming Linus Torvalds 2021-05-05 17:44 ` incoming Andrew Morton 2021-05-06 3:19 ` incoming Anshuman Khandual 2021-04-30 5:52 incoming Andrew Morton 2021-04-23 21:28 incoming Andrew Morton 2021-04-16 22:45 incoming Andrew Morton 2021-04-09 20:26 incoming Andrew Morton 2021-03-25 4:36 incoming Andrew Morton 2021-03-13 5:06 incoming Andrew Morton 2021-02-26 1:14 incoming Andrew Morton 2021-02-26 17:55 ` incoming Linus Torvalds 2021-02-26 19:16 ` incoming Andrew Morton 2021-02-24 19:58 incoming Andrew Morton 2021-02-24 21:30 ` incoming Linus Torvalds 2021-02-24 21:37 ` incoming Linus Torvalds 2021-02-25 8:53 ` incoming Arnd Bergmann 2021-02-25 9:12 ` incoming Andrey Ryabinin 2021-02-25 11:07 ` incoming Walter Wu 2021-02-13 4:52 incoming Andrew Morton 2021-02-09 21:41 incoming Andrew Morton 2021-02-10 19:30 ` incoming Linus Torvalds 2021-02-05 2:31 incoming Andrew Morton 2021-01-24 5:00 incoming Andrew Morton 2021-01-12 23:48 incoming Andrew Morton 2021-01-15 23:32 ` incoming Linus Torvalds 2020-12-29 23:13 incoming Andrew Morton 2020-12-22 19:58 incoming Andrew Morton 2020-12-22 21:43 ` incoming Linus Torvalds 2020-12-18 22:00 incoming Andrew Morton 2020-12-16 4:41 incoming Andrew Morton 2020-12-15 20:32 incoming Andrew Morton 2020-12-15 21:00 ` incoming Linus Torvalds 2020-12-15 22:48 ` incoming Linus Torvalds 2020-12-15 22:49 ` incoming Linus Torvalds 2020-12-15 22:55 ` incoming Andrew Morton 2020-12-15 3:02 incoming Andrew Morton 2020-12-15 3:25 ` incoming Linus Torvalds 2020-12-15 3:30 ` incoming Linus Torvalds 2020-12-15 14:04 ` incoming Konstantin Ryabitsev 2020-12-11 21:35 incoming Andrew Morton 2020-12-06 6:14 incoming Andrew Morton 2020-11-22 6:16 incoming Andrew Morton 2020-11-14 6:51 incoming Andrew Morton 2020-11-02 1:06 incoming Andrew Morton 2020-10-17 23:13 incoming Andrew Morton 2020-10-16 2:40 incoming Andrew Morton 2020-10-16 3:03 ` incoming Andrew Morton 2020-10-11 6:15 incoming Andrew Morton 2020-10-03 5:20 incoming Andrew Morton 2020-09-26 4:17 incoming Andrew Morton 2020-09-19 4:19 incoming Andrew Morton 2020-09-04 23:34 incoming Andrew Morton 2020-08-21 0:41 incoming Andrew Morton 2020-08-15 0:29 incoming Andrew Morton 2020-08-12 1:29 incoming Andrew Morton 2020-08-07 6:16 incoming Andrew Morton 2020-07-24 4:14 incoming Andrew Morton 2020-07-03 22:14 incoming Andrew Morton 2020-06-26 3:28 incoming Andrew Morton 2020-06-26 6:51 ` incoming Linus Torvalds 2020-06-26 7:31 ` incoming Linus Torvalds 2020-06-26 17:39 ` incoming Konstantin Ryabitsev 2020-06-26 17:40 ` incoming Konstantin Ryabitsev 2020-06-12 0:30 incoming Andrew Morton 2020-06-11 1:40 incoming Andrew Morton 2020-06-09 4:29 incoming Andrew Morton 2020-06-09 16:58 ` incoming Linus Torvalds 2020-06-08 4:35 incoming Andrew Morton 2020-06-04 23:45 incoming Andrew Morton 2020-06-03 22:55 incoming Andrew Morton 2020-06-02 20:09 incoming Andrew Morton 2020-06-02 4:44 incoming Andrew Morton 2020-06-02 20:08 ` incoming Andrew Morton 2020-06-02 20:45 ` incoming Linus Torvalds 2020-06-02 21:38 ` incoming