incoming

incoming

[Andrew Morton]

15 fixes, based on ae83d0b416db002fe95601e7f97f64b59514d936:


    Masahiro Yamada <masahiroy@kernel.org>:
      sh: fix build error in mm/init.c

    Kees Cook <keescook@chromium.org>:
      slub: avoid redzone when choosing freepointer location

    Peter Xu <peterx@redhat.com>:
      mm/userfaultfd: disable userfaultfd-wp on x86_32

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
      MAINTAINERS: add an entry for kfifo

    Longpeng <longpeng2@huawei.com>:
      mm/hugetlb: fix a addressing exception caused by huge_pte_offset

    Michal Hocko <mhocko@suse.com>:
      mm, gup: return EINTR when gup is interrupted by fatal signals

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      checkpatch: fix a typo in the regex for $allocFunctions

    George Burgess IV <gbiv@google.com>:
      tools/build: tweak unused value workaround

    Muchun Song <songmuchun@bytedance.com>:
      mm/ksm: fix NULL pointer dereference when KSM zero page is enabled

    Hugh Dickins <hughd@google.com>:
      mm/shmem: fix build without THP

    Jann Horn <jannh@google.com>:
      vmalloc: fix remap_vmalloc_range() bounds checks

    Hugh Dickins <hughd@google.com>:
      shmem: fix possible deadlocks on shmlock_user_lock

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path

    Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
      coredump: fix null pointer dereference on coredump

    Lucas Stach <l.stach@pengutronix.de>:
      tools/vm: fix cross-compile build

 MAINTAINERS                                      |    7 +++++++
 arch/sh/mm/init.c                                |    2 +-
 arch/x86/Kconfig                                 |    2 +-
 fs/coredump.c                                    |    2 ++
 fs/proc/vmcore.c                                 |    5 +++--
 include/linux/vmalloc.h                          |    2 +-
 mm/gup.c                                         |    2 +-
 mm/hugetlb.c                                     |   14 ++++++++------
 mm/ksm.c                                         |   12 ++++++++++--
 mm/shmem.c                                       |   13 ++++++++-----
 mm/slub.c                                        |   12 ++++++++++--
 mm/vmalloc.c                                     |   16 +++++++++++++---
 samples/vfio-mdev/mdpy.c                         |    2 +-
 scripts/checkpatch.pl                            |    2 +-
 tools/build/feature/test-sync-compare-and-swap.c |    2 +-
 tools/vm/Makefile                                |    2 ++
 16 files changed, 70 insertions(+), 27 deletions(-)

[patch 01/15] sh: fix build error in mm/init.c

[Andrew Morton]

From: Masahiro Yamada <masahiroy@kernel.org>
Subject: sh: fix build error in mm/init.c

The closing parenthesis is missing.

Link: http://lkml.kernel.org/r/20200413014743.16353-1-masahiroy@kernel.org
Fixes: bfeb022f8fe4 ("mm/memory_hotplug: add pgprot_t to mhp_params")
Signed-off-by: Masahiro Yamada <masahiroy@kernel.org>
Reviewed-by: Geert Uytterhoeven <geert+renesas@glider.be>
Reviewed-by: Logan Gunthorpe <logang@deltatee.com>
Cc: Stephen Rothwell <sfr@canb.auug.org.au>
Cc: Guenter Roeck <linux@roeck-us.net>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/sh/mm/init.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/arch/sh/mm/init.c~sh-fix-build-error-in-mm-initc
+++ a/arch/sh/mm/init.c
@@ -412,7 +412,7 @@ int arch_add_memory(int nid, u64 start,
 	unsigned long nr_pages = size >> PAGE_SHIFT;
 	int ret;
 
-	if (WARN_ON_ONCE(params->pgprot.pgprot != PAGE_KERNEL.pgprot)
+	if (WARN_ON_ONCE(params->pgprot.pgprot != PAGE_KERNEL.pgprot))
 		return -EINVAL;
 
 	/* We only have ZONE_NORMAL, so this is easy.. */
_

[patch 02/15] slub: avoid redzone when choosing freepointer location

[Andrew Morton]

From: Kees Cook <keescook@chromium.org>
Subject: slub: avoid redzone when choosing freepointer location

Marco Elver reported system crashes when booting with "slub_debug=Z".  The
freepointer location (s->offset) was not taking into account that the
"inuse" size that includes the redzone area should not be used by the
freelist pointer.  Change the calculation to save the area of the object
that an inline freepointer may be written into.

Link: http://lkml.kernel.org/r/202004151054.BD695840@keescook
Link: https://lore.kernel.org/linux-mm/20200415164726.GA234932@google.com
Fixes: 3202fa62fb43 ("slub: relocate freelist pointer to middle of object")
Signed-off-by: Kees Cook <keescook@chromium.org>
Reported-by: Marco Elver <elver@google.com>
Tested-by: Marco Elver <elver@google.com>
Cc: Christoph Lameter <cl@linux.com>
Cc: Pekka Enberg <penberg@kernel.org>
Cc: David Rientjes <rientjes@google.com>
Cc: Joonsoo Kim <iamjoonsoo.kim@lge.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/slub.c |   12 ++++++++++--
 1 file changed, 10 insertions(+), 2 deletions(-)

--- a/mm/slub.c~slub-avoid-redzone-when-choosing-freepointer-location
+++ a/mm/slub.c
@@ -3533,6 +3533,7 @@ static int calculate_sizes(struct kmem_c
 {
 	slab_flags_t flags = s->flags;
 	unsigned int size = s->object_size;
+	unsigned int freepointer_area;
 	unsigned int order;
 
 	/*
@@ -3541,6 +3542,13 @@ static int calculate_sizes(struct kmem_c
 	 * the possible location of the free pointer.
 	 */
 	size = ALIGN(size, sizeof(void *));
+	/*
+	 * This is the area of the object where a freepointer can be
+	 * safely written. If redzoning adds more to the inuse size, we
+	 * can't use that portion for writing the freepointer, so
+	 * s->offset must be limited within this for the general case.
+	 */
+	freepointer_area = size;
 
 #ifdef CONFIG_SLUB_DEBUG
 	/*
@@ -3582,13 +3590,13 @@ static int calculate_sizes(struct kmem_c
 		 */
 		s->offset = size;
 		size += sizeof(void *);
-	} else if (size > sizeof(void *)) {
+	} else if (freepointer_area > sizeof(void *)) {
 		/*
 		 * Store freelist pointer near middle of object to keep
 		 * it away from the edges of the object to avoid small
 		 * sized over/underflows from neighboring allocations.
 		 */
-		s->offset = ALIGN(size / 2, sizeof(void *));
+		s->offset = ALIGN(freepointer_area / 2, sizeof(void *));
 	}
 
 #ifdef CONFIG_SLUB_DEBUG
_

[patch 03/15] mm/userfaultfd: disable userfaultfd-wp on x86_32

[Andrew Morton]

From: Peter Xu <peterx@redhat.com>
Subject: mm/userfaultfd: disable userfaultfd-wp on x86_32

Userfaultfd-wp is not yet working on 32bit hosts, but it's accidentally
enabled previously.  Disable it.

Link: http://lkml.kernel.org/r/20200413141608.109211-1-peterx@redhat.com
Fixes: 5a281062af1d ("userfaultfd: wp: add WP pagetable tracking to x86")
Signed-off-by: Peter Xu <peterx@redhat.com>
Reported-by: Naresh Kamboju <naresh.kamboju@linaro.org>
Reported-by: kernel test robot <lkp@intel.com>
Tested-by: Naresh Kamboju <naresh.kamboju@linaro.org>
Reviewed-by: Andrea Arcangeli <aarcange@redhat.com>
Cc: Hillf Danton <hdanton@sina.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/x86/Kconfig |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/arch/x86/Kconfig~mm-userfaultfd-disable-userfaultfd-wp-on-x86_32
+++ a/arch/x86/Kconfig
@@ -149,7 +149,7 @@ config X86
 	select HAVE_ARCH_TRACEHOOK
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE_PUD if X86_64
-	select HAVE_ARCH_USERFAULTFD_WP		if USERFAULTFD
+	select HAVE_ARCH_USERFAULTFD_WP         if X86_64 && USERFAULTFD
 	select HAVE_ARCH_VMAP_STACK		if X86_64
 	select HAVE_ARCH_WITHIN_STACK_FRAMES
 	select HAVE_ASM_MODVERSIONS
_

[patch 04/15] MAINTAINERS: add an entry for kfifo

[Andrew Morton]

From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Subject: MAINTAINERS: add an entry for kfifo

Kfifo has been written by Stefani Seibold and she's implicitly expected to
Ack any changes to it.  She's not however officially listed as kfifo
maintainer which leads to delays in patch review.  This patch proposes to
add an explitic entry for kfifo to MAINTAINERS file.

[akpm@linux-foundation.org: alphasort F: entries, per Joe]
[akpm@linux-foundation.org: remove colon, per Bartosz]
Link: http://lkml.kernel.org/r/20200124174533.21815-1-brgl@bgdev.pl
Link: http://lkml.kernel.org/r/20200413104250.26683-1-brgl@bgdev.pl
Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>
Acked by Stefani Seibold <stefani@seibold.net>
Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
Cc: Linus Walleij <linus.walleij@linaro.org>
Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
Cc: Joe Perches <joe@perches.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 MAINTAINERS |    7 +++++++
 1 file changed, 7 insertions(+)

--- a/MAINTAINERS~maintainers-add-an-entry-for-kfifo
+++ a/MAINTAINERS
@@ -9416,6 +9416,13 @@ F:	include/linux/keyctl.h
 F:	include/uapi/linux/keyctl.h
 F:	security/keys/
 
+KFIFO
+M:	Stefani Seibold <stefani@seibold.net>
+S:	Maintained
+F:	include/linux/kfifo.h
+F:	lib/kfifo.c
+F:	samples/kfifo/
+
 KGDB / KDB /debug_core
 M:	Jason Wessel <jason.wessel@windriver.com>
 M:	Daniel Thompson <daniel.thompson@linaro.org>
_

[patch 05/15] mm/hugetlb: fix a addressing exception caused by huge_pte_offset

[Andrew Morton]

From: Longpeng <longpeng2@huawei.com>
Subject: mm/hugetlb: fix a addressing exception caused by huge_pte_offset

Our machine encountered a panic(addressing exception) after run for a long
time and the calltrace is:

RIP: 0010:[<ffffffff9dff0587>]  [<ffffffff9dff0587>] hugetlb_fault+0x307/0xbe0
RSP: 0018:ffff9567fc27f808  EFLAGS: 00010286
RAX: e800c03ff1258d48 RBX: ffffd3bb003b69c0 RCX: e800c03ff1258d48
RDX: 17ff3fc00eda72b7 RSI: 00003ffffffff000 RDI: e800c03ff1258d48
RBP: ffff9567fc27f8c8 R08: e800c03ff1258d48 R09: 0000000000000080
R10: ffffaba0704c22a8 R11: 0000000000000001 R12: ffff95c87b4b60d8
R13: 00005fff00000000 R14: 0000000000000000 R15: ffff9567face8074
FS:  00007fe2d9ffb700(0000) GS:ffff956900e40000(0000) knlGS:0000000000000000
CS:  0010 DS: 0000 ES: 0000 CR0: 0000000080050033
CR2: ffffd3bb003b69c0 CR3: 000000be67374000 CR4: 00000000003627e0
DR0: 0000000000000000 DR1: 0000000000000000 DR2: 0000000000000000
DR3: 0000000000000000 DR6: 00000000fffe0ff0 DR7: 0000000000000400
Call Trace:
 [<ffffffff9df9b71b>] ? unlock_page+0x2b/0x30
 [<ffffffff9dff04a2>] ? hugetlb_fault+0x222/0xbe0
 [<ffffffff9dff1405>] follow_hugetlb_page+0x175/0x540
 [<ffffffff9e15b825>] ? cpumask_next_and+0x35/0x50
 [<ffffffff9dfc7230>] __get_user_pages+0x2a0/0x7e0
 [<ffffffff9dfc648d>] __get_user_pages_unlocked+0x15d/0x210
 [<ffffffffc068cfc5>] __gfn_to_pfn_memslot+0x3c5/0x460 [kvm]
 [<ffffffffc06b28be>] try_async_pf+0x6e/0x2a0 [kvm]
 [<ffffffffc06b4b41>] tdp_page_fault+0x151/0x2d0 [kvm]
 ...
 [<ffffffffc06a6f90>] kvm_arch_vcpu_ioctl_run+0x330/0x490 [kvm]
 [<ffffffffc068d919>] kvm_vcpu_ioctl+0x309/0x6d0 [kvm]
 [<ffffffff9deaa8c2>] ? dequeue_signal+0x32/0x180
 [<ffffffff9deae34d>] ? do_sigtimedwait+0xcd/0x230
 [<ffffffff9e03aed0>] do_vfs_ioctl+0x3f0/0x540
 [<ffffffff9e03b0c1>] SyS_ioctl+0xa1/0xc0
 [<ffffffff9e53879b>] system_call_fastpath+0x22/0x27

For 1G hugepages, huge_pte_offset() wants to return NULL or pudp, but it
may return a wrong 'pmdp' if there is a race.  Please look at the
following code snippet:

    ...
    pud = pud_offset(p4d, addr);
    if (sz != PUD_SIZE && pud_none(*pud))
        return NULL;
    /* hugepage or swap? */
    if (pud_huge(*pud) || !pud_present(*pud))
        return (pte_t *)pud;

    pmd = pmd_offset(pud, addr);
    if (sz != PMD_SIZE && pmd_none(*pmd))
        return NULL;
    /* hugepage or swap? */
    if (pmd_huge(*pmd) || !pmd_present(*pmd))
        return (pte_t *)pmd;
    ...

The following sequence would trigger this bug:
1. CPU0: sz = PUD_SIZE and *pud = 0 , continue
1. CPU0: "pud_huge(*pud)" is false
2. CPU1: calling hugetlb_no_page and set *pud to xxxx8e7(PRESENT)
3. CPU0: "!pud_present(*pud)" is false, continue
4. CPU0: pmd = pmd_offset(pud, addr) and maybe return a wrong pmdp
However, we want CPU0 to return NULL or pudp in this case.

We must make sure there is exactly one dereference of pud and pmd.

Link: http://lkml.kernel.org/r/20200413010342.771-1-longpeng2@huawei.com
Signed-off-by: Longpeng <longpeng2@huawei.com>
Reviewed-by: Mike Kravetz <mike.kravetz@oracle.com>
Reviewed-by: Jason Gunthorpe <jgg@mellanox.com>
Cc: Matthew Wilcox <willy@infradead.org>
Cc: Sean Christopherson <sean.j.christopherson@intel.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/hugetlb.c |   14 ++++++++------
 1 file changed, 8 insertions(+), 6 deletions(-)

--- a/mm/hugetlb.c~mm-hugetlb-fix-a-addressing-exception-caused-by-huge_pte_offset
+++ a/mm/hugetlb.c
@@ -5365,8 +5365,8 @@ pte_t *huge_pte_offset(struct mm_struct
 {
 	pgd_t *pgd;
 	p4d_t *p4d;
-	pud_t *pud;
-	pmd_t *pmd;
+	pud_t *pud, pud_entry;
+	pmd_t *pmd, pmd_entry;
 
 	pgd = pgd_offset(mm, addr);
 	if (!pgd_present(*pgd))
@@ -5376,17 +5376,19 @@ pte_t *huge_pte_offset(struct mm_struct
 		return NULL;
 
 	pud = pud_offset(p4d, addr);
-	if (sz != PUD_SIZE && pud_none(*pud))
+	pud_entry = READ_ONCE(*pud);
+	if (sz != PUD_SIZE && pud_none(pud_entry))
 		return NULL;
 	/* hugepage or swap? */
-	if (pud_huge(*pud) || !pud_present(*pud))
+	if (pud_huge(pud_entry) || !pud_present(pud_entry))
 		return (pte_t *)pud;
 
 	pmd = pmd_offset(pud, addr);
-	if (sz != PMD_SIZE && pmd_none(*pmd))
+	pmd_entry = READ_ONCE(*pmd);
+	if (sz != PMD_SIZE && pmd_none(pmd_entry))
 		return NULL;
 	/* hugepage or swap? */
-	if (pmd_huge(*pmd) || !pmd_present(*pmd))
+	if (pmd_huge(pmd_entry) || !pmd_present(pmd_entry))
 		return (pte_t *)pmd;
 
 	return NULL;
_

[patch 06/15] mm, gup: return EINTR when gup is interrupted by fatal signals

[Andrew Morton]

From: Michal Hocko <mhocko@suse.com>
Subject: mm, gup: return EINTR when gup is interrupted by fatal signals

EINTR is the usual error code which other killable interfaces return. 
This is the case for the other fatal_signal_pending break out from the
same function.  Make the code consistent.

ERESTARTSYS is also quite confusing because the signal is fatal and so no
restart will happen before returning to the userspace.

Link: http://lkml.kernel.org/r/20200409071133.31734-1-mhocko@kernel.org
Signed-off-by: Michal Hocko <mhocko@suse.com>
Acked-by: Linus Torvalds <torvalds@linux-foundation.org>
Cc: Peter Xu <peterx@redhat.com>
Cc: Hillf Danton <hdanton@sina.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/gup.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/gup.c~mm-gup-return-eintr-when-gup-is-interrupted-by-fatal-signals
+++ a/mm/gup.c
@@ -1088,7 +1088,7 @@ retry:
 		 * potentially allocating memory.
 		 */
 		if (fatal_signal_pending(current)) {
-			ret = -ERESTARTSYS;
+			ret = -EINTR;
 			goto out;
 		}
 		cond_resched();
_

[patch 07/15] checkpatch: fix a typo in the regex for $allocFunctions

[Andrew Morton]

From: Christophe JAILLET <christophe.jaillet@wanadoo.fr>
Subject: checkpatch: fix a typo in the regex for $allocFunctions

Here, we look for function such as 'netdev_alloc_skb_ip_align', so a '_'
is missing in the regex.

To make sure:
   grep -r --include=*.c skbip_a * | wc   ==>   0 results
   grep -r --include=*.c skb_ip_a * | wc  ==> 112 results

Link: http://lkml.kernel.org/r/20200407190029.892-1-christophe.jaillet@wanadoo.fr
Signed-off-by: Christophe JAILLET <christophe.jaillet@wanadoo.fr>
Acked-by: Joe Perches <joe@perches.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 scripts/checkpatch.pl |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/scripts/checkpatch.pl~checkpatch-fix-a-typo-in-the-regex-for-allocfunctions
+++ a/scripts/checkpatch.pl
@@ -479,7 +479,7 @@ our $allocFunctions = qr{(?x:
 		(?:kv|k|v)[czm]alloc(?:_node|_array)? |
 		kstrdup(?:_const)? |
 		kmemdup(?:_nul)?) |
-	(?:\w+)?alloc_skb(?:ip_align)? |
+	(?:\w+)?alloc_skb(?:_ip_align)? |
 				# dev_alloc_skb/netdev_alloc_skb, et al
 	dma_alloc_coherent
 )};
_

[patch 08/15] tools/build: tweak unused value workaround

[Andrew Morton]

From: George Burgess IV <gbiv@google.com>
Subject: tools/build: tweak unused value workaround

Clang has -Wself-assign enabled by default under -Wall, which always gets
-Werror'ed on this file, causing sync-compare-and-swap to be disabled by
default.  The generally-accepted way to spell "this value is intentionally
unused," is casting it to `void`.  This is accepted by both GCC and Clang
with -Wall enabled: https://godbolt.org/z/qqZ9r3

Link: http://lkml.kernel.org/r/20200414195638.156123-1-gbiv@google.com
Signed-off-by: George Burgess IV <gbiv@google.com>
Cc: Nick Desaulniers <ndesaulniers@google.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 tools/build/feature/test-sync-compare-and-swap.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/tools/build/feature/test-sync-compare-and-swap.c~tools-build-tweak-unused-value-workaround
+++ a/tools/build/feature/test-sync-compare-and-swap.c
@@ -7,7 +7,7 @@ int main(int argc, char *argv[])
 {
 	uint64_t old, new = argc;
 
-	argv = argv;
+	(void)argv;
 	do {
 		old = __sync_val_compare_and_swap(&x, 0, 0);
 	} while (!__sync_bool_compare_and_swap(&x, old, new));
_

[patch 09/15] mm/ksm: fix NULL pointer dereference when KSM zero page is enabled

[Andrew Morton]

From: Muchun Song <songmuchun@bytedance.com>
Subject: mm/ksm: fix NULL pointer dereference when KSM zero page is enabled

find_mergeable_vma() can return NULL.  In this case, it leads to a crash
when we access vm_mm(its offset is 0x40) later in write_protect_page.  And
this case did happen on our server.  The following call trace is captured
in kernel 4.19 with the following patch applied and KSM zero page enabled
on our server.

  commit e86c59b1b12d ("mm/ksm: improve deduplication of zero pages with colouring")

So add a vma check to fix it.

--------------------------------------------------------------------------
  BUG: unable to handle kernel NULL pointer dereference at 0000000000000040
  Oops: 0000 [#1] SMP NOPTI
  CPU: 9 PID: 510 Comm: ksmd Kdump: loaded Tainted: G OE 4.19.36.bsk.9-amd64 #4.19.36.bsk.9
  RIP: 0010:try_to_merge_one_page+0xc7/0x760
  Code: 24 58 65 48 33 34 25 28 00 00 00 89 e8 0f 85 a3 06 00 00 48 83 c4
        60 5b 5d 41 5c 41 5d 41 5e 41 5f c3 48 8b 46 08 a8 01 75 b8 <49>
        8b 44 24 40 4c 8d 7c 24 20 b9 07 00 00 00 4c 89 e6 4c 89 ff 48
  RSP: 0018:ffffadbdd9fffdb0 EFLAGS: 00010246
  RAX: ffffda83ffd4be08 RBX: ffffda83ffd4be40 RCX: 0000002c6e800000
  RDX: 0000000000000000 RSI: ffffda83ffd4be40 RDI: 0000000000000000
  RBP: ffffa11939f02ec0 R08: 0000000094e1a447 R09: 00000000abe76577
  R10: 0000000000000962 R11: 0000000000004e6a R12: 0000000000000000
  R13: ffffda83b1e06380 R14: ffffa18f31f072c0 R15: ffffda83ffd4be40
  FS: 0000000000000000(0000) GS:ffffa0da43b80000(0000) knlGS:0000000000000000
  CS: 0010 DS: 0000 ES: 0000 CR0: 0000000080050033
  CR2: 0000000000000040 CR3: 0000002c77c0a003 CR4: 00000000007626e0
  DR0: 0000000000000000 DR1: 0000000000000000 DR2: 0000000000000000
  DR3: 0000000000000000 DR6: 00000000fffe0ff0 DR7: 0000000000000400
  PKRU: 55555554
  Call Trace:
    ? follow_page_pte+0x36d/0x5e0
    ksm_scan_thread+0x115e/0x1960
    ? remove_wait_queue+0x60/0x60
    kthread+0xf5/0x130
    ? try_to_merge_with_ksm_page+0x90/0x90
    ? kthread_create_worker_on_cpu+0x70/0x70
    ret_from_fork+0x1f/0x30
--------------------------------------------------------------------------

[songmuchun@bytedance.com: if the vma is out of date, just exit]
  Link: http://lkml.kernel.org/r/20200416025034.29780-1-songmuchun@bytedance.com
[akpm@linux-foundation.org: add the conventional braces, replace /** with /*]
Link: http://lkml.kernel.org/r/20200416025034.29780-1-songmuchun@bytedance.com
Link: http://lkml.kernel.org/r/20200414132905.83819-1-songmuchun@bytedance.com
Fixes: e86c59b1b12d ("mm/ksm: improve deduplication of zero pages with colouring")
Signed-off-by: Muchun Song <songmuchun@bytedance.com>
Co-developed-by: Xiongchun Duan <duanxiongchun@bytedance.com>
Reviewed-by: David Hildenbrand <david@redhat.com>
Reviewed-by: Kirill Tkhai <ktkhai@virtuozzo.com>
Cc: Hugh Dickins <hughd@google.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Cc: Claudio Imbrenda <imbrenda@linux.vnet.ibm.com>
Cc: Markus Elfring <Markus.Elfring@web.de>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/ksm.c |   12 ++++++++++--
 1 file changed, 10 insertions(+), 2 deletions(-)

--- a/mm/ksm.c~mm-ksm-fix-null-pointer-dereference-when-ksm-zero-page-is-enabled
+++ a/mm/ksm.c
@@ -2112,8 +2112,16 @@ static void cmp_and_merge_page(struct pa
 
 		down_read(&mm->mmap_sem);
 		vma = find_mergeable_vma(mm, rmap_item->address);
-		err = try_to_merge_one_page(vma, page,
-					    ZERO_PAGE(rmap_item->address));
+		if (vma) {
+			err = try_to_merge_one_page(vma, page,
+					ZERO_PAGE(rmap_item->address));
+		} else {
+			/*
+			 * If the vma is out of date, we do not need to
+			 * continue.
+			 */
+			err = 0;
+		}
 		up_read(&mm->mmap_sem);
 		/*
 		 * In case of failure, the page was not really empty, so we
_

[patch 10/15] mm/shmem: fix build without THP

[Andrew Morton]

From: Hugh Dickins <hughd@google.com>
Subject: mm/shmem: fix build without THP

Some optimizers don't notice that shmem_punch_compound() is always true
(PageTransCompound() being false) without CONFIG_TRANSPARENT_HUGEPAGE==y:
use IS_ENABLED to help them to avoid the BUILD_BUG inside HPAGE_PMD_NR.

Link: http://lkml.kernel.org/r/alpine.LSU.2.11.2004142339170.10035@eggly.anvils
Fixes: 71725ed10c40 ("mm: huge tmpfs: try to split_huge_page() when punching hole")
Signed-off-by: Hugh Dickins <hughd@google.com>
Reported-by: Randy Dunlap <rdunlap@infradead.org>
Tested-by: Randy Dunlap <rdunlap@infradead.org>
Acked-by: Randy Dunlap <rdunlap@infradead.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/shmem.c |    2 +-
 1 file changed, 1 insertion(+), 1 deletion(-)

--- a/mm/shmem.c~mm-shmem-fix-build-without-thp
+++ a/mm/shmem.c
@@ -952,7 +952,7 @@ static void shmem_undo_range(struct inod
 				VM_BUG_ON_PAGE(PageWriteback(page), page);
 				if (shmem_punch_compound(page, start, end))
 					truncate_inode_page(mapping, page);
-				else {
+				else if (IS_ENABLED(CONFIG_TRANSPARENT_HUGEPAGE)) {
 					/* Wipe the page and don't get stuck */
 					clear_highpage(page);
 					flush_dcache_page(page);
_

[patch 11/15] vmalloc: fix remap_vmalloc_range() bounds checks

[Andrew Morton]

From: Jann Horn <jannh@google.com>
Subject: vmalloc: fix remap_vmalloc_range() bounds checks

remap_vmalloc_range() has had various issues with the bounds checks it
promises to perform ("This function checks that addr is a valid vmalloc'ed
area, and that it is big enough to cover the vma") over time, e.g.:

 - not detecting pgoff<<PAGE_SHIFT overflow
 - not detecting (pgoff<<PAGE_SHIFT)+usize overflow
 - not checking whether addr and addr+(pgoff<<PAGE_SHIFT) are the same
   vmalloc allocation
 - comparing a potentially wildly out-of-bounds pointer with the end of the
   vmalloc region

In particular, since commit fc9702273e2e ("bpf: Add mmap() support for
BPF_MAP_TYPE_ARRAY"), unprivileged users can cause kernel null pointer
dereferences by calling mmap() on a BPF map with a size that is bigger
than the distance from the start of the BPF map to the end of the address
space.  This could theoretically be used as a kernel ASLR bypass, by using
whether mmap() with a given offset oopses or returns an error code to
perform a binary search over the possible address range.

To allow remap_vmalloc_range_partial() to verify that addr and
addr+(pgoff<<PAGE_SHIFT) are in the same vmalloc region, pass the offset
to remap_vmalloc_range_partial() instead of adding it to the pointer in
remap_vmalloc_range().

In remap_vmalloc_range_partial(), fix the check against get_vm_area_size()
by using size comparisons instead of pointer comparisons, and add checks
for pgoff.

Link: http://lkml.kernel.org/r/20200415222312.236431-1-jannh@google.com
Cc: stable@vger.kernel.org
Fixes: 833423143c3a ("[PATCH] mm: introduce remap_vmalloc_range()")
Signed-off-by: Jann Horn <jannh@google.com>
Cc: Alexei Starovoitov <ast@kernel.org>
Cc: Daniel Borkmann <daniel@iogearbox.net>
Cc: Martin KaFai Lau <kafai@fb.com>
Cc: Song Liu <songliubraving@fb.com>
Cc: Yonghong Song <yhs@fb.com>
Cc: Andrii Nakryiko <andriin@fb.com>
Cc: John Fastabend <john.fastabend@gmail.com>
Cc: KP Singh <kpsingh@chromium.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/proc/vmcore.c         |    5 +++--
 include/linux/vmalloc.h  |    2 +-
 mm/vmalloc.c             |   16 +++++++++++++---
 samples/vfio-mdev/mdpy.c |    2 +-
 4 files changed, 18 insertions(+), 7 deletions(-)

--- a/fs/proc/vmcore.c~vmalloc-fix-remap_vmalloc_range-bounds-checks
+++ a/fs/proc/vmcore.c
@@ -266,7 +266,8 @@ static int vmcoredd_mmap_dumps(struct vm
 		if (start < offset + dump->size) {
 			tsz = min(offset + (u64)dump->size - start, (u64)size);
 			buf = dump->buf + start - offset;
-			if (remap_vmalloc_range_partial(vma, dst, buf, tsz)) {
+			if (remap_vmalloc_range_partial(vma, dst, buf, 0,
+							tsz)) {
 				ret = -EFAULT;
 				goto out_unlock;
 			}
@@ -624,7 +625,7 @@ static int mmap_vmcore(struct file *file
 		tsz = min(elfcorebuf_sz + elfnotes_sz - (size_t)start, size);
 		kaddr = elfnotes_buf + start - elfcorebuf_sz - vmcoredd_orig_sz;
 		if (remap_vmalloc_range_partial(vma, vma->vm_start + len,
-						kaddr, tsz))
+						kaddr, 0, tsz))
 			goto fail;
 
 		size -= tsz;
--- a/include/linux/vmalloc.h~vmalloc-fix-remap_vmalloc_range-bounds-checks
+++ a/include/linux/vmalloc.h
@@ -137,7 +137,7 @@ extern void vunmap(const void *addr);
 
 extern int remap_vmalloc_range_partial(struct vm_area_struct *vma,
 				       unsigned long uaddr, void *kaddr,
-				       unsigned long size);
+				       unsigned long pgoff, unsigned long size);
 
 extern int remap_vmalloc_range(struct vm_area_struct *vma, void *addr,
 							unsigned long pgoff);
--- a/mm/vmalloc.c~vmalloc-fix-remap_vmalloc_range-bounds-checks
+++ a/mm/vmalloc.c
@@ -34,6 +34,7 @@
 #include <linux/llist.h>
 #include <linux/bitops.h>
 #include <linux/rbtree_augmented.h>
+#include <linux/overflow.h>
 
 #include <linux/uaccess.h>
 #include <asm/tlbflush.h>
@@ -3054,6 +3055,7 @@ finished:
  * @vma:		vma to cover
  * @uaddr:		target user address to start at
  * @kaddr:		virtual address of vmalloc kernel memory
+ * @pgoff:		offset from @kaddr to start at
  * @size:		size of map area
  *
  * Returns:	0 for success, -Exxx on failure
@@ -3066,9 +3068,15 @@ finished:
  * Similar to remap_pfn_range() (see mm/memory.c)
  */
 int remap_vmalloc_range_partial(struct vm_area_struct *vma, unsigned long uaddr,
-				void *kaddr, unsigned long size)
+				void *kaddr, unsigned long pgoff,
+				unsigned long size)
 {
 	struct vm_struct *area;
+	unsigned long off;
+	unsigned long end_index;
+
+	if (check_shl_overflow(pgoff, PAGE_SHIFT, &off))
+		return -EINVAL;
 
 	size = PAGE_ALIGN(size);
 
@@ -3082,8 +3090,10 @@ int remap_vmalloc_range_partial(struct v
 	if (!(area->flags & (VM_USERMAP | VM_DMA_COHERENT)))
 		return -EINVAL;
 
-	if (kaddr + size > area->addr + get_vm_area_size(area))
+	if (check_add_overflow(size, off, &end_index) ||
+	    end_index > get_vm_area_size(area))
 		return -EINVAL;
+	kaddr += off;
 
 	do {
 		struct page *page = vmalloc_to_page(kaddr);
@@ -3122,7 +3132,7 @@ int remap_vmalloc_range(struct vm_area_s
 						unsigned long pgoff)
 {
 	return remap_vmalloc_range_partial(vma, vma->vm_start,
-					   addr + (pgoff << PAGE_SHIFT),
+					   addr, pgoff,
 					   vma->vm_end - vma->vm_start);
 }
 EXPORT_SYMBOL(remap_vmalloc_range);
--- a/samples/vfio-mdev/mdpy.c~vmalloc-fix-remap_vmalloc_range-bounds-checks
+++ a/samples/vfio-mdev/mdpy.c
@@ -418,7 +418,7 @@ static int mdpy_mmap(struct mdev_device
 		return -EINVAL;
 
 	return remap_vmalloc_range_partial(vma, vma->vm_start,
-					   mdev_state->memblk,
+					   mdev_state->memblk, 0,
 					   vma->vm_end - vma->vm_start);
 }
 
_

[patch 12/15] shmem: fix possible deadlocks on shmlock_user_lock

[Andrew Morton]

From: Hugh Dickins <hughd@google.com>
Subject: shmem: fix possible deadlocks on shmlock_user_lock

Recent commit 71725ed10c40 ("mm: huge tmpfs: try to split_huge_page() when
punching hole") has allowed syzkaller to probe deeper, uncovering a
long-standing lockdep issue between the irq-unsafe shmlock_user_lock, the
irq-safe xa_lock on mapping->i_pages, and shmem inode's info->lock which
nests inside xa_lock (or tree_lock) since 4.8's shmem_uncharge().

user_shm_lock(), servicing SysV shmctl(SHM_LOCK), wants shmlock_user_lock
while its caller shmem_lock() holds info->lock with interrupts disabled;
but hugetlbfs_file_setup() calls user_shm_lock() with interrupts enabled,
and might be interrupted by a writeback endio wanting xa_lock on i_pages. 
This may not risk an actual deadlock, since shmem inodes do not take part
in writeback accounting, but there are several easy ways to avoid it.

Requiring interrupts disabled for shmlock_user_lock would be easy, but
it's a high-level global lock for which that seems inappropriate. 
Instead, recall that the use of info->lock to guard info->flags in
shmem_lock() dates from pre-3.1 days, when races with SHMEM_PAGEIN and
SHMEM_TRUNCATE could occur: nowadays it serves no purpose, the only flag
added or removed is VM_LOCKED itself, and calls to shmem_lock() an inode
are already serialized by the caller.  Take info->lock out of the chain
and the possibility of deadlock or lockdep warning goes away.

Link: http://lkml.kernel.org/r/alpine.LSU.2.11.2004161707410.16322@eggly.anvils
Reported-by: syzbot+c8a8197c8852f566b9d9@syzkaller.appspotmail.com
Link: https://lore.kernel.org/lkml/000000000000e5838c05a3152f53@google.com/
Reported-by: syzbot+40b71e145e73f78f81ad@syzkaller.appspotmail.com
Link: https://lore.kernel.org/lkml/0000000000003712b305a331d3b1@google.com/
Fixes: 4595ef88d136 ("shmem: make shmem_inode_info::lock irq-safe")
Signed-off-by: Hugh Dickins <hughd@google.com>
Cc: Yang Shi <yang.shi@linux.alibaba.com>
Acked-by: Yang Shi <yang.shi@linux.alibaba.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/shmem.c |    7 +++++--
 1 file changed, 5 insertions(+), 2 deletions(-)

--- a/mm/shmem.c~shmem-fix-possible-deadlocks-on-shmlock_user_lock
+++ a/mm/shmem.c
@@ -2179,7 +2179,11 @@ int shmem_lock(struct file *file, int lo
 	struct shmem_inode_info *info = SHMEM_I(inode);
 	int retval = -ENOMEM;
 
-	spin_lock_irq(&info->lock);
+	/*
+	 * What serializes the accesses to info->flags?
+	 * ipc_lock_object() when called from shmctl_do_lock(),
+	 * no serialization needed when called from shm_destroy().
+	 */
 	if (lock && !(info->flags & VM_LOCKED)) {
 		if (!user_shm_lock(inode->i_size, user))
 			goto out_nomem;
@@ -2194,7 +2198,6 @@ int shmem_lock(struct file *file, int lo
 	retval = 0;
 
 out_nomem:
-	spin_unlock_irq(&info->lock);
 	return retval;
 }
 
_

[patch 13/15] mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path

[Andrew Morton]

From: Yang Shi <yang.shi@linux.alibaba.com>
Subject: mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path

Syzbot reported the below lockdep splat:

WARNING: possible irq lock inversion dependency detected
5.6.0-rc7-syzkaller #0 Not tainted
--------------------------------------------------------
syz-executor.0/10317 just changed the state of lock:
ffff888021d16568 (&(&info->lock)->rlock){+.+.}, at: spin_lock
include/linux/spinlock.h:338 [inline]
ffff888021d16568 (&(&info->lock)->rlock){+.+.}, at:
shmem_mfill_atomic_pte+0x1012/0x21c0 mm/shmem.c:2407
but this lock was taken by another, SOFTIRQ-safe lock in the past:
 (&(&xa->xa_lock)->rlock#5){..-.}

and interrupts could create inverse lock ordering between them.

other info that might help us debug this:
 Possible interrupt unsafe locking scenario:

       CPU0                    CPU1
       ----                    ----
  lock(&(&info->lock)->rlock);
                               local_irq_disable();
                               lock(&(&xa->xa_lock)->rlock#5);
                               lock(&(&info->lock)->rlock);
  <Interrupt>
    lock(&(&xa->xa_lock)->rlock#5);

 *** DEADLOCK ***

The full report is quite lengthy, please see:
https://lore.kernel.org/linux-mm/alpine.LSU.2.11.2004152007370.13597@eggly.anvils/T/#m813b412c5f78e25ca8c6c7734886ed4de43f241d

It is because CPU 0 held info->lock with IRQ enabled in userfaultfd_copy
path, then CPU 1 is splitting a THP which held xa_lock and info->lock in
IRQ disabled context at the same time.  If softirq comes in to acquire
xa_lock, the deadlock would be triggered.

The fix is to acquire/release info->lock with *_irq version instead of
plain spin_{lock,unlock} to make it softirq safe.

Link: http://lkml.kernel.org/r/1587061357-122619-1-git-send-email-yang.shi@linux.alibaba.com
Fixes: 4c27fe4c4c84 ("userfaultfd: shmem: add shmem_mcopy_atomic_pte for userfaultfd support")
Signed-off-by: Yang Shi <yang.shi@linux.alibaba.com>
Reported-by: syzbot+e27980339d305f2dbfd9@syzkaller.appspotmail.com
Tested-by: syzbot+e27980339d305f2dbfd9@syzkaller.appspotmail.com
Acked-by: Hugh Dickins <hughd@google.com>
Cc: Andrea Arcangeli <aarcange@redhat.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 mm/shmem.c |    4 ++--
 1 file changed, 2 insertions(+), 2 deletions(-)

--- a/mm/shmem.c~mm-shmem-disable-interrupt-when-acquiring-info-lock-in-userfaultfd_copy-path
+++ a/mm/shmem.c
@@ -2402,11 +2402,11 @@ static int shmem_mfill_atomic_pte(struct
 
 	lru_cache_add_anon(page);
 
-	spin_lock(&info->lock);
+	spin_lock_irq(&info->lock);
 	info->alloced++;
 	inode->i_blocks += BLOCKS_PER_PAGE;
 	shmem_recalc_inode(inode);
-	spin_unlock(&info->lock);
+	spin_unlock_irq(&info->lock);
 
 	inc_mm_counter(dst_mm, mm_counter_file(page));
 	page_add_file_rmap(page, false);
_

[patch 14/15] coredump: fix null pointer dereference on coredump

[Andrew Morton]

From: Sudip Mukherjee <sudipm.mukherjee@gmail.com>
Subject: coredump: fix null pointer dereference on coredump

If the core_pattern is set to "|" and any process segfaults then we get
a null pointer derefernce while trying to coredump. The call stack shows:
[  108.212680] RIP: 0010:do_coredump+0x628/0x11c0

When the core_pattern has only "|" there is no use of trying the coredump
and we can check that while formating the corename and exit with an error.

After this change I get:
[   48.453756] format_corename failed
[   48.453758] Aborting core

Link: http://lkml.kernel.org/r/20200416194612.21418-1-sudipm.mukherjee@gmail.com
Fixes: 315c69261dd3 ("coredump: split pipe command whitespace before expanding template")
Signed-off-by: Sudip Mukherjee <sudipm.mukherjee@gmail.com>
Reported-by: Matthew Ruffell <matthew.ruffell@canonical.com>
Cc: Paul Wise <pabs3@bonedaddy.net>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Neil Horman <nhorman@tuxdriver.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 fs/coredump.c |    2 ++
 1 file changed, 2 insertions(+)

--- a/fs/coredump.c~coredump-fix-null-pointer-dereference-on-coredump
+++ a/fs/coredump.c
@@ -211,6 +211,8 @@ static int format_corename(struct core_n
 			return -ENOMEM;
 		(*argv)[(*argc)++] = 0;
 		++pat_ptr;
+		if (!(*pat_ptr))
+			return -ENOMEM;
 	}
 
 	/* Repeat as long as we have more pattern to process and more output
_

[patch 15/15] tools/vm: fix cross-compile build

[Andrew Morton]

From: Lucas Stach <l.stach@pengutronix.de>
Subject: tools/vm: fix cross-compile build

7ed1c1901fe5 (tools: fix cross-compile var clobbering) moved the setup of
the CC variable to tools/scripts/Makefile.include to make the behavior
consistent across all the tools Makefiles.  As the vm tools missed the
include we end up with the wrong CC in a cross-compiling evironment.

Link: http://lkml.kernel.org/r/20200416104748.25243-1-l.stach@pengutronix.de
Fixes: 7ed1c1901fe5 (tools: fix cross-compile var clobbering)
Signed-off-by: Lucas Stach <l.stach@pengutronix.de>
Cc: Martin Kelly <martin@martingkelly.com>
Cc: <stable@vger.kernel.org>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 tools/vm/Makefile |    2 ++
 1 file changed, 2 insertions(+)

--- a/tools/vm/Makefile~tools-vm-fix-cross-compile-build
+++ a/tools/vm/Makefile
@@ -1,6 +1,8 @@
 # SPDX-License-Identifier: GPL-2.0
 # Makefile for vm tools
 #
+include ../scripts/Makefile.include
+
 TARGETS=page-types slabinfo page_owner_sort
 
 LIB_DIR = ../lib/api
_

mmotm 2020-04-20-22-43 uploaded

[Andrew Morton]

The mm-of-the-moment snapshot 2020-04-20-22-43 has been uploaded to

   http://www.ozlabs.org/~akpm/mmotm/

mmotm-readme.txt says

README for mm-of-the-moment:

http://www.ozlabs.org/~akpm/mmotm/

This is a snapshot of my -mm patch queue.  Uploaded at random hopefully
more than once a week.

You will need quilt to apply these patches to the latest Linus release (5.x
or 5.x-rcY).  The series file is in broken-out.tar.gz and is duplicated in
http://ozlabs.org/~akpm/mmotm/series

The file broken-out.tar.gz contains two datestamp files: .DATE and
.DATE-yyyy-mm-dd-hh-mm-ss.  Both contain the string yyyy-mm-dd-hh-mm-ss,
followed by the base kernel version against which this patch series is to
be applied.

This tree is partially included in linux-next.  To see which patches are
included in linux-next, consult the `series' file.  Only the patches
within the #NEXT_PATCHES_START/#NEXT_PATCHES_END markers are included in
linux-next.


A full copy of the full kernel tree with the linux-next and mmotm patches
already applied is available through git within an hour of the mmotm
release.  Individual mmotm releases are tagged.  The master branch always
points to the latest release, so it's constantly rebasing.

	https://github.com/hnaz/linux-mm

The directory http://www.ozlabs.org/~akpm/mmots/ (mm-of-the-second)
contains daily snapshots of the -mm tree.  It is updated more frequently
than mmotm, and is untested.

A git copy of this tree is also available at

	https://github.com/hnaz/linux-mm



This mmotm tree contains the following patches against 5.7-rc2:
(patches marked "*" will be included in linux-next)