Andrew Morton 2020-06-02 22:18 ` incoming Linus Torvalds 2020-05-28 5:20 incoming Andrew Morton 2020-05-28 20:10 ` incoming Linus Torvalds 2020-05-29 20:31 ` incoming Andrew Morton 2020-05-29 20:38 ` incoming Linus Torvalds 2020-05-29 21:12 ` incoming Andrew Morton 2020-05-29 21:20 ` incoming Linus Torvalds 2020-05-23 5:22 incoming Andrew Morton 2020-05-14 0:50 incoming Andrew Morton 2020-05-08 1:35 incoming Andrew Morton 2020-04-21 1:13 incoming Andrew Morton 2020-04-12 7:41 incoming Andrew Morton 2020-04-10 21:30 incoming Andrew Morton 2020-04-07 3:02 incoming Andrew Morton 2020-04-02 4:01 incoming Andrew Morton 2020-03-29 2:14 incoming Andrew Morton 2020-03-22 1:19 incoming Andrew Morton 2020-03-06 6:27 incoming Andrew Morton 2020-02-21 4:00 incoming Andrew Morton 2020-02-21 4:03 ` incoming Andrew Morton 2020-02-21 18:21 ` incoming Linus Torvalds 2020-02-21 18:32 ` incoming Konstantin Ryabitsev 2020-02-27 9:59 ` incoming Vlastimil Babka 2020-02-21 19:33 ` incoming Linus Torvalds 2020-02-04 1:33 incoming Andrew Morton 2020-02-04 2:27 ` incoming Linus Torvalds 2020-02-04 2:46 ` incoming Andrew Morton 2020-02-04 3:11 ` incoming Linus Torvalds 2020-01-31 6:10 incoming Andrew Morton 2020-01-14 0:28 incoming Andrew Morton 2020-01-04 20:55 incoming Andrew Morton 2019-12-18 4:50 incoming Andrew Morton 2019-12-05 0:48 incoming Andrew Morton 2019-12-01 1:47 incoming Andrew Morton 2019-12-01 5:17 ` incoming James Bottomley 2019-12-01 21:07 ` incoming Linus Torvalds 2019-12-02 8:21 ` incoming Steven Price 2019-11-22 1:53 incoming Andrew Morton 2019-11-16 1:34 incoming Andrew Morton 2019-11-06 5:16 incoming Andrew Morton 2019-10-19 3:19 incoming Andrew Morton 2019-10-14 21:11 incoming Andrew Morton 2019-10-07 0:57 incoming Andrew Morton 2019-09-25 23:45 incoming Andrew Morton 2019-09-23 22:31 incoming Andrew Morton 2019-09-24 0:55 ` incoming Linus Torvalds 2019-09-24 4:31 ` incoming Andrew Morton 2019-09-24 7:48 ` incoming Michal Hocko 2019-09-24 15:34 ` incoming Linus Torvalds 2019-09-25 6:36 ` incoming Michal Hocko 2019-09-24 19:55 ` incoming Vlastimil Babka 2019-08-30 23:04 incoming Andrew Morton 2019-08-25 0:54 incoming Andrew Morton [not found] <20190716162536.bb52b8f34a8ecf5331a86a42@linux-foundation.org> 2019-07-17 8:47 ` incoming Vlastimil Babka 2019-07-17 8:57 ` incoming Bhaskar Chowdhury 2019-07-17 16:13 ` incoming Linus Torvalds 2019-07-17 17:09 ` incoming Christian Brauner 2019-07-17 18:13 ` incoming Vlastimil Babka 2007-05-02 22:02 incoming Andrew Morton 2007-05-02 22:31 ` incoming Benjamin Herrenschmidt 2007-05-03 7:55 ` incoming Russell King 2007-05-03 8:05 ` incoming Andrew Morton 2007-05-04 13:37 ` incoming Greg KH 2007-05-04 16:14 ` incoming Andrew Morton 2007-05-04 17:02 ` incoming Greg KH 2007-05-04 18:57 ` incoming Roland McGrath 2007-05-04 19:24 ` incoming Greg KH 2007-05-04 19:29 ` incoming Roland McGrath
This is a public inbox, see mirroring instructions for how to clone and mirror all data and code used for this inbox; as well as URLs for NNTP newsgroup(s).