* sh-fix-build-error-in-mm-initc.patch
* slub-avoid-redzone-when-choosing-freepointer-location.patch
* mm-userfaultfd-disable-userfaultfd-wp-on-x86_32.patch
* maintainers-add-an-entry-for-kfifo.patch
* mm-hugetlb-fix-a-addressing-exception-caused-by-huge_pte_offset.patch
* mm-gup-return-eintr-when-gup-is-interrupted-by-fatal-signals.patch
* checkpatch-fix-a-typo-in-the-regex-for-allocfunctions.patch
* tools-build-tweak-unused-value-workaround.patch
* mm-ksm-fix-null-pointer-dereference-when-ksm-zero-page-is-enabled.patch
* mm-shmem-fix-build-without-thp.patch
* vmalloc-fix-remap_vmalloc_range-bounds-checks.patch
* shmem-fix-possible-deadlocks-on-shmlock_user_lock.patch
* mm-shmem-disable-interrupt-when-acquiring-info-lock-in-userfaultfd_copy-path.patch
* coredump-fix-null-pointer-dereference-on-coredump.patch
* tools-vm-fix-cross-compile-build.patch
* proc-kpageflags-prevent-an-integer-overflow-in-stable_page_flags.patch
* proc-kpageflags-do-not-use-uninitialized-struct-pages.patch
* ipc-mqueuec-change-__do_notify-to-bypass-check_kill_permission-v2.patch
* mm-memcg-fix-error-return-value-of-mem_cgroup_css_alloc.patch
* mm-memcg-fix-error-return-value-of-mem_cgroup_css_alloc-fix.patch
* kcov-cleanup-debug-messages.patch
* kcov-fix-potential-use-after-free-in-kcov_remote_start.patch
* kcov-move-t-kcov-assignments-into-kcov_start-stop.patch
* kcov-move-t-kcov_sequence-assignment.patch
* kcov-use-t-kcov_mode-as-enabled-indicator.patch
* kcov-collect-coverage-from-interrupts.patch
* usb-core-kcov-collect-coverage-from-usb-complete-callback.patch
* mm-page_alloc-fix-watchdog-soft-lockups-during-set_zone_contiguous.patch
* kernel-kcovc-fix-typos-in-kcov_remote_start-documentation.patch
* scripts-decodecode-fix-trapping-instruction-formatting.patch
* fs-binfmt_elfc-allocate-initialized-memory-in-fill_thread_core_info.patch
* squashfs-squashfs_fsh-replace-zero-length-array-with-flexible-array-member.patch
* squashfs-migrate-from-ll_rw_block-usage-to-bio.patch
* squashfs-migrate-from-ll_rw_block-usage-to-bio-fix.patch
* ocfs2-add-missing-annotation-for-dlm_empty_lockres.patch
* drivers-tty-serial-sh-scic-suppress-uninitialized-var-warning.patch
* ramfs-support-o_tmpfile.patch
* kernel-watchdog-flush-all-printk-nmi-buffers-when-hardlockup-detected.patch
  mm.patch
* usercopy-mark-dma-kmalloc-caches-as-usercopy-caches.patch
* mm-slub-fix-corrupted-freechain-in-deactivate_slab.patch
* mm-slub-fix-corrupted-freechain-in-deactivate_slab-fix.patch
* mm-dump_page-do-not-crash-with-invalid-mapping-pointer.patch
* mm-move-readahead-prototypes-from-mmh.patch
* mm-return-void-from-various-readahead-functions.patch
* mm-ignore-return-value-of-readpages.patch
* mm-move-readahead-nr_pages-check-into-read_pages.patch
* mm-add-new-readahead_control-api.patch
* mm-use-readahead_control-to-pass-arguments.patch
* mm-rename-various-offset-parameters-to-index.patch
* mm-rename-readahead-loop-variable-to-i.patch
* mm-remove-page_offset-from-readahead-loop.patch
* mm-put-readahead-pages-in-cache-earlier.patch
* mm-add-readahead-address-space-operation.patch
* mm-move-end_index-check-out-of-readahead-loop.patch
* mm-add-page_cache_readahead_unbounded.patch
* mm-document-why-we-dont-set-pagereadahead.patch
* mm-use-memalloc_nofs_save-in-readahead-path.patch
* fs-convert-mpage_readpages-to-mpage_readahead.patch
* btrfs-convert-from-readpages-to-readahead.patch
* erofs-convert-uncompressed-files-from-readpages-to-readahead.patch
* erofs-convert-compressed-files-from-readpages-to-readahead.patch
* ext4-convert-from-readpages-to-readahead.patch
* ext4-pass-the-inode-to-ext4_mpage_readpages.patch
* f2fs-convert-from-readpages-to-readahead.patch
* f2fs-pass-the-inode-to-f2fs_mpage_readpages.patch
* fuse-convert-from-readpages-to-readahead.patch
* fuse-convert-from-readpages-to-readahead-fix.patch
* iomap-convert-from-readpages-to-readahead.patch
* mm-swapfile-use-list_prevnext_entry-instead-of-open-coding.patch
* mm-swap_state-fix-a-data-race-in-swapin_nr_pages.patch
* mm-swap-properly-update-readahead-statistics-in-unuse_pte_range.patch
* mm-swapfilec-offset-is-only-used-when-there-is-more-slots.patch
* mm-swapfilec-explicitly-show-ssd-non-ssd-is-handled-mutually-exclusive.patch
* mm-swapfilec-remove-the-unnecessary-goto-for-ssd-case.patch
* mm-swapfilec-simplify-the-calculation-of-n_goal.patch
* mm-swapfilec-remove-the-extra-check-in-scan_swap_map_slots.patch
* memcg-optimize-memorynuma_stat-like-memorystat.patch
* memcg-optimize-memorynuma_stat-like-memorystat-fix.patch
* h8300-remove-usage-of-__arch_use_5level_hack.patch
* arm-add-support-for-folded-p4d-page-tables.patch
* arm64-add-support-for-folded-p4d-page-tables.patch
* hexagon-remove-__arch_use_5level_hack.patch
* ia64-add-support-for-folded-p4d-page-tables.patch
* nios2-add-support-for-folded-p4d-page-tables.patch
* openrisc-add-support-for-folded-p4d-page-tables.patch
* powerpc-add-support-for-folded-p4d-page-tables.patch
* sh-fault-modernize-printing-of-kernel-messages.patch
* sh-drop-__pxd_offset-macros-that-duplicate-pxd_index-ones.patch
* sh-add-support-for-folded-p4d-page-tables.patch
* unicore32-remove-__arch_use_5level_hack.patch
* asm-generic-remove-pgtable-nop4d-hackh.patch
* mm-remove-__arch_has_5level_hack-and-include-asm-generic-5level-fixuph.patch
* mm-gupc-further-document-vma_permits_fault.patch
* proc-pid-smaps-add-pmd-migration-entry-parsing.patch
* mm-mmap-fix-the-adjusted-length-error.patch
* mm-memory-remove-unnecessary-pte_devmap-case-in-copy_one_pte.patch
* x86-hyperv-use-vmalloc_exec-for-the-hypercall-page.patch
* x86-fix-vmap-arguments-in-map_irq_stack.patch
* staging-android-ion-use-vmap-instead-of-vm_map_ram.patch
* staging-media-ipu3-use-vmap-instead-of-reimplementing-it.patch
* dma-mapping-use-vmap-insted-of-reimplementing-it.patch
* powerpc-add-an-ioremap_phb-helper.patch
* powerpc-remove-__ioremap_at-and-__iounmap_at.patch
* mm-remove-__get_vm_area.patch
* mm-unexport-unmap_kernel_range_noflush.patch
* mm-rename-config_pgtable_mapping-to-config_zsmalloc_pgtable_mapping.patch
* mm-only-allow-page-table-mappings-for-built-in-zsmalloc.patch
* mm-pass-addr-as-unsigned-long-to-vb_free.patch
* mm-remove-vmap_page_range_noflush-and-vunmap_page_range.patch
* mm-rename-vmap_page_range-to-map_kernel_range.patch
* mm-dont-return-the-number-of-pages-from-map_kernel_range_noflush.patch
* mm-remove-map_vm_range.patch
* mm-remove-unmap_vmap_area.patch
* mm-remove-the-prot-argument-from-vm_map_ram.patch
* mm-enforce-that-vmap-cant-map-pages-executable.patch
* gpu-drm-remove-the-powerpc-hack-in-drm_legacy_sg_alloc.patch
* mm-remove-the-pgprot-argument-to-__vmalloc.patch
* mm-remove-the-prot-argument-to-__vmalloc_node.patch
* mm-remove-both-instances-of-__vmalloc_node_flags.patch
* mm-remove-__vmalloc_node_flags_caller.patch
* mm-remove-__vmalloc_node_flags_caller-fix.patch
* mm-switch-the-test_vmalloc-module-to-use-__vmalloc_node.patch
* mm-switch-the-test_vmalloc-module-to-use-__vmalloc_node-fix.patch
* mm-remove-vmalloc_user_node_flags.patch
* mm-remove-vmalloc_user_node_flags-fix.patch
* arm64-use-__vmalloc_node-in-arch_alloc_vmap_stack.patch
* powerpc-use-__vmalloc_node-in-alloc_vm_stack.patch
* s390-use-__vmalloc_node-in-stack_alloc.patch
* mm-init-report-kasan-tag-information-stored-in-page-flags.patch
* mm-clarify-__gfp_memalloc-usage.patch
* mm-memblock-replace-dereferences-of-memblock_regionnid-with-api-calls.patch
* mm-make-early_pfn_to_nid-and-related-defintions-close-to-each-other.patch
* mm-remove-config_have_memblock_node_map-option.patch
* mm-free_area_init-use-maximal-zone-pfns-rather-than-zone-sizes.patch
* mm-use-free_area_init-instead-of-free_area_init_nodes.patch
* alpha-simplify-detection-of-memory-zone-boundaries.patch
* arm-simplify-detection-of-memory-zone-boundaries.patch
* arm64-simplify-detection-of-memory-zone-boundaries-for-uma-configs.patch
* csky-simplify-detection-of-memory-zone-boundaries.patch
* m68k-mm-simplify-detection-of-memory-zone-boundaries.patch
* parisc-simplify-detection-of-memory-zone-boundaries.patch
* sparc32-simplify-detection-of-memory-zone-boundaries.patch
* unicore32-simplify-detection-of-memory-zone-boundaries.patch
* xtensa-simplify-detection-of-memory-zone-boundaries.patch
* mm-memmap_init-iterate-over-memblock-regions-rather-that-check-each-pfn.patch
* mm-memmap_init-iterate-over-memblock-regions-rather-that-check-each-pfn-fix.patch
* mm-remove-early_pfn_in_nid-and-config_nodes_span_other_nodes.patch
* mm-free_area_init-allow-defining-max_zone_pfn-in-descending-order.patch
* mm-rename-free_area_init_node-to-free_area_init_memoryless_node.patch
* mm-clean-up-free_area_init_node-and-its-helpers.patch
* mm-simplify-find_min_pfn_with_active_regions.patch
* docs-vm-update-memory-models-documentation.patch
* mm-page_allocc-bad_-is-not-necessary-when-pagehwpoison.patch
* mm-page_allocc-bad_flags-is-not-necessary-for-bad_page.patch
* mm-page_allocc-rename-free_pages_check_bad-to-check_free_page_bad.patch
* mm-page_allocc-rename-free_pages_check-to-check_free_page.patch
* mm-page_allocc-extract-check__page_bad-common-part-to-page_bad_reason.patch
* mmpage_alloccma-conditionally-prefer-cma-pageblocks-for-movable-allocations.patch
* mmpage_alloccma-conditionally-prefer-cma-pageblocks-for-movable-allocations-fix.patch
* mm-call-touch_nmi_watchdog-on-max-order-boundaries-in-deferred-init.patch
* mm-initialize-deferred-pages-with-interrupts-enabled.patch
* mm-call-cond_resched-from-deferred_init_memmap.patch
* mm-remove-unused-free_bootmem_with_active_regions.patch
* mm-page_allocc-only-tune-sysctl_lowmem_reserve_ratio-value-once-when-changing-it.patch
* mm-page_allocc-clear-out-zone-lowmem_reserve-if-the-zone-is-empty.patch
* mm-vmstatc-do-not-show-lowmem-reserve-protection-information-of-empty-zone.patch
* mm-page_alloc-use-ac-high_zoneidx-for-classzone_idx.patch
* mm-page_alloc-integrate-classzone_idx-and-high_zoneidx.patch
* mm-page_allocc-use-node_mask_none-in-build_zonelists.patch
* mm-rename-gfpflags_to_migratetype-to-gfp_migratetype-for-same-convention.patch
* mm-vmscanc-use-update_lru_size-in-update_lru_sizes.patch
* hugetlb_cgroup-remove-unused-variable-i.patch
* khugepaged-add-self-test.patch
* khugepaged-add-self-test-fix.patch
* khugepaged-do-not-stop-collapse-if-less-than-half-ptes-are-referenced.patch
* khugepaged-drain-all-lru-caches-before-scanning-pages.patch
* khugepaged-drain-lru-add-pagevec-after-swapin.patch
* khugepaged-allow-to-collapse-a-page-shared-across-fork.patch
* khugepaged-allow-to-collapse-pte-mapped-compound-pages.patch
* thp-change-cow-semantics-for-anon-thp.patch
* khugepaged-introduce-max_ptes_shared-tunable.patch
* khugepaged-introduce-max_ptes_shared-tunable-fix.patch
* hugetlbfs-add-arch_hugetlb_valid_size.patch
* hugetlbfs-move-hugepagesz=-parsing-to-arch-independent-code.patch
* hugetlbfs-remove-hugetlb_add_hstate-warning-for-existing-hstate.patch
* hugetlbfs-remove-hugetlb_add_hstate-warning-for-existing-hstate-fix.patch
* hugetlbfs-clean-up-command-line-processing.patch
* mm-thp-dont-need-drain-lru-cache-when-splitting-and-mlocking-thp.patch
* powerpc-mm-drop-platform-defined-pmd_mknotpresent.patch
* mm-thp-rename-pmd_mknotpresent-as-pmd_mknotvalid.patch
* drivers-base-memoryc-cache-memory-blocks-in-xarray-to-accelerate-lookup.patch
* drivers-base-memoryc-cache-memory-blocks-in-xarray-to-accelerate-lookup-fix.patch
* mm-memory_hotplug-refrain-from-adding-memory-into-an-impossible-node.patch
* powerpc-pseries-hotplug-memory-stop-checking-is_mem_section_removable.patch
* mm-memory_hotplug-remove-is_mem_section_removable.patch
* mm-replace-zero-length-array-with-flexible-array-member.patch
* mm-replace-zero-length-array-with-flexible-array-member-fix.patch
* mm-memory_hotplug-fix-a-typo-in-comment-recoreded-recorded.patch
* mm-ksm-fix-a-typo-in-comment-alreaady-already.patch
* mm-ksm-fix-a-typo-in-comment-alreaady-already-v2.patch
* mm-mmap-fix-a-typo-in-comment-compatbility-compatibility.patch
* mm-hugetlb-fix-a-typo-in-comment-manitained-maintained.patch
* mm-hugetlb-fix-a-typo-in-comment-manitained-maintained-v2.patch
* mm-hugetlb-fix-a-typo-in-comment-manitained-maintained-v2-checkpatch-fixes.patch
* mm-vmsan-fix-some-typos-in-comment.patch
* mm-compaction-fix-a-typo-in-comment-pessemistic-pessimistic.patch
* mm-memblock-fix-a-typo-in-comment-implict-implicit.patch
* mm-list_lru-fix-a-typo-in-comment-numbesr-numbers.patch
* mm-filemap-fix-a-typo-in-comment-unneccssary-unnecessary.patch
* mm-frontswap-fix-some-typos-in-frontswapc.patch
* mm-memcg-fix-some-typos-in-memcontrolc.patch
* mm-fix-a-typo-in-comment-strucure-structure.patch
* mm-slub-fix-a-typo-in-comment-disambiguiation-disambiguation.patch
* mm-sparse-fix-a-typo-in-comment-convienence-convenience.patch
* mm-page-writeback-fix-a-typo-in-comment-effictive-effective.patch
* mm-memory-fix-a-typo-in-comment-attampt-attempt.patch
* mm-use-false-for-bool-variable.patch
* info-task-hung-in-generic_file_write_iter.patch
* info-task-hung-in-generic_file_write-fix.patch
* kernel-hung_taskc-monitor-killed-tasks.patch
* proc-rename-catch-function-argument.patch
* proc-rename-struct-proc_fs_info-to-proc_fs_opts.patch
* proc-allow-to-mount-many-instances-of-proc-in-one-pid-namespace.patch
* proc-instantiate-only-pids-that-we-can-ptrace-on-hidepid=4-mount-option.patch
* proc-add-option-to-mount-only-a-pids-subset.patch
* docs-proc-add-documentation-for-hidepid=4-and-subset=pid-options-and-new-mount-behavior.patch
* proc-use-human-readable-values-for-hidepid.patch
* proc-use-named-enums-for-better-readability.patch
* x86-mm-define-mm_p4d_folded.patch
* mm-debug-add-tests-validating-architecture-page-table-helpers.patch
* mm-debug-add-tests-validating-architecture-page-table-helpers-v17.patch
* userc-make-uidhash_table-static.patch
* parisc-add-sysctl-file-interface-panic_on_stackoverflow.patch
* kernel-hung_taskc-introduce-sysctl-to-print-all-traces-when-a-hung-task-is-detected.patch
* dynamic_debug-add-an-option-to-enable-dynamic-debug-for-modules-only.patch
* dynamic_debug-add-an-option-to-enable-dynamic-debug-for-modules-only-v2.patch
* lib-math-avoid-trailing-n-hidden-in-pr_fmt.patch
* lib-add-might_fault-to-strncpy_from_user.patch
* lib-optimize-cpumask_local_spread.patch
* lib-test_lockupc-make-test_inode-static.patch
* checkpatch-additional-maintainer-section-entry-ordering-checks.patch
* checkpatch-look-for-c99-comments-in-ctx_locate_comment.patch
* fs-binfmt_elf-remove-redundant-elf_map-ifndef.patch
* elfnote-mark-all-note-sections-shf_alloc.patch
* initrdmem=-option-to-specify-initrd-physical-address.patch
* initrdmem=-option-to-specify-initrd-physical-address-checkpatch-fixes.patch
* fat-dont-allow-to-mount-if-the-fat-length-==-0.patch
* fat-improve-the-readahead-for-fat-entries.patch
* fs-seq_filec-seq_read-update-pr_info_ratelimited.patch
* umh-fix-refcount-underflow-in-fork_usermode_blob.patch
* kexec-prevent-removal-of-memory-in-use-by-a-loaded-kexec-image.patch
* mm-memory_hotplug-allow-arch-override-of-non-boot-memory-resource-names.patch
* arm64-memory-give-hotplug-memory-a-different-resource-name.patch
* panic-add-sysctl-to-dump-all-cpus-backtraces-on-oops-event.patch
* kernel-relayc-fix-read_pos-error-when-multiple-readers.patch
* aio-simplify-read_events.patch
* selftests-x86-pkeys-move-selftests-to-arch-neutral-directory.patch
* selftests-vm-pkeys-rename-all-references-to-pkru-to-a-generic-name.patch
* selftests-vm-pkeys-move-generic-definitions-to-header-file.patch
* selftests-vm-pkeys-move-some-definitions-to-arch-specific-header.patch
* selftests-vm-pkeys-make-gcc-check-arguments-of-sigsafe_printf.patch
* selftests-vm-pkeys-use-sane-types-for-pkey-register.patch
* selftests-vm-pkeys-add-helpers-for-pkey-bits.patch
* selftests-vm-pkeys-fix-pkey_disable_clear.patch
* selftests-vm-pkeys-fix-assertion-in-pkey_disable_set-clear.patch
* selftests-vm-pkeys-fix-alloc_random_pkey-to-make-it-really-random.patch
* selftests-vm-pkeys-use-the-correct-huge-page-size.patch
* selftests-vm-pkeys-introduce-generic-pkey-abstractions.patch
* selftests-vm-pkeys-introduce-powerpc-support.patch
* selftests-vm-pkeys-fix-number-of-reserved-powerpc-pkeys.patch
* selftests-vm-pkeys-fix-assertion-in-test_pkey_alloc_exhaust.patch
* selftests-vm-pkeys-improve-checks-to-determine-pkey-support.patch
* selftests-vm-pkeys-associate-key-on-a-mapped-page-and-detect-access-violation.patch
* selftests-vm-pkeys-associate-key-on-a-mapped-page-and-detect-write-violation.patch
* selftests-vm-pkeys-detect-write-violation-on-a-mapped-access-denied-key-page.patch
* selftests-vm-pkeys-introduce-a-sub-page-allocator.patch
* selftests-vm-pkeys-test-correct-behaviour-of-pkey-0.patch
* selftests-vm-pkeys-override-access-right-definitions-on-powerpc.patch
* selftests-vm-pkeys-use-the-correct-page-size-on-powerpc.patch
* selftests-vm-pkeys-fix-multilib-builds-for-x86.patch
* tools-testing-selftests-vm-remove-duplicate-headers.patch
* ipc-msg-add-missing-annotation-for-freeque.patch
* ipc-use-a-work-queue-to-free_ipc.patch
* ipc-convert-ipcs_idr-to-xarray.patch
  linux-next.patch
  linux-next-fix.patch
* amdgpu-a-null-mm-does-not-mean-a-thread-is-a-kthread.patch
* i915-gvt-remove-unused-xen-bits.patch
* kernel-move-use_mm-unuse_mm-to-kthreadc.patch
* kernel-move-use_mm-unuse_mm-to-kthreadc-v2.patch
* kernel-better-document-the-use_mm-unuse_mm-api-contract.patch
* kernel-better-document-the-use_mm-unuse_mm-api-contract-v2.patch
* kernel-set-user_ds-in-kthread_use_mm.patch
* mm-kmemleak-silence-kcsan-splats-in-checksum.patch
* kallsyms-printk-add-loglvl-to-print_ip_sym.patch
* alpha-add-show_stack_loglvl.patch
* arc-add-show_stack_loglvl.patch
* arm-asm-add-loglvl-to-c_backtrace.patch
* arm-add-loglvl-to-unwind_backtrace.patch
* arm-add-loglvl-to-dump_backtrace.patch
* arm-wire-up-dump_backtrace_entrystm.patch
* arm-add-show_stack_loglvl.patch
* arm64-add-loglvl-to-dump_backtrace.patch
* arm64-add-show_stack_loglvl.patch
* c6x-add-show_stack_loglvl.patch
* csky-add-show_stack_loglvl.patch
* h8300-add-show_stack_loglvl.patch
* hexagon-add-show_stack_loglvl.patch
* ia64-pass-log-level-as-arg-into-ia64_do_show_stack.patch
* ia64-add-show_stack_loglvl.patch
* m68k-add-show_stack_loglvl.patch
* microblaze-add-loglvl-to-microblaze_unwind_inner.patch
* microblaze-add-loglvl-to-microblaze_unwind.patch
* microblaze-add-show_stack_loglvl.patch
* mips-add-show_stack_loglvl.patch
* nds32-add-show_stack_loglvl.patch
* nios2-add-show_stack_loglvl.patch
* openrisc-add-show_stack_loglvl.patch
* parisc-add-show_stack_loglvl.patch
* powerpc-add-show_stack_loglvl.patch
* riscv-add-show_stack_loglvl.patch
* s390-add-show_stack_loglvl.patch
* sh-add-loglvl-to-dump_mem.patch
* sh-remove-needless-printk.patch
* sh-add-loglvl-to-printk_address.patch
* sh-add-loglvl-to-show_trace.patch
* sh-add-show_stack_loglvl.patch
* sparc-add-show_stack_loglvl.patch
* um-sysrq-remove-needless-variable-sp.patch
* um-add-show_stack_loglvl.patch
* unicore32-remove-unused-pmode-argument-in-c_backtrace.patch
* unicore32-add-loglvl-to-c_backtrace.patch
* unicore32-add-show_stack_loglvl.patch
* x86-add-missing-const-qualifiers-for-log_lvl.patch
* x86-add-show_stack_loglvl.patch
* xtensa-add-loglvl-to-show_trace.patch
* xtensa-add-show_stack_loglvl.patch
* sysrq-use-show_stack_loglvl.patch
* x86-amd_gart-print-stacktrace-for-a-leak-with-kern_err.patch
* power-use-show_stack_loglvl.patch
* kdb-dont-play-with-console_loglevel.patch
* sched-print-stack-trace-with-kern_info.patch
* kernel-use-show_stack_loglvl.patch
* kernel-rename-show_stack_loglvl-=-show_stack.patch
* mm-frontswap-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races.patch
* mm-page_io-mark-various-intentional-data-races-v2.patch
* mm-swap_state-mark-various-intentional-data-races.patch
* mm-filemap-fix-a-data-race-in-filemap_fault.patch
* mm-swapfile-fix-and-annotate-various-data-races.patch
* mm-swapfile-fix-and-annotate-various-data-races-v2.patch
* mm-page_counter-fix-various-data-races-at-memsw.patch
* mm-memcontrol-fix-a-data-race-in-scan-count.patch
* mm-list_lru-fix-a-data-race-in-list_lru_count_one.patch
* mm-mempool-fix-a-data-race-in-mempool_free.patch
* mm-util-annotate-an-data-race-at-vm_committed_as.patch
* mm-rmap-annotate-a-data-race-at-tlb_flush_batched.patch
* mm-annotate-a-data-race-in-page_zonenum.patch
* mm-swap-annotate-data-races-for-lru_rotate_pvecs.patch
* net-zerocopy-use-vm_insert_pages-for-tcp-rcv-zerocopy.patch
* mm-mmapc-add-more-sanity-checks-to-get_unmapped_area.patch
* mm-mmapc-do-not-allow-mappings-outside-of-allowed-limits.patch
* mm-pass-task-and-mm-to-do_madvise.patch
* mm-introduce-external-memory-hinting-api.patch
* mm-introduce-external-memory-hinting-api-fix.patch
* mm-check-fatal-signal-pending-of-target-process.patch
* pid-move-pidfd_get_pid-function-to-pidc.patch
* mm-support-both-pid-and-pidfd-for-process_madvise.patch
* mm-madvise-employ-mmget_still_valid-for-write-lock.patch
* mm-madvise-allow-ksm-hints-for-remote-api.patch
* fix-read-buffer-overflow-in-delta-ipc.patch
  make-sure-nobodys-leaking-resources.patch
  releasing-resources-with-children.patch
  mutex-subsystem-synchro-test-module.patch
  kernel-forkc-export-kernel_thread-to-modules.patch
  workaround-for-a-pci-restoring-bug.patch

Re: [patch 04/15] MAINTAINERS: add an entry for kfifo

[Andy Shevchenko]

On Mon, Apr 20, 2020 at 06:13:48PM -0700, Andrew Morton wrote:
> From: Bartosz Golaszewski <bgolaszewski@baylibre.com>
> Subject: MAINTAINERS: add an entry for kfifo
> 
> Kfifo has been written by Stefani Seibold and she's implicitly expected to
> Ack any changes to it.  She's not however officially listed as kfifo
> maintainer which leads to delays in patch review.  This patch proposes to
> add an explitic entry for kfifo to MAINTAINERS file.
> 
> [akpm@linux-foundation.org: alphasort F: entries, per Joe]
> [akpm@linux-foundation.org: remove colon, per Bartosz]
> Link: http://lkml.kernel.org/r/20200124174533.21815-1-brgl@bgdev.pl
> Link: http://lkml.kernel.org/r/20200413104250.26683-1-brgl@bgdev.pl
> Signed-off-by: Bartosz Golaszewski <bgolaszewski@baylibre.com>

> Acked by Stefani Seibold <stefani@seibold.net>

It looks broken by some reason.

> Cc: Greg Kroah-Hartman <gregkh@linuxfoundation.org>
> Cc: Linus Walleij <linus.walleij@linaro.org>
> Cc: Andy Shevchenko <andriy.shevchenko@linux.intel.com>
> Cc: Joe Perches <joe@perches.com>
> Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
> ---
> 
>  MAINTAINERS |    7 +++++++
>  1 file changed, 7 insertions(+)
> 
> --- a/MAINTAINERS~maintainers-add-an-entry-for-kfifo
> +++ a/MAINTAINERS
> @@ -9416,6 +9416,13 @@ F:	include/linux/keyctl.h
>  F:	include/uapi/linux/keyctl.h
>  F:	security/keys/
>  
> +KFIFO
> +M:	Stefani Seibold <stefani@seibold.net>
> +S:	Maintained
> +F:	include/linux/kfifo.h
> +F:	lib/kfifo.c
> +F:	samples/kfifo/
> +
>  KGDB / KDB /debug_core
>  M:	Jason Wessel <jason.wessel@windriver.com>
>  M:	Daniel Thompson <daniel.thompson@linaro.org>
> _

-- 
With Best Regards,
Andy Shevchenko

incoming

[Andrew Morton]

2 patches, based on d615b5416f8a1afeb82d13b238f8152c572d59c0.

Subsystems affected by this patch series:

  mm/kasan
  mm/debug

Subsystem: mm/kasan

    Zqiang <qiang1.zhang@intel.com>:
      kasan: prevent cpu_quarantine corruption when CPU offline and cache shrink occur at same time

Subsystem: mm/debug

    Akira Yokosawa <akiyks@gmail.com>:
      docs: vm/page_owner: use literal blocks for param description

 Documentation/vm/page_owner.rst |    5 +++--
 mm/kasan/quarantine.c           |    7 +++++++
 2 files changed, 10 insertions(+), 2 deletions(-)

incoming

[Andrew Morton]

13 patches, based on b253435746d9a4a701b5f09211b9c14d3370d0da.

Subsystems affected by this patch series:

  mm/memory-failure
  mm/memcg
  mm/userfaultfd
  mm/hugetlbfs
  mm/mremap
  mm/oom-kill
  mm/kasan
  kcov
  mm/hmm

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: fix race between hugetlb free/demotion and memory_failure_hugetlb()

    Xu Yu <xuyu@linux.alibaba.com>:
      mm/memory-failure.c: skip huge_zero_page in memory_failure()

Subsystem: mm/memcg

    Shakeel Butt <shakeelb@google.com>:
      memcg: sync flush only if periodic flush is delayed

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
      userfaultfd: mark uffd_wp regardless of VM_WRITE flag

Subsystem: mm/hugetlbfs

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm, hugetlb: allow for "high" userspace addresses

Subsystem: mm/mremap

    Sidhartha Kumar <sidhartha.kumar@oracle.com>:
      selftest/vm: verify mmap addr in mremap_test
      selftest/vm: verify remap destination address in mremap_test
      selftest/vm: support xfail in mremap_test
      selftest/vm: add skip support to mremap_test

Subsystem: mm/oom-kill

    Nico Pache <npache@redhat.com>:
      oom_kill.c: futex: delay the OOM reaper to allow time for proper futex cleanup

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      MAINTAINERS: add Vincenzo Frascino to KASAN reviewers

Subsystem: kcov

    Aleksandr Nogikh <nogikh@google.com>:
      kcov: don't generate a warning on vm_insert_page()'s failure

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
      mm/mmu_notifier.c: fix race in mmu_interval_notifier_remove()

 MAINTAINERS                               |    1 
 fs/hugetlbfs/inode.c                      |    9 -
 include/linux/hugetlb.h                   |    6 +
 include/linux/memcontrol.h                |    5 
 include/linux/mm.h                        |    8 +
 include/linux/sched.h                     |    1 
 include/linux/sched/mm.h                  |    8 +
 kernel/kcov.c                             |    7 -
 mm/hugetlb.c                              |   10 +
 mm/memcontrol.c                           |   12 ++
 mm/memory-failure.c                       |  158 ++++++++++++++++++++++--------
 mm/mmap.c                                 |    8 -
 mm/mmu_notifier.c                         |   14 ++
 mm/oom_kill.c                             |   54 +++++++---
 mm/userfaultfd.c                          |   15 +-
 mm/workingset.c                           |    2 
 tools/testing/selftests/vm/mremap_test.c  |   85 +++++++++++++++-
 tools/testing/selftests/vm/run_vmtests.sh |   11 +-
 18 files changed, 327 insertions(+), 87 deletions(-)

incoming

[Andrew Morton]

14 patches, based on 115acbb56978941bb7537a97dfc303da286106c1.

Subsystems affected by this patch series:

  MAINTAINERS
  mm/tmpfs
  m/secretmem
  mm/kasan
  mm/kfence
  mm/pagealloc
  mm/zram
  mm/compaction
  mm/hugetlb
  binfmt
  mm/vmalloc
  mm/kmemleak

Subsystem: MAINTAINERS

    Joe Perches <joe@perches.com>:
      MAINTAINERS: Broadcom internal lists aren't maintainers

Subsystem: mm/tmpfs

    Hugh Dickins <hughd@google.com>:
      tmpfs: fix regressions from wider use of ZERO_PAGE

Subsystem: m/secretmem

    Axel Rasmussen <axelrasmussen@google.com>:
      mm/secretmem: fix panic when growing a memfd_secret

Subsystem: mm/kasan

    Zqiang <qiang1.zhang@intel.com>:
      irq_work: use kasan_record_aux_stack_noalloc() record callstack

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kasan: fix hw tags enablement when KUNIT tests are disabled

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      mm, kfence: support kmem_dump_obj() for KFENCE objects

Subsystem: mm/pagealloc

    Juergen Gross <jgross@suse.com>:
      mm, page_alloc: fix build_zonerefs_node()

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      mm: fix unexpected zeroed page mapping with zram swap

Subsystem: mm/compaction

    Charan Teja Kalla <quic_charante@quicinc.com>:
      mm: compaction: fix compiler warning when CONFIG_COMPACTION=n

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: do not demote poisoned hugetlb pages

Subsystem: binfmt

    Andrew Morton <akpm@linux-foundation.org>:
      revert "fs/binfmt_elf: fix PT_LOAD p_align values for loaders"
      revert "fs/binfmt_elf: use PT_LOAD p_align values for static PIE"

Subsystem: mm/vmalloc

    Omar Sandoval <osandov@fb.com>:
      mm/vmalloc: fix spinning drain_vmap_work after reading from /proc/vmcore

Subsystem: mm/kmemleak

    Patrick Wang <patrick.wang.shcn@gmail.com>:
      mm: kmemleak: take a full lowmem check in kmemleak_*_phys()

 MAINTAINERS                     |   64 ++++++++++++++++++++--------------------
 arch/x86/include/asm/io.h       |    2 -
 arch/x86/kernel/crash_dump_64.c |    1 
 fs/binfmt_elf.c                 |    6 +--
 include/linux/kfence.h          |   24 +++++++++++++++
 kernel/irq_work.c               |    2 -
 mm/compaction.c                 |   10 +++---
 mm/filemap.c                    |    6 ---
 mm/hugetlb.c                    |   17 ++++++----
 mm/kasan/hw_tags.c              |    5 +--
 mm/kasan/kasan.h                |   10 +++---
 mm/kfence/core.c                |   21 -------------
 mm/kfence/kfence.h              |   21 +++++++++++++
 mm/kfence/report.c              |   47 +++++++++++++++++++++++++++++
 mm/kmemleak.c                   |    8 ++---
 mm/page_alloc.c                 |    2 -
 mm/page_io.c                    |   54 ---------------------------------
 mm/secretmem.c                  |   17 ++++++++++
 mm/shmem.c                      |   31 ++++++++++++-------
 mm/slab.c                       |    2 -
 mm/slab.h                       |    2 -
 mm/slab_common.c                |    9 +++++
 mm/slob.c                       |    2 -
 mm/slub.c                       |    2 -
 mm/vmalloc.c                    |   11 ------
 25 files changed, 207 insertions(+), 169 deletions(-)

incoming

[Andrew Morton]

9 patches, based on d00c50b35101b862c3db270ffeba53a63a1063d9.

Subsystems affected by this patch series:

  mm/migration
  mm/highmem
  lz4
  mm/sparsemem
  mm/mremap
  mm/mempolicy
  mailmap
  mm/memcg
  MAINTAINERS

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm: migrate: use thp_order instead of HPAGE_PMD_ORDER for new page allocation.

Subsystem: mm/highmem

    Max Filippov <jcmvbkbc@gmail.com>:
      highmem: fix checks in __kmap_local_sched_{in,out}

Subsystem: lz4

    Guo Xuenan <guoxuenan@huawei.com>:
      lz4: fix LZ4_decompress_safe_partial read out of bound

Subsystem: mm/sparsemem

    Waiman Long <longman@redhat.com>:
      mm/sparsemem: fix 'mem_section' will never be NULL gcc 12 warning

Subsystem: mm/mremap

    Paolo Bonzini <pbonzini@redhat.com>:
      mmmremap.c: avoid pointless invalidate_range_start/end on mremap(old_size=0)

Subsystem: mm/mempolicy

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempolicy: fix mpol_new leak in shared_policy_replace

Subsystem: mailmap

    Vasily Averin <vasily.averin@linux.dev>:
      mailmap: update Vasily Averin's email address

Subsystem: mm/memcg

    Andrew Morton <akpm@linux-foundation.org>:
      mm/list_lru.c: revert "mm/list_lru: optimize memcg_reparent_list_lru_node()"

Subsystem: MAINTAINERS

    Tom Rix <trix@redhat.com>:
      MAINTAINERS: add Tom as clang reviewer

 .mailmap                 |    4 ++++
 MAINTAINERS              |    1 +
 include/linux/mmzone.h   |   11 +++++++----
 lib/lz4/lz4_decompress.c |    8 ++++++--
 mm/highmem.c             |    4 ++--
 mm/list_lru.c            |    6 ------
 mm/mempolicy.c           |    3 ++-
 mm/migrate.c             |    2 +-
 mm/mremap.c              |    3 +++
 9 files changed, 26 insertions(+), 16 deletions(-)

incoming

[Andrew Morton]

16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.

Subsystems affected by this patch series:

  mm/madvise
  ofs2
  nilfs2
  mm/mlock
  mm/mfence
  mailmap
  mm/memory-failure
  mm/kasan
  mm/debug
  mm/kmemleak
  mm/damon

Subsystem: mm/madvise

    Charan Teja Kalla <quic_charante@quicinc.com>:
      Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"

Subsystem: ofs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: fix crash when mount with quota enabled

Subsystem: nilfs2

    Ryusuke Konishi <konishi.ryusuke@gmail.com>:
    Patch series "nilfs2 lockdep warning fixes":
      nilfs2: fix lockdep warnings in page operations for btree nodes
      nilfs2: fix lockdep warnings during disk space reclamation
      nilfs2: get rid of nilfs_mapping_init()

Subsystem: mm/mlock

    Hugh Dickins <hughd@google.com>:
      mm/munlock: add lru_add_drain() to fix memcg_stat_test
      mm/munlock: update Documentation/vm/unevictable-lru.rst

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/munlock: protect the per-CPU pagevec by a local_lock_t

Subsystem: mm/kfence

    Muchun Song <songmuchun@bytedance.com>:
      mm: kfence: fix objcgs vector allocation

Subsystem: mailmap

    Kirill Tkhai <kirill.tkhai@openvz.org>:
      mailmap: update Kirill's email

Subsystem: mm/memory-failure

    Rik van Riel <riel@surriel.com>:
      mm,hwpoison: unmap poisoned page before invalidation

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP

Subsystem: mm/debug

    Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: remove -c option
      doc/vm/page_owner.rst: remove content related to -c option

Subsystem: mm/kmemleak

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      mm/kmemleak: reset tag when compare object pointer

Subsystem: mm/damon

    Jonghyeon Kim <tome01@ajou.ac.kr>:
      mm/damon: prevent activated scheme from sleeping by deactivated schemes

 .mailmap                             |    1 
 Documentation/vm/page_owner.rst      |    1 
 Documentation/vm/unevictable-lru.rst |  473 +++++++++++++++--------------------
 fs/nilfs2/btnode.c                   |   23 +
 fs/nilfs2/btnode.h                   |    1 
 fs/nilfs2/btree.c                    |   27 +
 fs/nilfs2/dat.c                      |    4 
 fs/nilfs2/gcinode.c                  |    7 
 fs/nilfs2/inode.c                    |  167 +++++++++++-
 fs/nilfs2/mdt.c                      |   45 ++-
 fs/nilfs2/mdt.h                      |    6 
 fs/nilfs2/nilfs.h                    |   16 -
 fs/nilfs2/page.c                     |   16 -
 fs/nilfs2/page.h                     |    1 
 fs/nilfs2/segment.c                  |    9 
 fs/nilfs2/super.c                    |    5 
 fs/ocfs2/quota_global.c              |   23 -
 fs/ocfs2/quota_local.c               |    2 
 include/linux/gfp.h                  |    4 
 mm/damon/core.c                      |    5 
 mm/gup.c                             |   10 
 mm/internal.h                        |    6 
 mm/kfence/core.c                     |   11 
 mm/kfence/kfence.h                   |    3 
 mm/kmemleak.c                        |    9 
 mm/madvise.c                         |    9 
 mm/memory.c                          |   12 
 mm/migrate.c                         |    2 
 mm/mlock.c                           |   46 ++-
 mm/page_alloc.c                      |    1 
 mm/rmap.c                            |    4 
 mm/swap.c                            |    4 
 tools/vm/page_owner_sort.c           |    6 
 33 files changed, 560 insertions(+), 399 deletions(-)

Re: incoming

[Andrew Morton]

Argh, messed up in-reply-to.  Let me redo...

incoming

[Andrew Morton]

16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.

Subsystems affected by this patch series:

  mm/madvise
  ofs2
  nilfs2
  mm/mlock
  mm/mfence
  mailmap
  mm/memory-failure
  mm/kasan
  mm/debug
  mm/kmemleak
  mm/damon

Subsystem: mm/madvise

    Charan Teja Kalla <quic_charante@quicinc.com>:
      Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"

Subsystem: ofs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: fix crash when mount with quota enabled

Subsystem: nilfs2

    Ryusuke Konishi <konishi.ryusuke@gmail.com>:
    Patch series "nilfs2 lockdep warning fixes":
      nilfs2: fix lockdep warnings in page operations for btree nodes
      nilfs2: fix lockdep warnings during disk space reclamation
      nilfs2: get rid of nilfs_mapping_init()

Subsystem: mm/mlock

    Hugh Dickins <hughd@google.com>:
      mm/munlock: add lru_add_drain() to fix memcg_stat_test
      mm/munlock: update Documentation/vm/unevictable-lru.rst

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/munlock: protect the per-CPU pagevec by a local_lock_t

Subsystem: mm/kfence

    Muchun Song <songmuchun@bytedance.com>:
      mm: kfence: fix objcgs vector allocation

Subsystem: mailmap

    Kirill Tkhai <kirill.tkhai@openvz.org>:
      mailmap: update Kirill's email

Subsystem: mm/memory-failure

    Rik van Riel <riel@surriel.com>:
      mm,hwpoison: unmap poisoned page before invalidation

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP

Subsystem: mm/debug

    Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: remove -c option
      doc/vm/page_owner.rst: remove content related to -c option

Subsystem: mm/kmemleak

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      mm/kmemleak: reset tag when compare object pointer

Subsystem: mm/damon

    Jonghyeon Kim <tome01@ajou.ac.kr>:
      mm/damon: prevent activated scheme from sleeping by deactivated schemes

 .mailmap                             |    1 
 Documentation/vm/page_owner.rst      |    1 
 Documentation/vm/unevictable-lru.rst |  473 +++++++++++++++--------------------
 fs/nilfs2/btnode.c                   |   23 +
 fs/nilfs2/btnode.h                   |    1 
 fs/nilfs2/btree.c                    |   27 +
 fs/nilfs2/dat.c                      |    4 
 fs/nilfs2/gcinode.c                  |    7 
 fs/nilfs2/inode.c                    |  167 +++++++++++-
 fs/nilfs2/mdt.c                      |   45 ++-
 fs/nilfs2/mdt.h                      |    6 
 fs/nilfs2/nilfs.h                    |   16 -
 fs/nilfs2/page.c                     |   16 -
 fs/nilfs2/page.h                     |    1 
 fs/nilfs2/segment.c                  |    9 
 fs/nilfs2/super.c                    |    5 
 fs/ocfs2/quota_global.c              |   23 -
 fs/ocfs2/quota_local.c               |    2 
 include/linux/gfp.h                  |    4 
 mm/damon/core.c                      |    5 
 mm/gup.c                             |   10 
 mm/internal.h                        |    6 
 mm/kfence/core.c                     |   11 
 mm/kfence/kfence.h                   |    3 
 mm/kmemleak.c                        |    9 
 mm/madvise.c                         |    9 
 mm/memory.c                          |   12 
 mm/migrate.c                         |    2 
 mm/mlock.c                           |   46 ++-
 mm/page_alloc.c                      |    1 
 mm/rmap.c                            |    4 
 mm/swap.c                            |    4 
 tools/vm/page_owner_sort.c           |    6 
 33 files changed, 560 insertions(+), 399 deletions(-)

incoming

[Andrew Morton]

This is the material which was staged after willystuff in linux-next. 
Everything applied seamlessly on your latest, all looks well.



114 patches, based on 52deda9551a01879b3562e7b41748e85c591f14c.

Subsystems affected by this patch series:

  mm/debug
  mm/selftests
  mm/pagecache
  mm/thp
  mm/rmap
  mm/migration
  mm/kasan
  mm/hugetlb
  mm/pagemap
  mm/madvise
  selftests

Subsystem: mm/debug

    Sean Anderson <seanga2@gmail.com>:
      tools/vm/page_owner_sort.c: sort by stacktrace before culling
      tools/vm/page_owner_sort.c: support sorting by stack trace

    Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt

    Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: support sorting pid and time

    Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: two trivial fixes

    Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: delete invalid duplicate code

    Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
      Documentation/vm/page_owner.rst: update the documentation

    Shuah Khan <skhan@linuxfoundation.org>:
      Documentation/vm/page_owner.rst: fix unexpected indentation warns

    Waiman Long <longman@redhat.com>:
    Patch series "mm/page_owner: Extend page_owner to show memcg information", v4:
      lib/vsprintf: avoid redundant work with 0 size
      mm/page_owner: use scnprintf() to avoid excessive buffer overrun check
      mm/page_owner: print memcg information
      mm/page_owner: record task command name

    Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
      mm/page_owner.c: record tgid
      tools/vm/page_owner_sort.c: fix the instructions for use

    Jiajian Ye <yejiajian2018@email.szu.edu.cn>:
      tools/vm/page_owner_sort.c: fix comments
      tools/vm/page_owner_sort.c: add a security check
      tools/vm/page_owner_sort.c: support sorting by tgid and update documentation
      tools/vm/page_owner_sort: fix three trivival places
      tools/vm/page_owner_sort: support for sorting by task command name
      tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name
      tools/vm/page_owner_sort.c: support for user-defined culling rules

    Christoph Hellwig <hch@lst.de>:
      mm: unexport page_init_poison

Subsystem: mm/selftests

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      selftest/vm: add util.h and and move helper functions there

    Mike Rapoport <rppt@kernel.org>:
      selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT

Subsystem: mm/pagecache

    Hugh Dickins <hughd@google.com>:
      mm: delete __ClearPageWaiters()
      mm: filemap_unaccount_folio() large skip mapcount fixup

Subsystem: mm/thp

    Hugh Dickins <hughd@google.com>:
      mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap()

Subsystem: mm/rmap

Subsystem: mm/migration

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/migration: Add trace events", v3:
      mm/migration: add trace events for THP migrations
      mm/migration: add trace events for base page and HugeTLB migrations

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6:
      kasan, page_alloc: deduplicate should_skip_kasan_poison
      kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages
      kasan, page_alloc: merge kasan_free_pages into free_pages_prepare
      kasan, page_alloc: simplify kasan_poison_pages call site
      kasan, page_alloc: init memory of skipped pages on free
      kasan: drop skip_kasan_poison variable in free_pages_prepare
      mm: clarify __GFP_ZEROTAGS comment
      kasan: only apply __GFP_ZEROTAGS when memory is zeroed
      kasan, page_alloc: refactor init checks in post_alloc_hook
      kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook
      kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook
      kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook
      kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook
      kasan, page_alloc: rework kasan_unpoison_pages call site
      kasan: clean up metadata byte definitions
      kasan: define KASAN_VMALLOC_INVALID for SW_TAGS
      kasan, x86, arm64, s390: rename functions for modules shadow
      kasan, vmalloc: drop outdated VM_KASAN comment
      kasan: reorder vmalloc hooks
      kasan: add wrappers for vmalloc hooks
      kasan, vmalloc: reset tags in vmalloc functions
      kasan, fork: reset pointer tags of vmapped stacks
      kasan, arm64: reset pointer tags of vmapped stacks
      kasan, vmalloc: add vmalloc tagging for SW_TAGS
      kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged
      kasan, vmalloc: unpoison VM_ALLOC pages after mapping
      kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS
      kasan, page_alloc: allow skipping unpoisoning for HW_TAGS
      kasan, page_alloc: allow skipping memory init for HW_TAGS
      kasan, vmalloc: add vmalloc tagging for HW_TAGS
      kasan, vmalloc: only tag normal vmalloc allocations
      kasan, arm64: don't tag executable vmalloc allocations
      kasan: mark kasan_arg_stacktrace as __initdata
      kasan: clean up feature flags for HW_TAGS mode
      kasan: add kasan.vmalloc command line flag
      kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS
      arm64: select KASAN_VMALLOC for SW/HW_TAGS modes
      kasan: documentation updates
      kasan: improve vmalloc tests
      kasan: test: support async (again) and asymm modes for HW_TAGS

    tangmeng <tangmeng@uniontech.com>:
      mm/kasan: remove unnecessary CONFIG_KASAN option

    Peter Collingbourne <pcc@google.com>:
      kasan: update function name in comments

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: print virtual mapping info in reports
    Patch series "kasan: report clean-ups and improvements":
      kasan: drop addr check from describe_object_addr
      kasan: more line breaks in reports
      kasan: rearrange stack frame info in reports
      kasan: improve stack frame info in reports
      kasan: print basic stack frame info for SW_TAGS
      kasan: simplify async check in end_report()
      kasan: simplify kasan_update_kunit_status() and call sites
      kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT
      kasan: move update_kunit_status to start_report
      kasan: move disable_trace_on_warning to start_report
      kasan: split out print_report from __kasan_report
      kasan: simplify kasan_find_first_bad_addr call sites
      kasan: restructure kasan_report
      kasan: merge __kasan_report into kasan_report
      kasan: call print_report from kasan_report_invalid_free
      kasan: move and simplify kasan_report_async
      kasan: rename kasan_access_info to kasan_report_info
      kasan: add comment about UACCESS regions to kasan_report
      kasan: respect KASAN_BIT_REPORTED in all reporting routines
      kasan: reorder reporting functions
      kasan: move and hide kasan_save_enable/restore_multi_shot
      kasan: disable LOCKDEP when printing reports

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "Add hugetlb MADV_DONTNEED support", v3:
      mm: enable MADV_DONTNEED for hugetlb mappings
      selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test
      userfaultfd/selftests: enable hugetlb remap and remove event testing

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/huge_memory: make is_transparent_hugepage() static

Subsystem: mm/pagemap

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3:
      mm: optimize do_wp_page() for exclusive pages in the swapcache
      mm: optimize do_wp_page() for fresh pages in local LRU pagevecs
      mm: slightly clarify KSM logic in do_swap_page()
      mm: streamline COW logic in do_swap_page()
      mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page()
      mm/khugepaged: remove reuse_swap_page() usage
      mm/swapfile: remove stale reuse_swap_page()
      mm/huge_memory: remove stale page_trans_huge_mapcount()
      mm/huge_memory: remove stale locking logic from __split_huge_pmd()

    Hugh Dickins <hughd@google.com>:
      mm: warn on deleting redirtied only if accounted
      mm: unmap_mapping_range_tree() with i_mmap_rwsem shared

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: generalize ARCH_HAS_FILTER_PGPROT

Subsystem: mm/madvise

    Mauricio Faria de Oliveira <mfo@canonical.com>:
      mm: fix race between MADV_FREE reclaim and blkdev direct IO read

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: madvise: MADV_DONTNEED_LOCKED

Subsystem: selftests

    Muhammad Usama Anjum <usama.anjum@collabora.com>:
      selftests: vm: remove dependecy from internal kernel macros

    Kees Cook <keescook@chromium.org>:
      selftests: kselftest framework: provide "finished" helper

 Documentation/dev-tools/kasan.rst             |   17 
 Documentation/vm/page_owner.rst               |   72 ++
 arch/alpha/include/uapi/asm/mman.h            |    2 
 arch/arm64/Kconfig                            |    2 
 arch/arm64/include/asm/vmalloc.h              |    6 
 arch/arm64/include/asm/vmap_stack.h           |    5 
 arch/arm64/kernel/module.c                    |    5 
 arch/arm64/mm/pageattr.c                      |    2 
 arch/arm64/net/bpf_jit_comp.c                 |    3 
 arch/mips/include/uapi/asm/mman.h             |    2 
 arch/parisc/include/uapi/asm/mman.h           |    2 
 arch/powerpc/mm/book3s64/trace.c              |    1 
 arch/s390/kernel/module.c                     |    2 
 arch/x86/Kconfig                              |    3 
 arch/x86/kernel/module.c                      |    2 
 arch/x86/mm/init.c                            |    1 
 arch/xtensa/include/uapi/asm/mman.h           |    2 
 include/linux/gfp.h                           |   53 +-
 include/linux/huge_mm.h                       |    6 
 include/linux/kasan.h                         |  136 +++--
 include/linux/mm.h                            |    5 
 include/linux/page-flags.h                    |    2 
 include/linux/pagemap.h                       |    3 
 include/linux/swap.h                          |    4 
 include/linux/vmalloc.h                       |   18 
 include/trace/events/huge_memory.h            |    1 
 include/trace/events/migrate.h                |   31 +
 include/trace/events/mmflags.h                |   18 
 include/trace/events/thp.h                    |   27 +
 include/uapi/asm-generic/mman-common.h        |    2 
 kernel/fork.c                                 |   13 
 kernel/scs.c                                  |   16 
 lib/Kconfig.kasan                             |   18 
 lib/test_kasan.c                              |  239 ++++++++-
 lib/vsprintf.c                                |    8 
 mm/Kconfig                                    |    3 
 mm/debug.c                                    |    1 
 mm/filemap.c                                  |   63 +-
 mm/huge_memory.c                              |  109 ----
 mm/kasan/Makefile                             |    2 
 mm/kasan/common.c                             |    4 
 mm/kasan/hw_tags.c                            |  243 +++++++---
 mm/kasan/kasan.h                              |   76 ++-
 mm/kasan/report.c                             |  516 +++++++++++----------
 mm/kasan/report_generic.c                     |   34 -
 mm/kasan/report_hw_tags.c                     |    1 
 mm/kasan/report_sw_tags.c                     |   16 
 mm/kasan/report_tags.c                        |    2 
 mm/kasan/shadow.c                             |   76 +--
 mm/khugepaged.c                               |   11 
 mm/madvise.c                                  |   57 +-
 mm/memory.c                                   |  129 +++--
 mm/memremap.c                                 |    2 
 mm/migrate.c                                  |    4 
 mm/page-writeback.c                           |   18 
 mm/page_alloc.c                               |  270 ++++++-----
 mm/page_owner.c                               |   86 ++-
 mm/rmap.c                                     |   62 +-
 mm/swap.c                                     |    4 
 mm/swapfile.c                                 |  104 ----
 mm/vmalloc.c                                  |  167 ++++--
 tools/testing/selftests/kselftest.h           |   10 
 tools/testing/selftests/vm/.gitignore         |    1 
 tools/testing/selftests/vm/Makefile           |    1 
 tools/testing/selftests/vm/gup_test.c         |    3 
 tools/testing/selftests/vm/hugetlb-madvise.c  |  410 ++++++++++++++++
 tools/testing/selftests/vm/ksm_tests.c        |   38 -
 tools/testing/selftests/vm/memfd_secret.c     |    2 
 tools/testing/selftests/vm/run_vmtests.sh     |   15 
 tools/testing/selftests/vm/transhuge-stress.c |   41 -
 tools/testing/selftests/vm/userfaultfd.c      |   72 +-
 tools/testing/selftests/vm/util.h             |   75 ++-
 tools/vm/page_owner_sort.c                    |  628 +++++++++++++++++++++-----
 73 files changed, 2797 insertions(+), 1288 deletions(-)

incoming

[Andrew Morton]

Various misc subsystems, before getting into the post-linux-next material.

This is all based on v5.17.  I tested applying and compiling against
today's 1bc191051dca28fa6.  One patch required an extra whack, all
looks good.


41 patches, based on f443e374ae131c168a065ea1748feac6b2e76613.

Subsystems affected by this patch series:

  procfs
  misc
  core-kernel
  lib
  checkpatch
  init
  pipe
  minix
  fat
  cgroups
  kexec
  kdump
  taskstats
  panic
  kcov
  resource
  ubsan

Subsystem: procfs

    Hao Lee <haolee.swjtu@gmail.com>:
      proc: alloc PATH_MAX bytes for /proc/${pid}/fd/ symlinks

    David Hildenbrand <david@redhat.com>:
      proc/vmcore: fix possible deadlock on concurrent mmap and read

    Yang Li <yang.lee@linux.alibaba.com>:
      proc/vmcore: fix vmcore_alloc_buf() kernel-doc comment

Subsystem: misc

    Bjorn Helgaas <bhelgaas@google.com>:
      linux/types.h: remove unnecessary __bitwise__
      Documentation/sparse: add hints about __CHECKER__

Subsystem: core-kernel

    Miaohe Lin <linmiaohe@huawei.com>:
      kernel/ksysfs.c: use helper macro __ATTR_RW

Subsystem: lib

    Kees Cook <keescook@chromium.org>:
      Kconfig.debug: make DEBUG_INFO selectable from a choice

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      include: drop pointless __compiler_offsetof indirection

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      ilog2: force inlining of __ilog2_u32() and __ilog2_u64()

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      bitfield: add explicit inclusions to the example

    Feng Tang <feng.tang@intel.com>:
      lib/Kconfig.debug: add ARCH dependency for FUNCTION_ALIGN option

    Randy Dunlap <rdunlap@infradead.org>:
      lib: bitmap: fix many kernel-doc warnings

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: prefer MODULE_LICENSE("GPL") over MODULE_LICENSE("GPL v2")
      checkpatch: add --fix option for some TRAILING_STATEMENTS
      checkpatch: add early_param exception to blank line after struct/function test

    Sagar Patel <sagarmp@cs.unc.edu>:
      checkpatch: use python3 to find codespell dictionary

Subsystem: init

    Mark-PK Tsai <mark-pk.tsai@mediatek.com>:
      init: use ktime_us_delta() to make initcall_debug log more precise

    Randy Dunlap <rdunlap@infradead.org>:
      init.h: improve __setup and early_param documentation
      init/main.c: return 1 from handled __setup() functions

Subsystem: pipe

    Andrei Vagin <avagin@gmail.com>:
      fs/pipe: use kvcalloc to allocate a pipe_buffer array
      fs/pipe.c: local vars have to match types of proper pipe_inode_info fields

Subsystem: minix

    Qinghua Jin <qhjin.dev@gmail.com>:
      minix: fix bug when opening a file with O_DIRECT

Subsystem: fat

    Helge Deller <deller@gmx.de>:
      fat: use pointer to simple type in put_user()

Subsystem: cgroups

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      cgroup: use irqsave in cgroup_rstat_flush_locked().
cgroup: add a comment to cgroup_rstat_flush_locked().

Subsystem: kexec

    Jisheng Zhang <jszhang@kernel.org>:
    Patch series "kexec: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef", v2:
      kexec: make crashk_res, crashk_low_res and crash_notes symbols always visible
      riscv: mm: init: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
      x86/setup: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
      arm64: mm: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef

Subsystem: kdump

    Tiezhu Yang <yangtiezhu@loongson.cn>:
    Patch series "Update doc and fix some issues about kdump", v2:
      docs: kdump: update description about sysfs file system support
      docs: kdump: add scp example to write out the dump file
      panic: unset panic_on_warn inside panic()
      ubsan: no need to unset panic_on_warn in ubsan_epilogue()
      kasan: no need to unset panic_on_warn in end_report()

Subsystem: taskstats

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      taskstats: remove unneeded dead assignment

Subsystem: panic

    "Guilherme G. Piccoli" <gpiccoli@igalia.com>:
    Patch series "Some improvements on panic_print":
      docs: sysctl/kernel: add missing bit to panic_print
      panic: add option to dump all CPUs backtraces in panic_print
      panic: move panic_print before kmsg dumpers

Subsystem: kcov

    Aleksandr Nogikh <nogikh@google.com>:
    Patch series "kcov: improve mmap processing", v3:
      kcov: split ioctl handling into locked and unlocked parts
      kcov: properly handle subsequent mmap calls

Subsystem: resource

    Miaohe Lin <linmiaohe@huawei.com>:
      kernel/resource: fix kfree() of bootmem memory again

Subsystem: ubsan

    Marco Elver <elver@google.com>:
      Revert "ubsan, kcsan: Don't combine sanitizer with kcov on clang"

 Documentation/admin-guide/kdump/kdump.rst       |   10 +
 Documentation/admin-guide/kernel-parameters.txt |    5 
 Documentation/admin-guide/sysctl/kernel.rst     |    2 
 Documentation/dev-tools/sparse.rst              |    2 
 arch/arm64/mm/init.c                            |    9 -
 arch/riscv/mm/init.c                            |    6 -
 arch/x86/kernel/setup.c                         |   10 -
 fs/fat/dir.c                                    |    2 
 fs/minix/inode.c                                |    3 
 fs/pipe.c                                       |   13 +-
 fs/proc/base.c                                  |    8 -
 fs/proc/vmcore.c                                |   43 +++----
 include/linux/bitfield.h                        |    3 
 include/linux/compiler_types.h                  |    3 
 include/linux/init.h                            |   11 +
 include/linux/kexec.h                           |   12 +-
 include/linux/log2.h                            |    4 
 include/linux/stddef.h                          |    6 -
 include/uapi/linux/types.h                      |    6 -
 init/main.c                                     |   14 +-
 kernel/cgroup/rstat.c                           |   13 +-
 kernel/kcov.c                                   |  102 ++++++++---------
 kernel/ksysfs.c                                 |    3 
 kernel/panic.c                                  |   37 ++++--
 kernel/resource.c                               |   41 +-----
 kernel/taskstats.c                              |    5 
 lib/Kconfig.debug                               |  142 ++++++++++++------------
 lib/Kconfig.kcsan                               |   11 -
 lib/Kconfig.ubsan                               |   12 --
 lib/bitmap.c                                    |   24 ++--
 lib/ubsan.c                                     |   10 -
 mm/kasan/report.c                               |   10 -
 scripts/checkpatch.pl                           |   31 ++++-
 tools/include/linux/types.h                     |    5 
 34 files changed, 313 insertions(+), 305 deletions(-)

incoming

[Andrew Morton]

- A few misc subsystems

- There is a lot of MM material in Willy's tree.  Folio work and
  non-folio patches which depended on that work.

  Here I send almost all the MM patches which precede the patches in
  Willy's tree.  The remaining ~100 MM patches are staged on Willy's
  tree and I'll send those along once Willy is merged up.

  I tried this batch against your current tree (as of
  51912904076680281) and a couple need some extra persuasion to apply,
  but all looks OK otherwise.


227 patches, based on f443e374ae131c168a065ea1748feac6b2e76613

Subsystems affected by this patch series:

  kthread
  scripts
  ntfs
  ocfs2
  block
  vfs
  mm/kasan
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mremap
  mm/sparsemem
  mm/vmalloc
  mm/pagealloc
  mm/memory-failure
  mm/mlock
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/mempolicy
  mm/oom-kill
  mm/migration
  mm/thp
  mm/cma
  mm/autonuma
  mm/psi
  mm/ksm
  mm/page-poison
  mm/madvise
  mm/memory-hotplug
  mm/rmap
  mm/zswap
  mm/uaccess
  mm/ioremap
  mm/highmem
  mm/cleanups
  mm/kfence
  mm/hmm
  mm/damon

Subsystem: kthread

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      linux/kthread.h: remove unused macros

Subsystem: scripts

    Colin Ian King <colin.i.king@gmail.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Dongliang Mu <mudongliangabcd@gmail.com>:
      ntfs: add sanity check on allocation size

Subsystem: ocfs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: cleanup some return variables

    hongnanli <hongnan.li@linux.alibaba.com>:
      fs/ocfs2: fix comments mentioning i_mutex

Subsystem: block

    NeilBrown <neilb@suse.de>:
    Patch series "Remove remaining parts of congestion tracking code", v2:
      doc: convert 'subsection' to 'section' in gfp.h
      mm: document and polish read-ahead code
      mm: improve cleanup when ->readpages doesn't process all pages
      fuse: remove reliance on bdi congestion
      nfs: remove reliance on bdi congestion
      ceph: remove reliance on bdi congestion
      remove inode_congested()
      remove bdi_congested() and wb_congested() and related functions
      f2fs: replace congestion_wait() calls with io_schedule_timeout()
      block/bfq-iosched.c: use "false" rather than "BLK_RW_ASYNC"
      remove congestion tracking framework

Subsystem: vfs

    Anthony Iliopoulos <ailiop@suse.com>:
      mount: warn only once about timestamp range expiration

Subsystem: mm/kasan

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memremap: avoid calling kasan_remove_zero_shadow() for device private memory

Subsystem: mm/pagecache

    Miaohe Lin <linmiaohe@huawei.com>:
      filemap: remove find_get_pages()
      mm/writeback: minor clean up for highmem_dirtyable_memory

    Minchan Kim <minchan@kernel.org>:
      mm: fs: fix lru_cache_disabled race in bh_lru

Subsystem: mm/gup

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/gup: some cleanups", v5:
      mm: fix invalid page pointer returned with FOLL_PIN gups

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: follow_pfn_pte(): -EEXIST cleanup
      mm/gup: remove unused pin_user_pages_locked()
      mm: change lookup_node() to use get_user_pages_fast()
      mm/gup: remove unused get_user_pages_locked()

Subsystem: mm/swap

    Bang Li <libang.linuxer@gmail.com>:
      mm/swap: fix confusing comment in folio_mark_accessed

Subsystem: mm/shmem

    Xavier Roche <xavier.roche@algolia.com>:
      tmpfs: support for file creation time

    Hugh Dickins <hughd@google.com>:
      shmem: mapping_set_exiting() to help mapped resilience
      tmpfs: do not allocate pages on read

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: shmem: use helper macro __ATTR_RW

Subsystem: mm/memcg

    Shakeel Butt <shakeelb@google.com>:
      memcg: replace in_interrupt() with !in_task()

    Yosry Ahmed <yosryahmed@google.com>:
      memcg: add per-memcg total kernel memory stat

    Wei Yang <richard.weiyang@gmail.com>:
      mm/memcg: mem_cgroup_per_node is already set to 0 on allocation
      mm/memcg: retrieve parent memcg from css.parent

    Shakeel Butt <shakeelb@google.com>:
    Patch series "memcg: robust enforcement of memory.high", v2:
      memcg: refactor mem_cgroup_oom
      memcg: unify force charging conditions
      selftests: memcg: test high limit for single entry allocation
      memcg: synchronously enforce memory.high for large overcharges

    Randy Dunlap <rdunlap@infradead.org>:
      mm/memcontrol: return 1 from cgroup.memory __setup() handler

    Michal Hocko <mhocko@suse.com>:
    Patch series "mm/memcg: Address PREEMPT_RT problems instead of disabling it", v5:
      mm/memcg: revert ("mm/memcg: optimize user context object stock access")

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/memcg: disable threshold event handlers on PREEMPT_RT
      mm/memcg: protect per-CPU counter by disabling preemption on PREEMPT_RT where needed.

    Johannes Weiner <hannes@cmpxchg.org>:
      mm/memcg: opencode the inner part of obj_cgroup_uncharge_pages() in drain_obj_stock()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm/memcg: protect memcg_stock with a local_lock_t
      mm/memcg: disable migration instead of preemption in drain_all_stock().

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Optimize list lru memory consumption", v6:
      mm: list_lru: transpose the array of per-node per-memcg lru lists
      mm: introduce kmem_cache_alloc_lru
      fs: introduce alloc_inode_sb() to allocate filesystems specific inode
      fs: allocate inode by using alloc_inode_sb()
      f2fs: allocate inode by using alloc_inode_sb()
      mm: dcache: use kmem_cache_alloc_lru() to allocate dentry
      xarray: use kmem_cache_alloc_lru to allocate xa_node
      mm: memcontrol: move memcg_online_kmem() to mem_cgroup_css_online()
      mm: list_lru: allocate list_lru_one only when needed
      mm: list_lru: rename memcg_drain_all_list_lrus to memcg_reparent_list_lrus
      mm: list_lru: replace linear array with xarray
      mm: memcontrol: reuse memory cgroup ID for kmem ID
      mm: memcontrol: fix cannot alloc the maximum memcg ID
      mm: list_lru: rename list_lru_per_memcg to list_lru_memcg
      mm: memcontrol: rename memcg_cache_id to memcg_kmem_id

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: enable accounting for tty-related objects

Subsystem: mm/selftests

    Guillaume Tucker <guillaume.tucker@collabora.com>:
      selftests, x86: fix how check_cc.sh is being invoked

Subsystem: mm/pagemap

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: merge pte_mkhuge() call into arch_make_huge_pte()

    Stafford Horne <shorne@gmail.com>:
      mm: remove mmu_gathers storage from remaining architectures

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Fix some cache flush bugs", v5:
      mm: thp: fix wrong cache flush in remove_migration_pmd()
      mm: fix missing cache flush for all tail pages of compound page
      mm: hugetlb: fix missing cache flush in copy_huge_page_from_user()
      mm: hugetlb: fix missing cache flush in hugetlb_mcopy_atomic_pte()
      mm: shmem: fix missing cache flush in shmem_mfill_atomic_pte()
      mm: userfaultfd: fix missing cache flush in mcopy_atomic_pte() and __mcopy_atomic()
      mm: replace multiple dcache flush with flush_dcache_folio()

    Peter Xu <peterx@redhat.com>:
    Patch series "mm: Rework zap ptes on swap entries", v5:
      mm: don't skip swap entry even if zap_details specified
      mm: rename zap_skip_check_mapping() to should_zap_page()
      mm: change zap_details.zap_mapping into even_cows
      mm: rework swap handling of zap_pte_range

    Randy Dunlap <rdunlap@infradead.org>:
      mm/mmap: return 1 from stack_guard_gap __setup() handler

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory.c: use helper function range_in_vma()
      mm/memory.c: use helper macro min and max in unmap_mapping_range_tree()

    Hugh Dickins <hughd@google.com>:
      mm: _install_special_mapping() apply VM_LOCKED_CLEAR_MASK

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mmap: remove obsolete comment in ksys_mmap_pgoff

Subsystem: mm/mremap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mremap:: use vma_lookup() instead of find_vma()

Subsystem: mm/sparsemem

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/sparse: make mminit_validate_memmodel_limits() static

Subsystem: mm/vmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmalloc: remove unneeded function forward declaration

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: Move draining areas out of caller context

    Uladzislau Rezki <uladzislau.rezki@sony.com>:
      mm/vmalloc: add adjust_search_size parameter

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: eliminate an extra orig_gfp_mask

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      mm/vmalloc.c: fix "unused function" warning

    Bang Li <libang.linuxer@gmail.com>:
      mm/vmalloc: fix comments about vmap_area struct

Subsystem: mm/pagealloc

    Zi Yan <ziy@nvidia.com>:
      mm: page_alloc: avoid merging non-fallbackable pageblocks with others

    Peter Collingbourne <pcc@google.com>:
      mm/mmzone.c: use try_cmpxchg() in page_cpupid_xchg_last()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mmzone.h: remove unused macros

    Nicolas Saenz Julienne <nsaenzju@redhat.com>:
      mm/page_alloc: don't pass pfn to free_unref_page_commit()

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: enforce pageblock_order < MAX_ORDER":
      cma: factor out minimum alignment requirement
      mm: enforce pageblock_order < MAX_ORDER

    Nathan Chancellor <nathan@kernel.org>:
      mm/page_alloc: mark pagesets as __maybe_unused

    Alistair Popple <apopple@nvidia.com>:
      mm/pages_alloc.c: don't create ZONE_MOVABLE beyond the end of a node

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Follow-up on high-order PCP caching", v2:
      mm/page_alloc: fetch the correct pcp buddy during bulk free
      mm/page_alloc: track range of active PCP lists during bulk free
      mm/page_alloc: simplify how many pages are selected per pcp list during bulk free
      mm/page_alloc: drain the requested list first during bulk free
      mm/page_alloc: free pages in a single pass during bulk free
      mm/page_alloc: limit number of high-order pages on PCP during bulk free
      mm/page_alloc: do not prefetch buddies during bulk free

    Oscar Salvador <osalvador@suse.de>:
      arch/x86/mm/numa: Do not initialize nodes twice

    Suren Baghdasaryan <surenb@google.com>:
      mm: count time in drain_all_pages during direct reclaim as memory pressure

    Eric Dumazet <edumazet@google.com>:
      mm/page_alloc: call check_new_pages() while zone spinlock is not held

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: check high-order pages for corruption during PCP operations

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/memory-failure.c: remove obsolete comment
      mm/hwpoison: fix error page recovered but reported "not recovered"

    Rik van Riel <riel@surriel.com>:
      mm: invalidate hwpoison page cache page in fault path

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "A few cleanup and fixup patches for memory failure", v3:
      mm/memory-failure.c: minor clean up for memory_failure_dev_pagemap
      mm/memory-failure.c: catch unexpected -EFAULT from vma_address()
      mm/memory-failure.c: rework the signaling logic in kill_proc
      mm/memory-failure.c: fix race with changing page more robustly
      mm/memory-failure.c: remove PageSlab check in hwpoison_filter_dev
      mm/memory-failure.c: rework the try_to_unmap logic in hwpoison_user_mappings()
      mm/memory-failure.c: remove obsolete comment in __soft_offline_page
      mm/memory-failure.c: remove unnecessary PageTransTail check
      mm/hwpoison-inject: support injecting hwpoison to free page

    luofei <luofei@unicloud.com>:
      mm/hwpoison: avoid the impact of hwpoison_filter() return value on mce handler
      mm/hwpoison: add in-use hugepage hwpoison filter judgement

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "A few fixup patches for memory failure", v2:
      mm/memory-failure.c: fix race with changing page compound again
      mm/memory-failure.c: avoid calling invalidate_inode_page() with unexpected pages
      mm/memory-failure.c: make non-LRU movable pages unhandlable

    Vlastimil Babka <vbabka@suse.cz>:
      mm, fault-injection: declare should_fail_alloc_page()

Subsystem: mm/mlock

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mlock: fix potential imbalanced rlimit ucounts adjustment

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Free the 2nd vmemmap page associated with each HugeTLB page", v7:
      mm: hugetlb: free the 2nd vmemmap page associated with each HugeTLB page
      mm: hugetlb: replace hugetlb_free_vmemmap_enabled with a static_key
      mm: sparsemem: use page table lock to protect kernel pmd operations
      selftests: vm: add a hugetlb test case
      mm: sparsemem: move vmemmap related to HugeTLB to CONFIG_HUGETLB_PAGE_FREE_VMEMMAP

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/hugetlb: generalize ARCH_WANT_GENERAL_HUGETLB

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: clean up potential spectre issue warnings

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: use helper macro __ATTR_RW

    David Howells <dhowells@redhat.com>:
      mm/hugetlb.c: export PageHeadHuge()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: remove unneeded local variable follflags

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
      userfaultfd: provide unmasked address on page-fault

    Guo Zhengkui <guozhengkui@vivo.com>:
      userfaultfd/selftests: fix uninitialized_var.cocci warning

Subsystem: mm/vmscan

    Hugh Dickins <hughd@google.com>:
      mm/fs: delete PF_SWAPWRITE
      mm: __isolate_lru_page_prepare() in isolate_migratepages_block()

    Waiman Long <longman@redhat.com>:
      mm/list_lru: optimize memcg_reparent_list_lru_node()

    Marcelo Tosatti <mtosatti@redhat.com>:
      mm: lru_cache_disable: replace work queue synchronization with synchronize_rcu

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: workingset: replace IRQ-off check with a lockdep assert.

    Charan Teja Kalla <quic_charante@quicinc.com>:
      mm: vmscan: fix documentation for page_check_references()

Subsystem: mm/compaction

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: compaction: cleanup the compaction trace events

Subsystem: mm/mempolicy

    Hugh Dickins <hughd@google.com>:
      mempolicy: mbind_range() set_policy() after vma_merge()

Subsystem: mm/oom-kill

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/oom_kill: remove unneeded is_memcg_oom check

Subsystem: mm/migration

    Huang Ying <ying.huang@intel.com>:
      mm,migrate: fix establishing demotion target

    "andrew.yang" <andrew.yang@mediatek.com>:
      mm/migrate: fix race between lock page and clear PG_Isolated

Subsystem: mm/thp

    Hugh Dickins <hughd@google.com>:
      mm/thp: refix __split_huge_pmd_locked() for migration PMD

Subsystem: mm/cma

    Hari Bathini <hbathini@linux.ibm.com>:
    Patch series "powerpc/fadump: handle CMA activation failure appropriately", v3:
      mm/cma: provide option to opt out from exposing pages on activation failure
      powerpc/fadump: opt out from freeing pages on cma activation failure

Subsystem: mm/autonuma

    Huang Ying <ying.huang@intel.com>:
    Patch series "NUMA balancing: optimize memory placement for memory tiering system", v13:
      NUMA Balancing: add page promotion counter
      NUMA balancing: optimize page placement for memory tiering system
      memory tiering: skip to scan fast memory

Subsystem: mm/psi

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page_io: fix psi memory pressure error on cold swapins

Subsystem: mm/ksm

    Yang Yang <yang.yang29@zte.com.cn>:
      mm/vmstat: add event for ksm swapping in copy

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/ksm: use helper macro __ATTR_RW

Subsystem: mm/page-poison

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/hwpoison: check the subpage, not the head page

Subsystem: mm/madvise

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/madvise: use vma_lookup() instead of find_vma()

    Charan Teja Kalla <quic_charante@quicinc.com>:
    Patch series "mm: madvise: return correct bytes processed with:
      mm: madvise: return correct bytes advised with process_madvise
      mm: madvise: skip unmapped vma holes passed to process_madvise

Subsystem: mm/memory-hotplug

    Michal Hocko <mhocko@suse.com>:
    Patch series "mm, memory_hotplug: handle unitialized numa node gracefully":
      mm, memory_hotplug: make arch_alloc_nodedata independent on CONFIG_MEMORY_HOTPLUG
      mm: handle uninitialized numa nodes gracefully
      mm, memory_hotplug: drop arch_free_nodedata
      mm, memory_hotplug: reorganize new pgdat initialization
      mm: make free_area_init_node aware of memory less nodes

    Wei Yang <richard.weiyang@gmail.com>:
      memcg: do not tweak node in alloc_mem_cgroup_per_node_info

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: add memory block to memory group after registration succeeded
      drivers/base/node: consolidate node device subsystem initialization in node_dev_init()

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "A few cleanup patches around memory_hotplug":
      mm/memory_hotplug: remove obsolete comment of __add_pages
      mm/memory_hotplug: avoid calling zone_intersects() for ZONE_NORMAL
      mm/memory_hotplug: clean up try_offline_node
      mm/memory_hotplug: fix misplaced comment in offline_pages

    David Hildenbrand <david@redhat.com>:
    Patch series "drivers/base/memory: determine and store zone for single-zone memory blocks", v2:
      drivers/base/node: rename link_mem_sections() to register_memory_block_under_node()
      drivers/base/memory: determine and store zone for single-zone memory blocks
      drivers/base/memory: clarify adding and removing of memory blocks

    Oscar Salvador <osalvador@suse.de>:
      mm: only re-generate demotion targets when a numa node changes its N_CPU state

Subsystem: mm/rmap

    Hugh Dickins <hughd@google.com>:
      mm/thp: ClearPageDoubleMap in first page_add_file_rmap()

Subsystem: mm/zswap

    "Maciej S. Szmigiero" <maciej.szmigiero@oracle.com>:
      mm/zswap.c: allow handling just same-value filled pages

Subsystem: mm/uaccess

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: remove usercopy_warn()
      mm: uninline copy_overflow()

    Randy Dunlap <rdunlap@infradead.org>:
      mm/usercopy: return 1 from hardened_usercopy __setup() handler

Subsystem: mm/ioremap

    Vlastimil Babka <vbabka@suse.cz>:
      mm/early_ioremap: declare early_memremap_pgprot_adjust()

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
      highmem: document kunmap_local()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/highmem: remove unnecessary done label

Subsystem: mm/cleanups

    "Dr. David Alan Gilbert" <linux@treblig.org>:
      mm/page_table_check.c: use strtobool for param parsing

Subsystem: mm/kfence

    tangmeng <tangmeng@uniontech.com>:
      mm/kfence: remove unnecessary CONFIG_KFENCE option

    Tianchen Ding <dtcccc@linux.alibaba.com>:
    Patch series "provide the flexibility to enable KFENCE", v3:
      kfence: allow re-enabling KFENCE after system startup
      kfence: alloc kfence_pool after system startup

    Peng Liu <liupeng256@huawei.com>:
    Patch series "kunit: fix a UAF bug and do some optimization", v2:
      kunit: fix UAF when run kfence test case test_gfpzero
      kunit: make kunit_test_timeout compatible with comment
      kfence: test: try to avoid test_gfpzero trigger rcu_stall

    Marco Elver <elver@google.com>:
      kfence: allow use of a deferrable timer

Subsystem: mm/hmm

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hmm.c: remove unneeded local variable ret

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
    Patch series "Remove the type-unclear target id concept":
      mm/damon/dbgfs/init_regions: use target index instead of target id
      Docs/admin-guide/mm/damon/usage: update for changed initail_regions file input
      mm/damon/core: move damon_set_targets() into dbgfs
      mm/damon: remove the target id concept

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/damon: remove redundant page validation

    SeongJae Park <sj@kernel.org>:
    Patch series "Allow DAMON user code independent of monitoring primitives":
      mm/damon: rename damon_primitives to damon_operations
      mm/damon: let monitoring operations can be registered and selected
      mm/damon/paddr,vaddr: register themselves to DAMON in subsys_initcall
      mm/damon/reclaim: use damon_select_ops() instead of damon_{v,p}a_set_operations()
      mm/damon/dbgfs: use damon_select_ops() instead of damon_{v,p}a_set_operations()
      mm/damon/dbgfs: use operations id for knowing if the target has pid
      mm/damon/dbgfs-test: fix is_target_id() change
      mm/damon/paddr,vaddr: remove damon_{p,v}a_{target_valid,set_operations}()

    tangmeng <tangmeng@uniontech.com>:
      mm/damon: remove unnecessary CONFIG_DAMON option

    SeongJae Park <sj@kernel.org>:
    Patch series "Docs/damon: Update documents for better consistency":
      Docs/vm/damon: call low level monitoring primitives the operations
      Docs/vm/damon/design: update DAMON-Idle Page Tracking interference handling
      Docs/damon: update outdated term 'regions update interval'
    Patch series "Introduce DAMON sysfs interface", v3:
      mm/damon/core: allow non-exclusive DAMON start/stop
      mm/damon/core: add number of each enum type values
      mm/damon: implement a minimal stub for sysfs-based DAMON interface
      mm/damon/sysfs: link DAMON for virtual address spaces monitoring
      mm/damon/sysfs: support the physical address space monitoring
      mm/damon/sysfs: support DAMON-based Operation Schemes
      mm/damon/sysfs: support DAMOS quotas
      mm/damon/sysfs: support schemes prioritization
      mm/damon/sysfs: support DAMOS watermarks
      mm/damon/sysfs: support DAMOS stats
      selftests/damon: add a test for DAMON sysfs interface
      Docs/admin-guide/mm/damon/usage: document DAMON sysfs interface
      Docs/ABI/testing: add DAMON sysfs interface ABI document

    Xin Hao <xhao@linux.alibaba.com>:
      mm/damon/sysfs: remove repeat container_of() in damon_sysfs_kdamond_release()

 Documentation/ABI/testing/sysfs-kernel-mm-damon  |  274 ++
 Documentation/admin-guide/cgroup-v1/memory.rst   |    2 
 Documentation/admin-guide/cgroup-v2.rst          |    5 
 Documentation/admin-guide/kernel-parameters.txt  |    2 
 Documentation/admin-guide/mm/damon/usage.rst     |  380 +++
 Documentation/admin-guide/mm/zswap.rst           |   22 
 Documentation/admin-guide/sysctl/kernel.rst      |   31 
 Documentation/core-api/mm-api.rst                |   19 
 Documentation/dev-tools/kfence.rst               |   12 
 Documentation/filesystems/porting.rst            |    6 
 Documentation/filesystems/vfs.rst                |   16 
 Documentation/vm/damon/design.rst                |   43 
 Documentation/vm/damon/faq.rst                   |    2 
 MAINTAINERS                                      |    1 
 arch/arm/Kconfig                                 |    4 
 arch/arm64/kernel/setup.c                        |    3 
 arch/arm64/mm/hugetlbpage.c                      |    1 
 arch/hexagon/mm/init.c                           |    2 
 arch/ia64/kernel/topology.c                      |   10 
 arch/ia64/mm/discontig.c                         |   11 
 arch/mips/kernel/topology.c                      |    5 
 arch/nds32/mm/init.c                             |    1 
 arch/openrisc/mm/init.c                          |    2 
 arch/powerpc/include/asm/fadump-internal.h       |    5 
 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h |    4 
 arch/powerpc/kernel/fadump.c                     |    8 
 arch/powerpc/kernel/sysfs.c                      |   17 
 arch/riscv/Kconfig                               |    4 
 arch/riscv/kernel/setup.c                        |    3 
 arch/s390/kernel/numa.c                          |    7 
 arch/sh/kernel/topology.c                        |    5 
 arch/sparc/kernel/sysfs.c                        |   12 
 arch/sparc/mm/hugetlbpage.c                      |    1 
 arch/x86/Kconfig                                 |    4 
 arch/x86/kernel/cpu/mce/core.c                   |    8 
 arch/x86/kernel/topology.c                       |    5 
 arch/x86/mm/numa.c                               |   33 
 block/bdev.c                                     |    2 
 block/bfq-iosched.c                              |    2 
 drivers/base/init.c                              |    1 
 drivers/base/memory.c                            |  149 +
 drivers/base/node.c                              |   48 
 drivers/block/drbd/drbd_int.h                    |    3 
 drivers/block/drbd/drbd_req.c                    |    3 
 drivers/dax/super.c                              |    2 
 drivers/of/of_reserved_mem.c                     |    9 
 drivers/tty/tty_io.c                             |    2 
 drivers/virtio/virtio_mem.c                      |    9 
 fs/9p/vfs_inode.c                                |    2 
 fs/adfs/super.c                                  |    2 
 fs/affs/super.c                                  |    2 
 fs/afs/super.c                                   |    2 
 fs/befs/linuxvfs.c                               |    2 
 fs/bfs/inode.c                                   |    2 
 fs/btrfs/inode.c                                 |    2 
 fs/buffer.c                                      |    8 
 fs/ceph/addr.c                                   |   22 
 fs/ceph/inode.c                                  |    2 
 fs/ceph/super.c                                  |    1 
 fs/ceph/super.h                                  |    1 
 fs/cifs/cifsfs.c                                 |    2 
 fs/coda/inode.c                                  |    2 
 fs/dcache.c                                      |    3 
 fs/ecryptfs/super.c                              |    2 
 fs/efs/super.c                                   |    2 
 fs/erofs/super.c                                 |    2 
 fs/exfat/super.c                                 |    2 
 fs/ext2/ialloc.c                                 |    5 
 fs/ext2/super.c                                  |    2 
 fs/ext4/super.c                                  |    2 
 fs/f2fs/compress.c                               |    4 
 fs/f2fs/data.c                                   |    3 
 fs/f2fs/f2fs.h                                   |    6 
 fs/f2fs/segment.c                                |    8 
 fs/f2fs/super.c                                  |   14 
 fs/fat/inode.c                                   |    2 
 fs/freevxfs/vxfs_super.c                         |    2 
 fs/fs-writeback.c                                |   40 
 fs/fuse/control.c                                |   17 
 fs/fuse/dev.c                                    |    8 
 fs/fuse/file.c                                   |   17 
 fs/fuse/inode.c                                  |    2 
 fs/gfs2/super.c                                  |    2 
 fs/hfs/super.c                                   |    2 
 fs/hfsplus/super.c                               |    2 
 fs/hostfs/hostfs_kern.c                          |    2 
 fs/hpfs/super.c                                  |    2 
 fs/hugetlbfs/inode.c                             |    2 
 fs/inode.c                                       |    2 
 fs/isofs/inode.c                                 |    2 
 fs/jffs2/super.c                                 |    2 
 fs/jfs/super.c                                   |    2 
 fs/minix/inode.c                                 |    2 
 fs/namespace.c                                   |    2 
 fs/nfs/inode.c                                   |    2 
 fs/nfs/write.c                                   |   14 
 fs/nilfs2/segbuf.c                               |   16 
 fs/nilfs2/super.c                                |    2 
 fs/ntfs/inode.c                                  |    6 
 fs/ntfs3/super.c                                 |    2 
 fs/ocfs2/alloc.c                                 |    2 
 fs/ocfs2/aops.c                                  |    2 
 fs/ocfs2/cluster/nodemanager.c                   |    2 
 fs/ocfs2/dir.c                                   |    4 
 fs/ocfs2/dlmfs/dlmfs.c                           |    2 
 fs/ocfs2/file.c                                  |   13 
 fs/ocfs2/inode.c                                 |    2 
 fs/ocfs2/localalloc.c                            |    6 
 fs/ocfs2/namei.c                                 |    2 
 fs/ocfs2/ocfs2.h                                 |    4 
 fs/ocfs2/quota_global.c                          |    2 
 fs/ocfs2/stack_user.c                            |   18 
 fs/ocfs2/super.c                                 |    2 
 fs/ocfs2/xattr.c                                 |    2 
 fs/openpromfs/inode.c                            |    2 
 fs/orangefs/super.c                              |    2 
 fs/overlayfs/super.c                             |    2 
 fs/proc/inode.c                                  |    2 
 fs/qnx4/inode.c                                  |    2 
 fs/qnx6/inode.c                                  |    2 
 fs/reiserfs/super.c                              |    2 
 fs/romfs/super.c                                 |    2 
 fs/squashfs/super.c                              |    2 
 fs/sysv/inode.c                                  |    2 
 fs/ubifs/super.c                                 |    2 
 fs/udf/super.c                                   |    2 
 fs/ufs/super.c                                   |    2 
 fs/userfaultfd.c                                 |    5 
 fs/vboxsf/super.c                                |    2 
 fs/xfs/libxfs/xfs_btree.c                        |    2 
 fs/xfs/xfs_buf.c                                 |    3 
 fs/xfs/xfs_icache.c                              |    2 
 fs/zonefs/super.c                                |    2 
 include/linux/backing-dev-defs.h                 |    8 
 include/linux/backing-dev.h                      |   50 
 include/linux/cma.h                              |   14 
 include/linux/damon.h                            |   95 
 include/linux/fault-inject.h                     |    2 
 include/linux/fs.h                               |   21 
 include/linux/gfp.h                              |   10 
 include/linux/highmem-internal.h                 |   10 
 include/linux/hugetlb.h                          |    8 
 include/linux/kthread.h                          |   22 
 include/linux/list_lru.h                         |   45 
 include/linux/memcontrol.h                       |   46 
 include/linux/memory.h                           |   12 
 include/linux/memory_hotplug.h                   |  132 -
 include/linux/migrate.h                          |    8 
 include/linux/mm.h                               |   11 
 include/linux/mmzone.h                           |   22 
 include/linux/nfs_fs_sb.h                        |    1 
 include/linux/node.h                             |   25 
 include/linux/page-flags.h                       |   96 
 include/linux/pageblock-flags.h                  |    7 
 include/linux/pagemap.h                          |    7 
 include/linux/sched.h                            |    1 
 include/linux/sched/sysctl.h                     |   10 
 include/linux/shmem_fs.h                         |    1 
 include/linux/slab.h                             |    3 
 include/linux/swap.h                             |    6 
 include/linux/thread_info.h                      |    5 
 include/linux/uaccess.h                          |    2 
 include/linux/vm_event_item.h                    |    3 
 include/linux/vmalloc.h                          |    4 
 include/linux/xarray.h                           |    9 
 include/ras/ras_event.h                          |    1 
 include/trace/events/compaction.h                |   26 
 include/trace/events/writeback.h                 |   28 
 include/uapi/linux/userfaultfd.h                 |    8 
 ipc/mqueue.c                                     |    2 
 kernel/dma/contiguous.c                          |    4 
 kernel/sched/core.c                              |   21 
 kernel/sysctl.c                                  |    2 
 lib/Kconfig.kfence                               |   12 
 lib/kunit/try-catch.c                            |    3 
 lib/xarray.c                                     |   10 
 mm/Kconfig                                       |    6 
 mm/backing-dev.c                                 |   57 
 mm/cma.c                                         |   31 
 mm/cma.h                                         |    1 
 mm/compaction.c                                  |   60 
 mm/damon/Kconfig                                 |   19 
 mm/damon/Makefile                                |    7 
 mm/damon/core-test.h                             |   23 
 mm/damon/core.c                                  |  190 +
 mm/damon/dbgfs-test.h                            |  103 
 mm/damon/dbgfs.c                                 |  264 +-
 mm/damon/ops-common.c                            |  133 +
 mm/damon/ops-common.h                            |   16 
 mm/damon/paddr.c                                 |   62 
 mm/damon/prmtv-common.c                          |  133 -
 mm/damon/prmtv-common.h                          |   16 
 mm/damon/reclaim.c                               |   11 
 mm/damon/sysfs.c                                 | 2632 ++++++++++++++++++++++-
 mm/damon/vaddr-test.h                            |    8 
 mm/damon/vaddr.c                                 |   67 
 mm/early_ioremap.c                               |    1 
 mm/fadvise.c                                     |    5 
 mm/filemap.c                                     |   17 
 mm/gup.c                                         |  103 
 mm/highmem.c                                     |    9 
 mm/hmm.c                                         |    3 
 mm/huge_memory.c                                 |   41 
 mm/hugetlb.c                                     |   23 
 mm/hugetlb_vmemmap.c                             |   74 
 mm/hwpoison-inject.c                             |    7 
 mm/internal.h                                    |   19 
 mm/kfence/Makefile                               |    2 
 mm/kfence/core.c                                 |  147 +
 mm/kfence/kfence_test.c                          |    3 
 mm/ksm.c                                         |    6 
 mm/list_lru.c                                    |  690 ++----
 mm/maccess.c                                     |    6 
 mm/madvise.c                                     |   18 
 mm/memcontrol.c                                  |  549 ++--
 mm/memory-failure.c                              |  148 -
 mm/memory.c                                      |  116 -
 mm/memory_hotplug.c                              |  136 -
 mm/mempolicy.c                                   |   29 
 mm/memremap.c                                    |    3 
 mm/migrate.c                                     |  128 -
 mm/mlock.c                                       |    1 
 mm/mmap.c                                        |    5 
 mm/mmzone.c                                      |    7 
 mm/mprotect.c                                    |   13 
 mm/mremap.c                                      |    4 
 mm/oom_kill.c                                    |    3 
 mm/page-writeback.c                              |   12 
 mm/page_alloc.c                                  |  429 +--
 mm/page_io.c                                     |    7 
 mm/page_table_check.c                            |   10 
 mm/ptdump.c                                      |   16 
 mm/readahead.c                                   |  124 +
 mm/rmap.c                                        |   15 
 mm/shmem.c                                       |   46 
 mm/slab.c                                        |   39 
 mm/slab.h                                        |   25 
 mm/slob.c                                        |    6 
 mm/slub.c                                        |   42 
 mm/sparse-vmemmap.c                              |   70 
 mm/sparse.c                                      |    2 
 mm/swap.c                                        |   25 
 mm/swapfile.c                                    |    1 
 mm/usercopy.c                                    |   16 
 mm/userfaultfd.c                                 |    3 
 mm/vmalloc.c                                     |  102 
 mm/vmscan.c                                      |  138 -
 mm/vmstat.c                                      |   19 
 mm/workingset.c                                  |    7 
 mm/zswap.c                                       |   15 
 net/socket.c                                     |    2 
 net/sunrpc/rpc_pipe.c                            |    2 
 scripts/spelling.txt                             |   16 
 tools/testing/selftests/cgroup/cgroup_util.c     |   15 
 tools/testing/selftests/cgroup/cgroup_util.h     |    1 
 tools/testing/selftests/cgroup/test_memcontrol.c |   78 
 tools/testing/selftests/damon/Makefile           |    1 
 tools/testing/selftests/damon/sysfs.sh           |  306 ++
 tools/testing/selftests/vm/.gitignore            |    1 
 tools/testing/selftests/vm/Makefile              |    7 
 tools/testing/selftests/vm/hugepage-vmemmap.c    |  144 +
 tools/testing/selftests/vm/run_vmtests.sh        |   11 
 tools/testing/selftests/vm/userfaultfd.c         |    2 
 tools/testing/selftests/x86/Makefile             |    6 
 264 files changed, 7205 insertions(+), 3090 deletions(-)

incoming

[Andrew Morton]

4 patches, based on 56e337f2cf1326323844927a04e9dbce9a244835.

Subsystems affected by this patch series:

  mm/swap
  kconfig
  ocfs2
  selftests

Subsystem: mm/swap

    Guo Ziliang <guo.ziliang@zte.com.cn>:
      mm: swap: get rid of deadloop in swapin readahead

Subsystem: kconfig

    Qian Cai <quic_qiancai@quicinc.com>:
      configs/debug: restore DEBUG_INFO=y for overriding

Subsystem: ocfs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: fix crash when initialize filecheck kobj fails

Subsystem: selftests

    Yosry Ahmed <yosryahmed@google.com>:
      selftests: vm: fix clang build error multiple output files

 fs/ocfs2/super.c                    |   22 +++++++++++-----------
 kernel/configs/debug.config         |    1 +
 mm/swap_state.c                     |    2 +-
 tools/testing/selftests/vm/Makefile |    6 ++----
 4 files changed, 15 insertions(+), 16 deletions(-)

incoming

[Andrew Morton]

8 patches, based on 07ebd38a0da24d2534da57b4841346379db9f354.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/pagemap
  memfd
  selftests
  mm/userfaultfd
  kconfig

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      selftests/vm: cleanup hugetlb file after mremap test

Subsystem: mm/pagemap

    Suren Baghdasaryan <surenb@google.com>:
      mm: refactor vm_area_struct::anon_vma_name usage code
      mm: prevent vm_area_struct::anon_name refcount saturation
      mm: fix use-after-free when anon vma name is used after vma is freed

Subsystem: memfd

    Hugh Dickins <hughd@google.com>:
      memfd: fix F_SEAL_WRITE after shmem huge page allocated

Subsystem: selftests

    Chengming Zhou <zhouchengming@bytedance.com>:
      kselftest/vm: fix tests build with old libc

Subsystem: mm/userfaultfd

    Yun Zhou <yun.zhou@windriver.com>:
      proc: fix documentation and description of pagemap

Subsystem: kconfig

    Qian Cai <quic_qiancai@quicinc.com>:
      configs/debug: set CONFIG_DEBUG_INFO=y properly

 Documentation/admin-guide/mm/pagemap.rst     |    2 
 fs/proc/task_mmu.c                           |    9 +-
 fs/userfaultfd.c                             |    6 -
 include/linux/mm.h                           |    7 +
 include/linux/mm_inline.h                    |  105 ++++++++++++++++++---------
 include/linux/mm_types.h                     |    5 +
 kernel/configs/debug.config                  |    2 
 kernel/fork.c                                |    4 -
 kernel/sys.c                                 |   19 +++-
 mm/madvise.c                                 |   98 +++++++++----------------
 mm/memfd.c                                   |   40 +++++++---
 mm/mempolicy.c                               |    2 
 mm/mlock.c                                   |    2 
 mm/mmap.c                                    |   12 +--
 mm/mprotect.c                                |    2 
 tools/testing/selftests/vm/hugepage-mremap.c |   26 ++++--
 tools/testing/selftests/vm/run_vmtests.sh    |    3 
 tools/testing/selftests/vm/userfaultfd.c     |    1 
 18 files changed, 201 insertions(+), 144 deletions(-)

incoming

[Andrew Morton]

12 patches, based on c47658311d60be064b839f329c0e4d34f5f0735b.

Subsystems affected by this patch series:

  MAINTAINERS
  mm/hugetlb
  mm/kasan
  mm/hugetlbfs
  mm/pagemap
  mm/selftests
  mm/memcg
  m/slab
  mailmap
  memfd

Subsystem: MAINTAINERS

    Luis Chamberlain <mcgrof@kernel.org>:
      MAINTAINERS: add sysctl-next git tree

Subsystem: mm/hugetlb

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/hugetlb: fix kernel crash with hugetlb mremap

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: test: prevent cache merging in kmem_cache_double_destroy

Subsystem: mm/hugetlbfs

    Liu Yuntao <liuyuntao10@huawei.com>:
      hugetlbfs: fix a truncation issue in hugepages parameter

Subsystem: mm/pagemap

    Suren Baghdasaryan <surenb@google.com>:
      mm: fix use-after-free bug when mm->mmap is reused after being freed

Subsystem: mm/selftests

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      selftest/vm: fix map_fixed_noreplace test failure

Subsystem: mm/memcg

    Roman Gushchin <roman.gushchin@linux.dev>:
      MAINTAINERS: add Roman as a memcg co-maintainer

    Vladimir Davydov <vdavydov.dev@gmail.com>:
      MAINTAINERS: remove Vladimir from memcg maintainers

    Shakeel Butt <shakeelb@google.com>:
      MAINTAINERS: add Shakeel as a memcg co-maintainer

Subsystem: m/slab

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS, SLAB: add Roman as reviewer, git tree

Subsystem: mailmap

    Roman Gushchin <roman.gushchin@linux.dev>:
      mailmap: update Roman Gushchin's email

Subsystem: memfd

    Mike Kravetz <mike.kravetz@oracle.com>:
      selftests/memfd: clean up mapping in mfd_fail_write

 .mailmap                                         |    3 +
 MAINTAINERS                                      |    6 ++
 lib/test_kasan.c                                 |    5 +-
 mm/hugetlb.c                                     |   11 ++---
 mm/mmap.c                                        |    1 
 tools/testing/selftests/memfd/memfd_test.c       |    1 
 tools/testing/selftests/vm/map_fixed_noreplace.c |   49 +++++++++++++++++------
 7 files changed, 56 insertions(+), 20 deletions(-)

Re: incoming

[Andrew Morton]

On Fri, 11 Feb 2022 18:02:53 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
> 
> So this *completely* flummoxed 'b4', because you first sent the wrong
> series, and then sent the right one in the same thread.
> 
> I fetched the emails  manually, but honestly, this was confusing even
> then, with two "[PATCH x/5]" series where the only way to tell the
> right one was basically by date of email. They did arrive in the same
> order in my mailbox, but even that wouldn't have been guaranteed if
> there had been some mailer delays somewhere..

Yes, I wondered.  Sorry bout that.

> So next time when you mess up, resend it all as a completely new
> series and completely new threading - so with a new header email too.
> Please?

Wilco.

> And since I'm here, let me just verify that yes, the series you
> actually want me to apply is this one (as described by the head
> email):
> 
>   Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
>   Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
>   Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
>   Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
>   Subject: [patch 5/5] kfence: make test case compatible with run..
> 
> and not the other one with GUP patches?

Those are the ones.  Five fixes, three with cc:stable.

Re: incoming

[Linus Torvalds]

On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.

So this *completely* flummoxed 'b4', because you first sent the wrong
series, and then sent the right one in the same thread.

I fetched the emails  manually, but honestly, this was confusing even
then, with two "[PATCH x/5]" series where the only way to tell the
right one was basically by date of email. They did arrive in the same
order in my mailbox, but even that wouldn't have been guaranteed if
there had been some mailer delays somewhere..

So next time when you mess up, resend it all as a completely new
series and completely new threading - so with a new header email too.
Please?

And since I'm here, let me just verify that yes, the series you
actually want me to apply is this one (as described by the head
email):

  Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
  Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
  Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
  Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
  Subject: [patch 5/5] kfence: make test case compatible with run..

and not the other one with GUP patches?

             Linus

incoming

[Andrew Morton]

5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.

Subsystems affected by this patch series:

  binfmt
  procfs
  mm/vmscan
  mm/memcg
  mm/kfence

Subsystem: binfmt

    Mike Rapoport <rppt@linux.ibm.com>:
      fs/binfmt_elf: fix PT_LOAD p_align values for loaders

Subsystem: procfs

    Yang Shi <shy828301@gmail.com>:
      fs/proc: task_mmu.c: don't read mapcount for migration entry

Subsystem: mm/vmscan

    Mel Gorman <mgorman@suse.de>:
      mm: vmscan: remove deadlock due to throttling failing to make progress

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg: synchronize objcg lists with a dedicated spinlock

Subsystem: mm/kfence

    Peng Liu <liupeng256@huawei.com>:
      kfence: make test case compatible with run time set sample interval

 fs/binfmt_elf.c            |    2 +-
 fs/proc/task_mmu.c         |   40 +++++++++++++++++++++++++++++++---------
 include/linux/kfence.h     |    2 ++
 include/linux/memcontrol.h |    5 +++--
 mm/kfence/core.c           |    3 ++-
 mm/kfence/kfence_test.c    |    8 ++++----
 mm/memcontrol.c            |   10 +++++-----
 mm/vmscan.c                |    4 +++-
 8 files changed, 51 insertions(+), 23 deletions(-)

incoming

[Andrew Morton]

10 patches, based on 1f2cfdd349b7647f438c1e552dc1b983da86d830.

Subsystems affected by this patch series:

  mm/vmscan
  mm/debug
  mm/pagemap
  ipc
  mm/kmemleak
  MAINTAINERS
  mm/selftests

Subsystem: mm/vmscan

    Chen Wandun <chenwandun@huawei.com>:
      Revert "mm/page_isolation: unset migratetype directly for non Buddy page"

Subsystem: mm/debug

    Pasha Tatashin <pasha.tatashin@soleen.com>:
    Patch series "page table check fixes and cleanups", v5:
      mm/debug_vm_pgtable: remove pte entry from the page table
      mm/page_table_check: use unsigned long for page counters and cleanup
      mm/khugepaged: unify collapse pmd clear, flush and free
      mm/page_table_check: check entries at pmd levels

Subsystem: mm/pagemap

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/pgtable: define pte_index so that preprocessor could recognize it

Subsystem: ipc

    Minghao Chi <chi.minghao@zte.com.cn>:
      ipc/sem: do not sleep with a spin lock held

Subsystem: mm/kmemleak

    Lang Yu <lang.yu@amd.com>:
      mm/kmemleak: avoid scanning potential huge holes

Subsystem: MAINTAINERS

    Mike Rapoport <rppt@linux.ibm.com>:
      MAINTAINERS: update rppt's email

Subsystem: mm/selftests

    Shuah Khan <skhan@linuxfoundation.org>:
      kselftest/vm: revert "tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner"

 MAINTAINERS                              |    2 -
 include/linux/page_table_check.h         |   19 ++++++++++
 include/linux/pgtable.h                  |    1 
 ipc/sem.c                                |    4 +-
 mm/debug_vm_pgtable.c                    |    2 +
 mm/khugepaged.c                          |   37 +++++++++++---------
 mm/kmemleak.c                            |   13 +++----
 mm/page_isolation.c                      |    2 -
 mm/page_table_check.c                    |   55 +++++++++++++++----------------
 tools/testing/selftests/vm/userfaultfd.c |   11 ++++--
 10 files changed, 89 insertions(+), 57 deletions(-)

incoming

[Andrew Morton]

12 patches, based on f8c7e4ede46fe63ff10000669652648aab09d112.

Subsystems affected by this patch series:

  sysctl
  binfmt
  ia64
  mm/memory-failure
  mm/folios
  selftests
  mm/kasan
  mm/psi
  ocfs2

Subsystem: sysctl

    Andrew Morton <akpm@linux-foundation.org>:
      include/linux/sysctl.h: fix register_sysctl_mount_point() return type

Subsystem: binfmt

    Tong Zhang <ztong0001@gmail.com>:
      binfmt_misc: fix crash when load/unload module

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: make IA64_MCA_RECOVERY bool instead of tristate

Subsystem: mm/memory-failure

    Joao Martins <joao.m.martins@oracle.com>:
      memory-failure: fetch compound_head after pgmap_pfn_valid()

Subsystem: mm/folios

    Wei Yang <richard.weiyang@gmail.com>:
      mm: page->mapping folio->mapping should have the same offset

Subsystem: selftests

    Maor Gottlieb <maorg@nvidia.com>:
      tools/testing/scatterlist: add missing defines

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: test: fix compatibility with FORTIFY_SOURCE

    Peter Collingbourne <pcc@google.com>:
      mm, kasan: use compare-exchange operation to set KASAN page tag

Subsystem: mm/psi

    Suren Baghdasaryan <surenb@google.com>:
      psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
      psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n

Subsystem: ocfs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
    Patch series "ocfs2: fix a deadlock case":
      jbd2: export jbd2_journal_[grab|put]_journal_head
      ocfs2: fix a deadlock when commit trans

 arch/ia64/Kconfig                    |    2 
 fs/binfmt_misc.c                     |    8 +--
 fs/jbd2/journal.c                    |    2 
 fs/ocfs2/suballoc.c                  |   25 ++++-------
 include/linux/mm.h                   |   17 +++++--
 include/linux/mm_types.h             |    1 
 include/linux/psi.h                  |   11 ++--
 include/linux/sysctl.h               |    2 
 kernel/sched/psi.c                   |   79 ++++++++++++++++++-----------------
 lib/test_kasan.c                     |    5 ++
 mm/memory-failure.c                  |    6 ++
 tools/testing/scatterlist/linux/mm.h |    3 -
 12 files changed, 91 insertions(+), 70 deletions(-)

Re: incoming

[Andrew Morton]

On Sat, 29 Jan 2022 04:25:33 +0000 Matthew Wilcox <willy@infradead.org> wrote:

> On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
>   ^^
> 
> I see 7?

Crap, sorry, ignore all this, shall redo tomorrow.

(It wasn't a good day over here.  The thing with disk drives is that
the bigger they are, the harder they fall).

Re: incoming

[Matthew Wilcox]

On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
  ^^

I see 7?

incoming

[Andrew Morton]

12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.

Subsystems affected by this patch series:

  sysctl
  binfmt
  ia64
  mm/memory-failure
  mm/folios
  selftests
  mm/kasan
  mm/psi
  ocfs2

Subsystem: sysctl

    Andrew Morton <akpm@linux-foundation.org>:
      include/linux/sysctl.h: fix register_sysctl_mount_point() return type

Subsystem: binfmt

    Tong Zhang <ztong0001@gmail.com>:
      binfmt_misc: fix crash when load/unload module

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: make IA64_MCA_RECOVERY bool instead of tristate

Subsystem: mm/memory-failure

    Joao Martins <joao.m.martins@oracle.com>:
      memory-failure: fetch compound_head after pgmap_pfn_valid()

Subsystem: mm/folios

    Wei Yang <richard.weiyang@gmail.com>:
      mm: page->mapping folio->mapping should have the same offset

Subsystem: selftests

    Maor Gottlieb <maorg@nvidia.com>:
      tools/testing/scatterlist: add missing defines

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: test: fix compatibility with FORTIFY_SOURCE

    Peter Collingbourne <pcc@google.com>:
      mm, kasan: use compare-exchange operation to set KASAN page tag

Subsystem: mm/psi

    Suren Baghdasaryan <surenb@google.com>:
      psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
      psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n

Subsystem: ocfs2

    Joseph Qi <joseph.qi@linux.alibaba.com>:
    Patch series "ocfs2: fix a deadlock case":
      jbd2: export jbd2_journal_[grab|put]_journal_head
      ocfs2: fix a deadlock when commit trans

 arch/ia64/Kconfig                    |    2 
 fs/binfmt_misc.c                     |    8 +--
 fs/jbd2/journal.c                    |    2 
 fs/ocfs2/suballoc.c                  |   25 ++++-------
 include/linux/mm.h                   |   17 +++++--
 include/linux/mm_types.h             |    1 
 include/linux/psi.h                  |   11 ++--
 include/linux/sysctl.h               |    2 
 kernel/sched/psi.c                   |   79 ++++++++++++++++++-----------------
 lib/test_kasan.c                     |    5 ++
 mm/memory-failure.c                  |    6 ++
 tools/testing/scatterlist/linux/mm.h |    3 -
 12 files changed, 91 insertions(+), 70 deletions(-)

incoming

[Andrew Morton]

This is the post-linux-next queue.  Material which was based on or
dependent upon material which was in -next.

69 patches, based on 9b57f458985742bd1c585f4c7f36d04634ce1143.

Subsystems affected by this patch series:

  mm/migration
  sysctl
  mm/zsmalloc
  proc
  lib

Subsystem: mm/migration

    Alistair Popple <apopple@nvidia.com>:
      mm/migrate.c: rework migration_entry_wait() to not take a pageref

Subsystem: sysctl

    Xiaoming Ni <nixiaoming@huawei.com>:
    Patch series "sysctl: first set of kernel/sysctl cleanups", v2:
      sysctl: add a new register_sysctl_init() interface
      sysctl: move some boundary constants from sysctl.c to sysctl_vals
      hung_task: move hung_task sysctl interface to hung_task.c
      watchdog: move watchdog sysctl interface to watchdog.c

    Stephen Kitt <steve@sk2.org>:
      sysctl: make ngroups_max const

    Xiaoming Ni <nixiaoming@huawei.com>:
      sysctl: use const for typically used max/min proc sysctls
      sysctl: use SYSCTL_ZERO to replace some static int zero uses
      aio: move aio sysctl to aio.c
      dnotify: move dnotify sysctl to dnotify.c

    Luis Chamberlain <mcgrof@kernel.org>:
    Patch series "sysctl: second set of kernel/sysctl cleanups", v2:
      hpet: simplify subdirectory registration with register_sysctl()
      i915: simplify subdirectory registration with register_sysctl()
      macintosh/mac_hid.c: simplify subdirectory registration with register_sysctl()
      ocfs2: simplify subdirectory registration with register_sysctl()
      test_sysctl: simplify subdirectory registration with register_sysctl()

    Xiaoming Ni <nixiaoming@huawei.com>:
      inotify: simplify subdirectory registration with register_sysctl()

    Luis Chamberlain <mcgrof@kernel.org>:
      cdrom: simplify subdirectory registration with register_sysctl()

    Xiaoming Ni <nixiaoming@huawei.com>:
      eventpoll: simplify sysctl declaration with register_sysctl()
    Patch series "sysctl: 3rd set of kernel/sysctl cleanups", v2:
      firmware_loader: move firmware sysctl to its own files
      random: move the random sysctl declarations to its own file

    Luis Chamberlain <mcgrof@kernel.org>:
      sysctl: add helper to register a sysctl mount point
      fs: move binfmt_misc sysctl to its own file

    Xiaoming Ni <nixiaoming@huawei.com>:
      printk: move printk sysctl to printk/sysctl.c
      scsi/sg: move sg-big-buff sysctl to scsi/sg.c
      stackleak: move stack_erasing sysctl to stackleak.c

    Luis Chamberlain <mcgrof@kernel.org>:
      sysctl: share unsigned long const values
    Patch series "sysctl: 4th set of kernel/sysctl cleanups":
      fs: move inode sysctls to its own file
      fs: move fs stat sysctls to file_table.c
      fs: move dcache sysctls to its own file
      sysctl: move maxolduid as a sysctl specific const
      fs: move shared sysctls to fs/sysctls.c
      fs: move locking sysctls where they are used
      fs: move namei sysctls to its own file
      fs: move fs/exec.c sysctls into its own file
      fs: move pipe sysctls to is own file
    Patch series "sysctl: add and use base directory declarer and registration helper":
      sysctl: add and use base directory declarer and registration helper
      fs: move namespace sysctls and declare fs base directory
      kernel/sysctl.c: rename sysctl_init() to sysctl_init_bases()

    Xiaoming Ni <nixiaoming@huawei.com>:
      printk: fix build warning when CONFIG_PRINTK=n
      fs/coredump: move coredump sysctls into its own file
      kprobe: move sysctl_kprobes_optimization to kprobes.c

    Colin Ian King <colin.i.king@gmail.com>:
      kernel/sysctl.c: remove unused variable ten_thousand

    Baokun Li <libaokun1@huawei.com>:
      sysctl: returns -EINVAL when a negative value is passed to proc_doulongvec_minmax

Subsystem: mm/zsmalloc

    Minchan Kim <minchan@kernel.org>:
    Patch series "zsmalloc: remove bit_spin_lock", v2:
      zsmalloc: introduce some helper functions
      zsmalloc: rename zs_stat_type to class_stat_type
      zsmalloc: decouple class actions from zspage works
      zsmalloc: introduce obj_allocated
      zsmalloc: move huge compressed obj from page to zspage
      zsmalloc: remove zspage isolation for migration
      locking/rwlocks: introduce write_lock_nested
      zsmalloc: replace per zpage lock with pool->migrate_lock

    Mike Galbraith <umgwanakikbuti@gmail.com>:
      zsmalloc: replace get_cpu_var with local_lock

Subsystem: proc

    Muchun Song <songmuchun@bytedance.com>:
      fs: proc: store PDE()->data into inode->i_private
      proc: remove PDE_DATA() completely

Subsystem: lib

    Vlastimil Babka <vbabka@suse.cz>:
      lib/stackdepot: allow optional init and stack_table allocation by kvmalloc()
lib/stackdepot: fix spelling mistake and grammar in pr_err message
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup3
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup4

    Marco Elver <elver@google.com>:
      lib/stackdepot: always do filter_irq_stacks() in stack_depot_save()

    Christoph Hellwig <hch@lst.de>:
    Patch series "remove Xen tmem leftovers":
      mm: remove cleancache
      frontswap: remove frontswap_writethrough
      frontswap: remove frontswap_tmem_exclusive_gets
      frontswap: remove frontswap_shrink
      frontswap: remove frontswap_curr_pages
      frontswap: simplify frontswap_init
      frontswap: remove the frontswap exports
      mm: simplify try_to_unuse
      frontswap: remove frontswap_test
      frontswap: simplify frontswap_register_ops
      mm: mark swap_lock and swap_active_head static
      frontswap: remove support for multiple ops
      mm: hide the FRONTSWAP Kconfig symbol

 Documentation/vm/cleancache.rst                        |  296 ------
 Documentation/vm/frontswap.rst                         |   31 
 Documentation/vm/index.rst                             |    1 
 MAINTAINERS                                            |    7 
 arch/alpha/kernel/srm_env.c                            |    4 
 arch/arm/configs/bcm2835_defconfig                     |    1 
 arch/arm/configs/qcom_defconfig                        |    1 
 arch/arm/kernel/atags_proc.c                           |    2 
 arch/arm/mm/alignment.c                                |    2 
 arch/ia64/kernel/salinfo.c                             |   10 
 arch/m68k/configs/amiga_defconfig                      |    1 
 arch/m68k/configs/apollo_defconfig                     |    1 
 arch/m68k/configs/atari_defconfig                      |    1 
 arch/m68k/configs/bvme6000_defconfig                   |    1 
 arch/m68k/configs/hp300_defconfig                      |    1 
 arch/m68k/configs/mac_defconfig                        |    1 
 arch/m68k/configs/multi_defconfig                      |    1 
 arch/m68k/configs/mvme147_defconfig                    |    1 
 arch/m68k/configs/mvme16x_defconfig                    |    1 
 arch/m68k/configs/q40_defconfig                        |    1 
 arch/m68k/configs/sun3_defconfig                       |    1 
 arch/m68k/configs/sun3x_defconfig                      |    1 
 arch/powerpc/kernel/proc_powerpc.c                     |    4 
 arch/s390/configs/debug_defconfig                      |    1 
 arch/s390/configs/defconfig                            |    1 
 arch/sh/mm/alignment.c                                 |    4 
 arch/xtensa/platforms/iss/simdisk.c                    |    4 
 block/bdev.c                                           |    5 
 drivers/acpi/proc.c                                    |    2 
 drivers/base/firmware_loader/fallback.c                |    7 
 drivers/base/firmware_loader/fallback.h                |   11 
 drivers/base/firmware_loader/fallback_table.c          |   25 
 drivers/cdrom/cdrom.c                                  |   23 
 drivers/char/hpet.c                                    |   22 
 drivers/char/random.c                                  |   14 
 drivers/gpu/drm/drm_dp_mst_topology.c                  |    1 
 drivers/gpu/drm/drm_mm.c                               |    4 
 drivers/gpu/drm/drm_modeset_lock.c                     |    9 
 drivers/gpu/drm/i915/i915_perf.c                       |   22 
 drivers/gpu/drm/i915/intel_runtime_pm.c                |    3 
 drivers/hwmon/dell-smm-hwmon.c                         |    4 
 drivers/macintosh/mac_hid.c                            |   24 
 drivers/net/bonding/bond_procfs.c                      |    8 
 drivers/net/wireless/cisco/airo.c                      |   22 
 drivers/net/wireless/intersil/hostap/hostap_ap.c       |   16 
 drivers/net/wireless/intersil/hostap/hostap_download.c |    2 
 drivers/net/wireless/intersil/hostap/hostap_proc.c     |   24 
 drivers/net/wireless/ray_cs.c                          |    2 
 drivers/nubus/proc.c                                   |   36 
 drivers/parisc/led.c                                   |    4 
 drivers/pci/proc.c                                     |   10 
 drivers/platform/x86/thinkpad_acpi.c                   |    4 
 drivers/platform/x86/toshiba_acpi.c                    |   16 
 drivers/pnp/isapnp/proc.c                              |    2 
 drivers/pnp/pnpbios/proc.c                             |    4 
 drivers/scsi/scsi_proc.c                               |    4 
 drivers/scsi/sg.c                                      |   35 
 drivers/usb/gadget/function/rndis.c                    |    4 
 drivers/zorro/proc.c                                   |    2 
 fs/Makefile                                            |    4 
 fs/afs/proc.c                                          |    6 
 fs/aio.c                                               |   31 
 fs/binfmt_misc.c                                       |    6 
 fs/btrfs/extent_io.c                                   |   10 
 fs/btrfs/super.c                                       |    2 
 fs/coredump.c                                          |   66 +
 fs/dcache.c                                            |   37 
 fs/eventpoll.c                                         |   10 
 fs/exec.c                                              |  145 +--
 fs/ext4/mballoc.c                                      |   14 
 fs/ext4/readpage.c                                     |    6 
 fs/ext4/super.c                                        |    3 
 fs/f2fs/data.c                                         |   13 
 fs/file_table.c                                        |   47 -
 fs/inode.c                                             |   39 
 fs/jbd2/journal.c                                      |    2 
 fs/locks.c                                             |   34 
 fs/mpage.c                                             |    7 
 fs/namei.c                                             |   58 +
 fs/namespace.c                                         |   24 
 fs/notify/dnotify/dnotify.c                            |   21 
 fs/notify/fanotify/fanotify_user.c                     |   10 
 fs/notify/inotify/inotify_user.c                       |   11 
 fs/ntfs3/ntfs_fs.h                                     |    1 
 fs/ocfs2/stackglue.c                                   |   25 
 fs/ocfs2/super.c                                       |    2 
 fs/pipe.c                                              |   64 +
 fs/proc/generic.c                                      |    6 
 fs/proc/inode.c                                        |    1 
 fs/proc/internal.h                                     |    5 
 fs/proc/proc_net.c                                     |    8 
 fs/proc/proc_sysctl.c                                  |   67 +
 fs/super.c                                             |    3 
 fs/sysctls.c                                           |   47 -
 include/linux/aio.h                                    |    4 
 include/linux/cleancache.h                             |  124 --
 include/linux/coredump.h                               |   10 
 include/linux/dcache.h                                 |   10 
 include/linux/dnotify.h                                |    1 
 include/linux/fanotify.h                               |    2 
 include/linux/frontswap.h                              |   35 
 include/linux/fs.h                                     |   18 
 include/linux/inotify.h                                |    3 
 include/linux/kprobes.h                                |    6 
 include/linux/migrate.h                                |    2 
 include/linux/mount.h                                  |    3 
 include/linux/pipe_fs_i.h                              |    4 
 include/linux/poll.h                                   |    2 
 include/linux/printk.h                                 |    4 
 include/linux/proc_fs.h                                |   17 
 include/linux/ref_tracker.h                            |    2 
 include/linux/rwlock.h                                 |    6 
 include/linux/rwlock_api_smp.h                         |    8 
 include/linux/rwlock_rt.h                              |   10 
 include/linux/sched/sysctl.h                           |   14 
 include/linux/seq_file.h                               |    2 
 include/linux/shmem_fs.h                               |    3 
 include/linux/spinlock_api_up.h                        |    1 
 include/linux/stackdepot.h                             |   25 
 include/linux/stackleak.h                              |    5 
 include/linux/swapfile.h                               |    3 
 include/linux/sysctl.h                                 |   67 +
 include/scsi/sg.h                                      |    4 
 init/main.c                                            |    9 
 ipc/util.c                                             |    2 
 kernel/hung_task.c                                     |   81 +
 kernel/irq/proc.c                                      |    8 
 kernel/kprobes.c                                       |   30 
 kernel/locking/spinlock.c                              |   10 
 kernel/locking/spinlock_rt.c                           |   12 
 kernel/printk/Makefile                                 |    5 
 kernel/printk/internal.h                               |    8 
 kernel/printk/printk.c                                 |    4 
 kernel/printk/sysctl.c                                 |   85 +
 kernel/resource.c                                      |    4 
 kernel/stackleak.c                                     |   26 
 kernel/sysctl.c                                        |  790 +----------------
 kernel/watchdog.c                                      |  101 ++
 lib/Kconfig                                            |    4 
 lib/Kconfig.kasan                                      |    2 
 lib/stackdepot.c                                       |   46 
 lib/test_sysctl.c                                      |   22 
 mm/Kconfig                                             |   40 
 mm/Makefile                                            |    1 
 mm/cleancache.c                                        |  315 ------
 mm/filemap.c                                           |  102 +-
 mm/frontswap.c                                         |  259 -----
 mm/kasan/common.c                                      |    1 
 mm/migrate.c                                           |   38 
 mm/page_owner.c                                        |    2 
 mm/shmem.c                                             |   33 
 mm/swapfile.c                                          |   90 -
 mm/truncate.c                                          |   15 
 mm/zsmalloc.c                                          |  557 ++++-------
 mm/zswap.c                                             |    8 
 net/atm/proc.c                                         |    4 
 net/bluetooth/af_bluetooth.c                           |    8 
 net/can/bcm.c                                          |    2 
 net/can/proc.c                                         |    2 
 net/core/neighbour.c                                   |    6 
 net/core/pktgen.c                                      |    6 
 net/ipv4/netfilter/ipt_CLUSTERIP.c                     |    6 
 net/ipv4/raw.c                                         |    8 
 net/ipv4/tcp_ipv4.c                                    |    2 
 net/ipv4/udp.c                                         |    6 
 net/netfilter/x_tables.c                               |   10 
 net/netfilter/xt_hashlimit.c                           |   18 
 net/netfilter/xt_recent.c                              |    4 
 net/sunrpc/auth_gss/svcauth_gss.c                      |    4 
 net/sunrpc/cache.c                                     |   24 
 net/sunrpc/stats.c                                     |    2 
 sound/core/info.c                                      |    4 
 172 files changed, 1877 insertions(+), 2931 deletions(-)

incoming

[Andrew Morton]

55 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")

Subsystems affected by this patch series:

  percpu
  procfs
  sysctl
  misc
  core-kernel
  get_maintainer
  lib
  checkpatch
  binfmt
  nilfs2
  hfs
  fat
  adfs
  panic
  delayacct
  kconfig
  kcov
  ubsan

Subsystem: percpu

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "mm: percpu: Cleanup percpu first chunk function":
      mm: percpu: generalize percpu related config
      mm: percpu: add pcpu_fc_cpu_to_node_fn_t typedef
      mm: percpu: add generic pcpu_fc_alloc/free funciton
      mm: percpu: add generic pcpu_populate_pte() function

Subsystem: procfs

    David Hildenbrand <david@redhat.com>:
      proc/vmcore: don't fake reading zeroes on surprise vmcore_cb unregistration

    Hans de Goede <hdegoede@redhat.com>:
      proc: make the proc_create[_data]() stubs static inlines

    Qi Zheng <zhengqi.arch@bytedance.com>:
      proc: convert the return type of proc_fd_access_allowed() to be boolean

Subsystem: sysctl

    Geert Uytterhoeven <geert+renesas@glider.be>:
      sysctl: fix duplicate path separator in printed entries

    luo penghao <luo.penghao@zte.com.cn>:
      sysctl: remove redundant ret assignment

Subsystem: misc

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/unaligned: replace kernel.h with the necessary inclusions
      kernel.h: include a note to discourage people from including it in headers

Subsystem: core-kernel

    Yafang Shao <laoar.shao@gmail.com>:
    Patch series "task comm cleanups", v2:
      fs/exec: replace strlcpy with strscpy_pad in __set_task_comm
      fs/exec: replace strncpy with strscpy_pad in __get_task_comm
      drivers/infiniband: replace open-coded string copy with get_task_comm
      fs/binfmt_elf: replace open-coded string copy with get_task_comm
      samples/bpf/test_overhead_kprobe_kern: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
      tools/bpf/bpftool/skeleton: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
      tools/testing/selftests/bpf: replace open-coded 16 with TASK_COMM_LEN
      kthread: dynamically allocate memory to store kthread's full name

    Davidlohr Bueso <dave@stgolabs.net>:
      kernel/sys.c: only take tasklist_lock for get/setpriority(PRIO_PGRP)

Subsystem: get_maintainer

    Randy Dunlap <rdunlap@infradead.org>:
      get_maintainer: don't remind about no git repo when --nogit is used

Subsystem: lib

    Alexey Dobriyan <adobriyan@gmail.com>:
      kstrtox: uninline everything

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      list: introduce list_is_head() helper and re-use it in list.h

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/list_debug.c: print more list debugging context in __list_del_entry_valid()

    Isabella Basso <isabbasso@riseup.net>:
    Patch series "test_hash.c: refactor into KUnit", v3:
      hash.h: remove unused define directive
      test_hash.c: split test_int_hash into arch-specific functions
      test_hash.c: split test_hash_init
      lib/Kconfig.debug: properly split hash test kernel entries
      test_hash.c: refactor into kunit

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kunit: replace kernel.h with the necessary inclusions
      uuid: discourage people from using UAPI header in new code
      uuid: remove licence boilerplate text from the header

    Andrey Konovalov <andreyknvl@google.com>:
      lib/test_meminit: destroy cache in kmem_cache_alloc_bulk() test

Subsystem: checkpatch

    Jerome Forissier <jerome@forissier.org>:
      checkpatch: relax regexp for COMMIT_LOG_LONG_LINE

    Joe Perches <joe@perches.com>:
      checkpatch: improve Kconfig help test

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add frequently used ops structs

Subsystem: binfmt

    "H.J. Lu" <hjl.tools@gmail.com>:
      fs/binfmt_elf: use PT_LOAD p_align values for static PIE

Subsystem: nilfs2

    Colin Ian King <colin.i.king@gmail.com>:
      nilfs2: remove redundant pointer sbufs

Subsystem: hfs

    Kees Cook <keescook@chromium.org>:
      hfsplus: use struct_group_attr() for memcpy() region

Subsystem: fat

    "NeilBrown" <neilb@suse.de>:
       FAT: use io_schedule_timeout() instead of congestion_wait()

Subsystem: adfs

    Minghao Chi <chi.minghao@zte.com.cn>:
      fs/adfs: remove unneeded variable make code cleaner

Subsystem: panic

    Marco Elver <elver@google.com>:
      panic: use error_report_end tracepoint on warnings

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      panic: remove oops_id

Subsystem: delayacct

    Yang Yang <yang.yang29@zte.com.cn>:
      delayacct: support swapin delay accounting for swapping without blkio
      delayacct: fix incomplete disable operation when switch enable to disable
      delayacct: cleanup flags in struct task_delay_info and functions use it

    wangyong <wang.yong12@zte.com.cn>:
      Documentation/accounting/delay-accounting.rst: add thrashing page cache and direct compact
      delayacct: track delays from memory compact

Subsystem: kconfig

    Qian Cai <quic_qiancai@quicinc.com>:
      configs: introduce debug.config for CI-like setup

    Nathan Chancellor <nathan@kernel.org>:
    Patch series "Fix CONFIG_TEST_KMOD with 256kB page size":
      arch/Kconfig: split PAGE_SIZE_LESS_THAN_256KB from PAGE_SIZE_LESS_THAN_64KB
      btrfs: use generic Kconfig option for 256kB page size limit
      lib/Kconfig.debug: make TEST_KMOD depend on PAGE_SIZE_LESS_THAN_256KB

Subsystem: kcov

    Marco Elver <elver@google.com>:
      kcov: fix generic Kconfig dependencies if ARCH_WANTS_NO_INSTR

Subsystem: ubsan

    Kees Cook <keescook@chromium.org>:
      ubsan: remove CONFIG_UBSAN_OBJECT_SIZE

    Colin Ian King <colin.i.king@gmail.com>:
      lib: remove redundant assignment to variable ret

 Documentation/accounting/delay-accounting.rst           |   63 +-
 arch/Kconfig                                            |    4 
 arch/arm64/Kconfig                                      |   20 
 arch/ia64/Kconfig                                       |    9 
 arch/mips/Kconfig                                       |   10 
 arch/mips/mm/init.c                                     |   28 -
 arch/powerpc/Kconfig                                    |   17 
 arch/powerpc/kernel/setup_64.c                          |  113 ----
 arch/riscv/Kconfig                                      |   10 
 arch/sparc/Kconfig                                      |   12 
 arch/sparc/kernel/led.c                                 |    8 
 arch/sparc/kernel/smp_64.c                              |  119 -----
 arch/x86/Kconfig                                        |   19 
 arch/x86/kernel/setup_percpu.c                          |   82 ---
 drivers/base/arch_numa.c                                |   78 ---
 drivers/infiniband/hw/qib/qib.h                         |    2 
 drivers/infiniband/hw/qib/qib_file_ops.c                |    2 
 drivers/infiniband/sw/rxe/rxe_qp.c                      |    3 
 drivers/net/wireless/broadcom/brcm80211/brcmfmac/xtlv.c |    2 
 fs/adfs/inode.c                                         |    4 
 fs/binfmt_elf.c                                         |    6 
 fs/btrfs/Kconfig                                        |    3 
 fs/exec.c                                               |    5 
 fs/fat/file.c                                           |    5 
 fs/hfsplus/hfsplus_raw.h                                |   12 
 fs/hfsplus/xattr.c                                      |    4 
 fs/nilfs2/page.c                                        |    4 
 fs/proc/array.c                                         |    3 
 fs/proc/base.c                                          |    4 
 fs/proc/proc_sysctl.c                                   |    9 
 fs/proc/vmcore.c                                        |   10 
 include/kunit/assert.h                                  |    2 
 include/linux/delayacct.h                               |  107 ++--
 include/linux/elfcore-compat.h                          |    5 
 include/linux/elfcore.h                                 |    5 
 include/linux/hash.h                                    |    5 
 include/linux/kernel.h                                  |    9 
 include/linux/kthread.h                                 |    1 
 include/linux/list.h                                    |   36 -
 include/linux/percpu.h                                  |   21 
 include/linux/proc_fs.h                                 |   12 
 include/linux/sched.h                                   |    9 
 include/linux/unaligned/packed_struct.h                 |    2 
 include/trace/events/error_report.h                     |    8 
 include/uapi/linux/taskstats.h                          |    6 
 include/uapi/linux/uuid.h                               |   10 
 kernel/configs/debug.config                             |  105 ++++
 kernel/delayacct.c                                      |   49 +-
 kernel/kthread.c                                        |   32 +
 kernel/panic.c                                          |   21 
 kernel/sys.c                                            |   16 
 lib/Kconfig.debug                                       |   45 +
 lib/Kconfig.ubsan                                       |   13 
 lib/Makefile                                            |    5 
 lib/asn1_encoder.c                                      |    2 
 lib/kstrtox.c                                           |   12 
 lib/list_debug.c                                        |    8 
 lib/lz4/lz4defs.h                                       |    2 
 lib/test_hash.c                                         |  375 +++++++---------
 lib/test_meminit.c                                      |    1 
 lib/test_ubsan.c                                        |   22 
 mm/Kconfig                                              |   12 
 mm/memory.c                                             |    4 
 mm/page_alloc.c                                         |    3 
 mm/page_io.c                                            |    3 
 mm/percpu.c                                             |  168 +++++--
 samples/bpf/offwaketime_kern.c                          |    4 
 samples/bpf/test_overhead_kprobe_kern.c                 |   11 
 samples/bpf/test_overhead_tp_kern.c                     |    5 
 scripts/Makefile.ubsan                                  |    1 
 scripts/checkpatch.pl                                   |   54 +-
 scripts/const_structs.checkpatch                        |   23 
 scripts/get_maintainer.pl                               |    2 
 tools/accounting/getdelays.c                            |    8 
 tools/bpf/bpftool/skeleton/pid_iter.bpf.c               |    4 
 tools/include/linux/hash.h                              |    5 
 tools/testing/selftests/bpf/progs/test_stacktrace_map.c |    6 
 tools/testing/selftests/bpf/progs/test_tracepoint.c     |    6 
 78 files changed, 943 insertions(+), 992 deletions(-)

incoming

[Andrew Morton]

146 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")

Subsystems affected by this patch series:

  kthread
  ia64
  scripts
  ntfs
  squashfs
  ocfs2
  vfs
  mm/slab-generic
  mm/slab
  mm/kmemleak
  mm/dax
  mm/kasan
  mm/debug
  mm/pagecache
  mm/gup
  mm/shmem
  mm/frontswap
  mm/memremap
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/dma
  mm/vmalloc
  mm/memory-failure
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/mempolicy
  mm/oom-kill
  mm/hugetlbfs
  mm/migration
  mm/thp
  mm/ksm
  mm/page-poison
  mm/percpu
  mm/rmap
  mm/zswap
  mm/zram
  mm/cleanups
  mm/hmm
  mm/damon

Subsystem: kthread

    Cai Huoqing <caihuoqing@baidu.com>:
      kthread: add the helper function kthread_run_on_cpu()
      RDMA/siw: make use of the helper function kthread_run_on_cpu()
      ring-buffer: make use of the helper function kthread_run_on_cpu()
      rcutorture: make use of the helper function kthread_run_on_cpu()
      trace/osnoise: make use of the helper function kthread_run_on_cpu()
      trace/hwlat: make use of the helper function kthread_run_on_cpu()

Subsystem: ia64

    Yang Guang <yang.guang5@zte.com.cn>:
      ia64: module: use swap() to make code cleaner
      arch/ia64/kernel/setup.c: use swap() to make code cleaner

    Jason Wang <wangborong@cdjrlc.com>:
      ia64: fix typo in a comment

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      ia64: topology: use default_groups in kobj_type

Subsystem: scripts

    Drew Fustini <dfustini@baylibre.com>:
      scripts/spelling.txt: add "oveflow"

Subsystem: ntfs

    Yang Li <yang.lee@linux.alibaba.com>:
      fs/ntfs/attrib.c: fix one kernel-doc comment

Subsystem: squashfs

    Zheng Liang <zhengliang6@huawei.com>:
      squashfs: provide backing_dev_info in order to disable read-ahead

Subsystem: ocfs2

    Zhang Mingyu <zhang.mingyu@zte.com.cn>:
      ocfs2: use BUG_ON instead of if condition followed by BUG.

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: clearly handle ocfs2_grab_pages_for_write() return value

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      ocfs2: use default_groups in kobj_type

    Colin Ian King <colin.i.king@gmail.com>:
      ocfs2: remove redundant assignment to pointer root_bh

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      ocfs2: cluster: use default_groups in kobj_type

    Colin Ian King <colin.i.king@gmail.com>:
      ocfs2: remove redundant assignment to variable free_space

Subsystem: vfs

    Amit Daniel Kachhap <amit.kachhap@arm.com>:
      fs/ioctl: remove unnecessary __user annotation

Subsystem: mm/slab-generic

    Marco Elver <elver@google.com>:
      mm/slab_common: use WARN() if cache still has objects on destroy

Subsystem: mm/slab

    Muchun Song <songmuchun@bytedance.com>:
      mm: slab: make slab iterator functions static

Subsystem: mm/kmemleak

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      kmemleak: fix kmemleak false positive report with HW tag-based kasan enable

    Calvin Zhang <calvinzhang.cool@gmail.com>:
      mm: kmemleak: alloc gray object for reserved region with direct map

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: defer kmemleak object creation of module_alloc()

Subsystem: mm/dax

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm, device-dax: Introduce compound pages in devmap", v7:
      mm/page_alloc: split prep_compound_page into head and tail subparts
      mm/page_alloc: refactor memmap_init_zone_device() page init
      mm/memremap: add ZONE_DEVICE support for compound pages
      device-dax: use ALIGN() for determining pgoff
      device-dax: use struct_size()
      device-dax: ensure dev_dax->pgmap is valid for dynamic devices
      device-dax: factor out page mapping initialization
      device-dax: set mapping prior to vmf_insert_pfn{,_pmd,pud}()
      device-dax: remove pfn from __dev_dax_{pte,pmd,pud}_fault()
      device-dax: compound devmap support

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: test: add globals left-out-of-bounds test
      kasan: add ability to detect double-kmem_cache_destroy()
      kasan: test: add test case for double-kmem_cache_destroy()

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix quarantine conflicting with init_on_free

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm,fs: split dump_mapping() out from dump_page()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/debug_vm_pgtable: update comments regarding migration swap entries

Subsystem: mm/pagecache

    chiminghao <chi.minghao@zte.com.cn>:
      mm/truncate.c: remove unneeded variable

Subsystem: mm/gup

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      gup: avoid multiple user access locking/unlocking in fault_in_{read/write}able

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/gup.c: stricter check on THP migration entry during follow_pmd_mask

Subsystem: mm/shmem

    Yang Shi <shy828301@gmail.com>:
      mm: shmem: don't truncate page if memory failure happens

    Gang Li <ligang.bdlg@bytedance.com>:
      shmem: fix a race between shmem_unused_huge_shrink and shmem_evict_inode

Subsystem: mm/frontswap

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      mm/frontswap.c: use non-atomic '__set_bit()' when possible

Subsystem: mm/memremap

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: make cgroup_memory_nokmem static

    Donghai Qiao <dqiao@redhat.com>:
      mm/page_counter: remove an incorrect call to propagate_protected_usage()

    Dan Schatzberg <schatzberg.dan@gmail.com>:
      mm/memcg: add oom_group_kill memory event

    Shakeel Butt <shakeelb@google.com>:
      memcg: better bounds on the memcg stats updates

    Wang Weiyang <wangweiyang2@huawei.com>:
      mm/memcg: use struct_size() helper in kzalloc()

    Shakeel Butt <shakeelb@google.com>:
      memcg: add per-memcg vmalloc stat

Subsystem: mm/selftests

    chiminghao <chi.minghao@zte.com.cn>:
      tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner

Subsystem: mm/pagemap

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm: remove redundant check about FAULT_FLAG_ALLOW_RETRY bit

    Colin Cross <ccross@google.com>:
    Patch series "mm: rearrange madvise code to allow for reuse", v11:
      mm: rearrange madvise code to allow for reuse
      mm: add a field to store names for private anonymous memory

    Suren Baghdasaryan <surenb@google.com>:
      mm: add anonymous vma name refcounting

    Arnd Bergmann <arnd@arndb.de>:
      mm: move anon_vma declarations to linux/mm_inline.h
      mm: move tlb_flush_pending inline helpers to mm_inline.h

    Suren Baghdasaryan <surenb@google.com>:
      mm: protect free_pgtables with mmap_lock write lock in exit_mmap
      mm: document locking restrictions for vm_operations_struct::close
      mm/oom_kill: allow process_mrelease to run under mmap_lock protection

    Shuah Khan <skhan@linuxfoundation.org>:
      docs/vm: add vmalloced-kernel-stacks document

    Pasha Tatashin <pasha.tatashin@soleen.com>:
    Patch series "page table check", v3:
      mm: change page type prior to adding page table entry
      mm: ptep_clear() page table helper
      mm: page table check
      x86: mm: add x86_64 support for page table check

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: remove last argument of reuse_swap_page()
      mm: remove the total_mapcount argument from page_trans_huge_map_swapcount()
      mm: remove the total_mapcount argument from page_trans_huge_mapcount()

Subsystem: mm/dma

    Christian König <christian.koenig@amd.com>:
      mm/dmapool.c: revert "make dma pool to use kmalloc_node"

Subsystem: mm/vmalloc

    Michal Hocko <mhocko@suse.com>:
    Patch series "extend vmalloc support for constrained allocations", v2:
      mm/vmalloc: alloc GFP_NO{FS,IO} for vmalloc
      mm/vmalloc: add support for __GFP_NOFAIL
      mm/vmalloc: be more explicit about supported gfp flags.
      mm: allow !GFP_KERNEL allocations for kvmalloc
      mm: make slab and vmalloc allocators __GFP_NOLOCKDEP aware

    "NeilBrown" <neilb@suse.de>:
      mm: introduce memalloc_retry_wait()

    Suren Baghdasaryan <surenb@google.com>:
      mm/pagealloc: sysctl: change watermark_scale_factor max limit to 30%

    Changcheng Deng <deng.changcheng@zte.com.cn>:
      mm: fix boolreturn.cocci warning

    Xiongwei Song <sxwjean@gmail.com>:
      mm: page_alloc: fix building error on -Werror=array-compare

    Michal Hocko <mhocko@suse.com>:
      mm: drop node from alloc_pages_vma

    Miles Chen <miles.chen@mediatek.com>:
      include/linux/gfp.h: further document GFP_DMA32

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/page_alloc.c: modify the comment section for alloc_contig_pages()

    Baoquan He <bhe@redhat.com>:
    Patch series "Handle warning of allocation failure on DMA zone w/o managed pages", v4:
      mm_zone: add function to check if managed dma zone exists
      dma/pool: create dma atomic pool only if dma zone has managed pages
      mm/page_alloc.c: do not warn allocation failure on zone DMA if no managed pages

Subsystem: mm/memory-failure

Subsystem: mm/hugetlb

    Mina Almasry <almasrymina@google.com>:
      hugetlb: add hugetlb.*.numa_stat file

    Yosry Ahmed <yosryahmed@google.com>:
      mm, hugepages: make memory size variable in hugepage-mremap selftest

    Yang Yang <yang.yang29@zte.com.cn>:
      mm/vmstat: add events for THP max_ptes_* exceeds

    Waiman Long <longman@redhat.com>:
      selftests/vm: make charge_reserved_hugetlb.sh work with existing cgroup setting

Subsystem: mm/userfaultfd

    Peter Xu <peterx@redhat.com>:
      selftests/uffd: allow EINTR/EAGAIN

    Mike Kravetz <mike.kravetz@oracle.com>:
      userfaultfd/selftests: clean up hugetlb allocation code

Subsystem: mm/vmscan

    Gang Li <ligang.bdlg@bytedance.com>:
      vmscan: make drop_slab_node static

    Chen Wandun <chenwandun@huawei.com>:
      mm/page_isolation: unset migratetype directly for non Buddy page

Subsystem: mm/mempolicy

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mm: add new syscall set_mempolicy_home_node", v6:
      mm/mempolicy: use policy_node helper with MPOL_PREFERRED_MANY
      mm/mempolicy: add set_mempolicy_home_node syscall
      mm/mempolicy: wire up syscall set_mempolicy_home_node

    Randy Dunlap <rdunlap@infradead.org>:
      mm/mempolicy: fix all kernel-doc warnings

Subsystem: mm/oom-kill

    Jann Horn <jannh@google.com>:
      mm, oom: OOM sysrq should always kill a process

Subsystem: mm/hugetlbfs

    Sean Christopherson <seanjc@google.com>:
      hugetlbfs: fix off-by-one error in hugetlb_vmdelete_list()

Subsystem: mm/migration

    Baolin Wang <baolin.wang@linux.alibaba.com>:
    Patch series "Improve the migration stats":
      mm: migrate: fix the return value of migrate_pages()
      mm: migrate: correct the hugetlb migration stats
      mm: compaction: fix the migration stats in trace_mm_compaction_migratepages()
      mm: migrate: support multiple target nodes demotion
      mm: migrate: add more comments for selecting target node randomly

    Huang Ying <ying.huang@intel.com>:
      mm/migrate: move node demotion code to near its user

    Colin Ian King <colin.i.king@gmail.com>:
      mm/migrate: remove redundant variables used in a for-loop

Subsystem: mm/thp

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: drop unused trace events hugepage_[invalidate|splitting]

Subsystem: mm/ksm

    Nanyong Sun <sunnanyong@huawei.com>:
      mm: ksm: fix use-after-free kasan report in ksm_might_need_to_copy

Subsystem: mm/page-poison

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
    Patch series "mm/hwpoison: fix unpoison_memory()", v4:
      mm/hwpoison: mf_mutex for soft offline and unpoison
      mm/hwpoison: remove MF_MSG_BUDDY_2ND and MF_MSG_POISONED_HUGE
      mm/hwpoison: fix unpoison_memory()

Subsystem: mm/percpu

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm: memcg/percpu: account extra objcg space to memory cgroups

Subsystem: mm/rmap

    Huang Ying <ying.huang@intel.com>:
      mm/rmap: fix potential batched TLB flush race

Subsystem: mm/zswap

    Zhaoyu Liu <zackary.liu.pro@gmail.com>:
      zpool: remove the list of pools_head

Subsystem: mm/zram

    Luis Chamberlain <mcgrof@kernel.org>:
      zram: use ATTRIBUTE_GROUPS

Subsystem: mm/cleanups

    Quanfa Fu <fuqf0919@gmail.com>:
      mm: fix some comment errors

    Ting Liu <liuting.0x7c00@bytedance.com>:
      mm: make some vars and functions static or __init

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
      mm/hmm.c: allow VM_MIXEDMAP to work with hmm_range_fault

Subsystem: mm/damon

    Xin Hao <xhao@linux.alibaba.com>:
    Patch series "mm/damon: Do some small changes", v4:
      mm/damon: unified access_check function naming rules
      mm/damon: add 'age' of region tracepoint support
      mm/damon/core: use abs() instead of diff_of()
      mm/damon: remove some unneeded function definitions in damon.h

    Yihao Han <hanyihao@vivo.com>:
      mm/damon/vaddr: remove swap_ranges() and replace it with swap()

    Xin Hao <xhao@linux.alibaba.com>:
      mm/damon/schemes: add the validity judgment of thresholds
      mm/damon: move damon_rand() definition into damon.h
      mm/damon: modify damon_rand() macro to static inline function

    SeongJae Park <sj@kernel.org>:
    Patch series "mm/damon: Misc cleanups":
      mm/damon: convert macro functions to static inline functions
      Docs/admin-guide/mm/damon/usage: update for scheme quotas and watermarks
      Docs/admin-guide/mm/damon/usage: remove redundant information
      Docs/admin-guide/mm/damon/usage: mention tracepoint at the beginning
      Docs/admin-guide/mm/damon/usage: update for kdamond_pid and (mk|rm)_contexts
      mm/damon: remove a mistakenly added comment for a future feature
    Patch series "mm/damon/schemes: Extend stats for better online analysis and tuning":
      mm/damon/schemes: account scheme actions that successfully applied
      mm/damon/schemes: account how many times quota limit has exceeded
      mm/damon/reclaim: provide reclamation statistics
      Docs/admin-guide/mm/damon/reclaim: document statistics parameters
      mm/damon/dbgfs: support all DAMOS stats
      Docs/admin-guide/mm/damon/usage: update for schemes statistics

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/damon: add access checking for hugetlb pages

    Guoqing Jiang <guoqing.jiang@linux.dev>:
      mm/damon: move the implementation of damon_insert_region to damon.h

    SeongJae Park <sj@kernel.org>:
    Patch series "mm/damon: Hide unnecessary information disclosures":
      mm/damon/dbgfs: remove an unnecessary variable
      mm/damon/vaddr: use pr_debug() for damon_va_three_regions() failure logging
      mm/damon/vaddr: hide kernel pointer from damon_va_three_regions() failure log
      mm/damon: hide kernel pointer from tracepoint event

 Documentation/admin-guide/cgroup-v1/hugetlb.rst        |    4 
 Documentation/admin-guide/cgroup-v2.rst                |   11 
 Documentation/admin-guide/mm/damon/reclaim.rst         |   25 
 Documentation/admin-guide/mm/damon/usage.rst           |  235 +++++--
 Documentation/admin-guide/mm/numa_memory_policy.rst    |   16 
 Documentation/admin-guide/sysctl/vm.rst                |    2 
 Documentation/filesystems/proc.rst                     |    6 
 Documentation/vm/arch_pgtable_helpers.rst              |   20 
 Documentation/vm/index.rst                             |    2 
 Documentation/vm/page_migration.rst                    |   12 
 Documentation/vm/page_table_check.rst                  |   56 +
 Documentation/vm/vmalloced-kernel-stacks.rst           |  153 ++++
 MAINTAINERS                                            |    9 
 arch/Kconfig                                           |    3 
 arch/alpha/kernel/syscalls/syscall.tbl                 |    1 
 arch/alpha/mm/fault.c                                  |   16 
 arch/arc/mm/fault.c                                    |    3 
 arch/arm/mm/fault.c                                    |    2 
 arch/arm/tools/syscall.tbl                             |    1 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    2 
 arch/arm64/kernel/module.c                             |    4 
 arch/arm64/mm/fault.c                                  |    6 
 arch/hexagon/mm/vm_fault.c                             |    8 
 arch/ia64/kernel/module.c                              |    6 
 arch/ia64/kernel/setup.c                               |    5 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    1 
 arch/ia64/kernel/topology.c                            |    3 
 arch/ia64/kernel/uncached.c                            |    2 
 arch/ia64/mm/fault.c                                   |   16 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    1 
 arch/m68k/mm/fault.c                                   |   18 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    1 
 arch/microblaze/mm/fault.c                             |   18 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    1 
 arch/mips/mm/fault.c                                   |   19 
 arch/nds32/mm/fault.c                                  |   16 
 arch/nios2/mm/fault.c                                  |   18 
 arch/openrisc/mm/fault.c                               |   18 
 arch/parisc/kernel/syscalls/syscall.tbl                |    1 
 arch/parisc/mm/fault.c                                 |   18 
 arch/powerpc/kernel/syscalls/syscall.tbl               |    1 
 arch/powerpc/mm/fault.c                                |    6 
 arch/riscv/mm/fault.c                                  |    2 
 arch/s390/kernel/module.c                              |    5 
 arch/s390/kernel/syscalls/syscall.tbl                  |    1 
 arch/s390/mm/fault.c                                   |   28 
 arch/sh/kernel/syscalls/syscall.tbl                    |    1 
 arch/sh/mm/fault.c                                     |   18 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    1 
 arch/sparc/mm/fault_32.c                               |   16 
 arch/sparc/mm/fault_64.c                               |   16 
 arch/um/kernel/trap.c                                  |    8 
 arch/x86/Kconfig                                       |    1 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    1 
 arch/x86/include/asm/pgtable.h                         |   31 -
 arch/x86/kernel/module.c                               |    7 
 arch/x86/mm/fault.c                                    |    3 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    1 
 arch/xtensa/mm/fault.c                                 |   17 
 drivers/block/zram/zram_drv.c                          |   11 
 drivers/dax/bus.c                                      |   32 +
 drivers/dax/bus.h                                      |    1 
 drivers/dax/device.c                                   |  140 ++--
 drivers/infiniband/sw/siw/siw_main.c                   |    7 
 drivers/of/fdt.c                                       |    6 
 fs/ext4/extents.c                                      |    8 
 fs/ext4/inline.c                                       |    5 
 fs/ext4/page-io.c                                      |    9 
 fs/f2fs/data.c                                         |    4 
 fs/f2fs/gc.c                                           |    5 
 fs/f2fs/inode.c                                        |    4 
 fs/f2fs/node.c                                         |    4 
 fs/f2fs/recovery.c                                     |    6 
 fs/f2fs/segment.c                                      |    9 
 fs/f2fs/super.c                                        |    5 
 fs/hugetlbfs/inode.c                                   |    7 
 fs/inode.c                                             |   49 +
 fs/ioctl.c                                             |    2 
 fs/ntfs/attrib.c                                       |    2 
 fs/ocfs2/alloc.c                                       |    2 
 fs/ocfs2/aops.c                                        |   26 
 fs/ocfs2/cluster/masklog.c                             |   11 
 fs/ocfs2/dir.c                                         |    2 
 fs/ocfs2/filecheck.c                                   |    3 
 fs/ocfs2/journal.c                                     |    6 
 fs/proc/task_mmu.c                                     |   13 
 fs/squashfs/super.c                                    |   33 +
 fs/userfaultfd.c                                       |    8 
 fs/xfs/kmem.c                                          |    3 
 fs/xfs/xfs_buf.c                                       |    2 
 include/linux/ceph/libceph.h                           |    1 
 include/linux/damon.h                                  |   93 +--
 include/linux/fs.h                                     |    1 
 include/linux/gfp.h                                    |   12 
 include/linux/hugetlb.h                                |    4 
 include/linux/hugetlb_cgroup.h                         |    7 
 include/linux/kasan.h                                  |    4 
 include/linux/kthread.h                                |   25 
 include/linux/memcontrol.h                             |   22 
 include/linux/mempolicy.h                              |    1 
 include/linux/memremap.h                               |   11 
 include/linux/mm.h                                     |   76 --
 include/linux/mm_inline.h                              |  136 ++++
 include/linux/mm_types.h                               |  252 +++-----
 include/linux/mmzone.h                                 |    9 
 include/linux/page-flags.h                             |    6 
 include/linux/page_idle.h                              |    1 
 include/linux/page_table_check.h                       |  147 ++++
 include/linux/pgtable.h                                |    8 
 include/linux/sched/mm.h                               |   26 
 include/linux/swap.h                                   |    8 
 include/linux/syscalls.h                               |    3 
 include/linux/vm_event_item.h                          |    3 
 include/linux/vmalloc.h                                |    7 
 include/ras/ras_event.h                                |    2 
 include/trace/events/compaction.h                      |   24 
 include/trace/events/damon.h                           |   15 
 include/trace/events/thp.h                             |   35 -
 include/uapi/asm-generic/unistd.h                      |    5 
 include/uapi/linux/prctl.h                             |    3 
 kernel/dma/pool.c                                      |    4 
 kernel/fork.c                                          |    3 
 kernel/kthread.c                                       |    1 
 kernel/rcu/rcutorture.c                                |    7 
 kernel/sys.c                                           |   63 ++
 kernel/sys_ni.c                                        |    1 
 kernel/sysctl.c                                        |    3 
 kernel/trace/ring_buffer.c                             |    7 
 kernel/trace/trace_hwlat.c                             |    6 
 kernel/trace/trace_osnoise.c                           |    3 
 lib/test_hmm.c                                         |   24 
 lib/test_kasan.c                                       |   30 
 mm/Kconfig                                             |   14 
 mm/Kconfig.debug                                       |   24 
 mm/Makefile                                            |    1 
 mm/compaction.c                                        |    7 
 mm/damon/core.c                                        |   45 -
 mm/damon/dbgfs.c                                       |   20 
 mm/damon/paddr.c                                       |   24 
 mm/damon/prmtv-common.h                                |    4 
 mm/damon/reclaim.c                                     |   46 +
 mm/damon/vaddr.c                                       |  186 ++++--
 mm/debug.c                                             |   52 -
 mm/debug_vm_pgtable.c                                  |    6 
 mm/dmapool.c                                           |    2 
 mm/frontswap.c                                         |    4 
 mm/gup.c                                               |   31 -
 mm/hmm.c                                               |    5 
 mm/huge_memory.c                                       |   32 -
 mm/hugetlb.c                                           |    6 
 mm/hugetlb_cgroup.c                                    |  133 +++-
 mm/internal.h                                          |    7 
 mm/kasan/quarantine.c                                  |   11 
 mm/kasan/shadow.c                                      |    9 
 mm/khugepaged.c                                        |   23 
 mm/kmemleak.c                                          |   21 
 mm/ksm.c                                               |    5 
 mm/madvise.c                                           |  510 ++++++++++------
 mm/mapping_dirty_helpers.c                             |    1 
 mm/memcontrol.c                                        |   44 -
 mm/memory-failure.c                                    |  189 +++---
 mm/memory.c                                            |   12 
 mm/mempolicy.c                                         |   95 ++-
 mm/memremap.c                                          |   18 
 mm/migrate.c                                           |  527 ++++++++++-------
 mm/mlock.c                                             |    2 
 mm/mmap.c                                              |   55 +
 mm/mmu_gather.c                                        |    1 
 mm/mprotect.c                                          |    2 
 mm/oom_kill.c                                          |   30 
 mm/page_alloc.c                                        |  198 ++++--
 mm/page_counter.c                                      |    1 
 mm/page_ext.c                                          |    8 
 mm/page_isolation.c                                    |    2 
 mm/page_owner.c                                        |    4 
 mm/page_table_check.c                                  |  270 ++++++++
 mm/percpu-internal.h                                   |   18 
 mm/percpu.c                                            |   10 
 mm/pgtable-generic.c                                   |    1 
 mm/rmap.c                                              |   43 +
 mm/shmem.c                                             |   91 ++
 mm/slab.h                                              |    5 
 mm/slab_common.c                                       |   34 -
 mm/swap.c                                              |    2 
 mm/swapfile.c                                          |   46 -
 mm/truncate.c                                          |    5 
 mm/userfaultfd.c                                       |    5 
 mm/util.c                                              |   15 
 mm/vmalloc.c                                           |   75 +-
 mm/vmscan.c                                            |    2 
 mm/vmstat.c                                            |    3 
 mm/zpool.c                                             |   12 
 net/ceph/buffer.c                                      |    4 
 net/ceph/ceph_common.c                                 |   27 
 net/ceph/crypto.c                                      |    2 
 net/ceph/messenger.c                                   |    2 
 net/ceph/messenger_v2.c                                |    2 
 net/ceph/osdmap.c                                      |   12 
 net/sunrpc/svc_xprt.c                                  |    3 
 scripts/spelling.txt                                   |    1 
 tools/testing/selftests/vm/charge_reserved_hugetlb.sh  |   34 -
 tools/testing/selftests/vm/hmm-tests.c                 |   42 +
 tools/testing/selftests/vm/hugepage-mremap.c           |   46 -
 tools/testing/selftests/vm/hugetlb_reparenting_test.sh |   21 
 tools/testing/selftests/vm/run_vmtests.sh              |    2 
 tools/testing/selftests/vm/userfaultfd.c               |   33 -
 tools/testing/selftests/vm/write_hugetlb_memory.sh     |    2 
 211 files changed, 3980 insertions(+), 1759 deletions(-)

incoming

[Andrew Morton]

2 patches, based on 4f3d93c6eaff6b84e43b63e0d7a119c5920e1020.

Subsystems affected by this patch series:

  mm/userfaultfd
  mm/damon

Subsystem: mm/userfaultfd

    Mike Kravetz <mike.kravetz@oracle.com>:
      userfaultfd/selftests: fix hugetlb area allocations

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
      mm/damon/dbgfs: fix 'struct pid' leaks in 'dbgfs_target_ids_write()'

 mm/damon/dbgfs.c                         |    9 +++++++--
 tools/testing/selftests/vm/userfaultfd.c |   16 ++++++++++------
 2 files changed, 17 insertions(+), 8 deletions(-)

incoming

[Andrew Morton]

9 patches, based on bc491fb12513e79702c6f936c838f792b5389129.

Subsystems affected by this patch series:

  mm/kfence
  mm/mempolicy
  core-kernel
  MAINTAINERS
  mm/memory-failure
  mm/pagemap
  mm/pagealloc
  mm/damon
  mm/memory-failure

Subsystem: mm/kfence

    Baokun Li <libaokun1@huawei.com>:
      kfence: fix memory leak when cat kfence objects

Subsystem: mm/mempolicy

    Andrey Ryabinin <arbn@yandex-team.com>:
      mm: mempolicy: fix THP allocations escaping mempolicy restrictions

Subsystem: core-kernel

    Philipp Rudo <prudo@redhat.com>:
      kernel/crash_core: suppress unknown crashkernel parameter warning

Subsystem: MAINTAINERS

    Randy Dunlap <rdunlap@infradead.org>:
      MAINTAINERS: mark more list instances as moderated

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm, hwpoison: fix condition in free hugetlb page path

Subsystem: mm/pagemap

    Hugh Dickins <hughd@google.com>:
      mm: delete unsafe BUG from page_cache_add_speculative()

Subsystem: mm/pagealloc

    Thibaut Sautereau <thibaut.sautereau@ssi.gouv.fr>:
      mm/page_alloc: fix __alloc_size attribute for alloc_pages_exact_nid

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
      mm/damon/dbgfs: protect targets destructions with kdamond_lock

Subsystem: mm/memory-failure

    Liu Shixin <liushixin2@huawei.com>:
      mm/hwpoison: clear MF_COUNT_INCREASED before retrying get_any_page()

 MAINTAINERS             |    4 ++--
 include/linux/gfp.h     |    2 +-
 include/linux/pagemap.h |    1 -
 kernel/crash_core.c     |   11 +++++++++++
 mm/damon/dbgfs.c        |    2 ++
 mm/kfence/core.c        |    1 +
 mm/memory-failure.c     |   14 +++++---------
 mm/mempolicy.c          |    3 +--
 8 files changed, 23 insertions(+), 15 deletions(-)

incoming

[Andrew Morton]

21 patches, based on c741e49150dbb0c0aebe234389f4aa8b47958fa8.

Subsystems affected by this patch series:

  mm/mlock
  MAINTAINERS
  mailmap
  mm/pagecache
  mm/damon
  mm/slub
  mm/memcg
  mm/hugetlb
  mm/pagecache

Subsystem: mm/mlock

    Drew DeVault <sir@cmpwn.com>:
      Increase default MLOCK_LIMIT to 8 MiB

Subsystem: MAINTAINERS

    Dave Young <dyoung@redhat.com>:
      MAINTAINERS: update kdump maintainers

Subsystem: mailmap

    Guo Ren <guoren@linux.alibaba.com>:
      mailmap: update email address for Guo Ren

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      filemap: remove PageHWPoison check from next_uptodate_page()

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
    Patch series "mm/damon: Fix fake /proc/loadavg reports", v3:
      timers: implement usleep_idle_range()
      mm/damon/core: fix fake load reports due to uninterruptible sleeps
    Patch series "mm/damon: Trivial fixups and improvements":
      mm/damon/core: use better timer mechanisms selection threshold
      mm/damon/dbgfs: remove an unnecessary error message
      mm/damon/core: remove unnecessary error messages
      mm/damon/vaddr: remove an unnecessary warning message
      mm/damon/vaddr-test: split a test function having >1024 bytes frame size
      mm/damon/vaddr-test: remove unnecessary variables
      selftests/damon: skip test if DAMON is running
      selftests/damon: test DAMON enabling with empty target_ids case
      selftests/damon: test wrong DAMOS condition ranges input
      selftests/damon: test debugfs file reads/writes with huge count
      selftests/damon: split test cases

Subsystem: mm/slub

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/slub: fix endianness bug for alloc/free_traces attributes

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
      mm/memcg: relocate mod_objcg_mlstate(), get_obj_stock() and put_obj_stock()

Subsystem: mm/hugetlb

    Zhenguo Yao <yaozhenguo1@gmail.com>:
      hugetlbfs: fix issue of preallocation of gigantic pages can't work

Subsystem: mm/pagecache

    Manjong Lee <mj0123.lee@samsung.com>:
      mm: bdi: initialize bdi_min_ratio when bdi is unregistered

 .mailmap                                                       |    2 
 MAINTAINERS                                                    |    2 
 include/linux/delay.h                                          |   14 
 include/uapi/linux/resource.h                                  |   13 
 kernel/time/timer.c                                            |   16 -
 mm/backing-dev.c                                               |    7 
 mm/damon/core.c                                                |   20 -
 mm/damon/dbgfs.c                                               |    4 
 mm/damon/vaddr-test.h                                          |   85 ++---
 mm/damon/vaddr.c                                               |    1 
 mm/filemap.c                                                   |    2 
 mm/hugetlb.c                                                   |    2 
 mm/memcontrol.c                                                |  106 +++----
 mm/slub.c                                                      |   15 -
 tools/testing/selftests/damon/.gitignore                       |    2 
 tools/testing/selftests/damon/Makefile                         |    7 
 tools/testing/selftests/damon/_debugfs_common.sh               |   52 +++
 tools/testing/selftests/damon/debugfs_attrs.sh                 |  149 ++--------
 tools/testing/selftests/damon/debugfs_empty_targets.sh         |   13 
 tools/testing/selftests/damon/debugfs_huge_count_read_write.sh |   22 +
 tools/testing/selftests/damon/debugfs_schemes.sh               |   19 +
 tools/testing/selftests/damon/debugfs_target_ids.sh            |   19 +
 tools/testing/selftests/damon/huge_count_read_write.c          |   39 ++
 23 files changed, 363 insertions(+), 248 deletions(-)

incoming

[Andrew Morton]

15 patches, based on a90af8f15bdc9449ee2d24e1d73fa3f7e8633f81.

Subsystems affected by this patch series:

  mm/swap
  ipc
  mm/slab-generic
  hexagon
  mm/kmemleak
  mm/hugetlb
  mm/kasan
  mm/damon
  mm/highmem
  proc

Subsystem: mm/swap

    Matthew Wilcox <willy@infradead.org>:
      mm/swap.c:put_pages_list(): reinitialise the page list

Subsystem: ipc

    Alexander Mikhalitsyn <alexander.mikhalitsyn@virtuozzo.com>:
    Patch series "shm: shm_rmid_forced feature fixes":
      ipc: WARN if trying to remove ipc object which is absent
      shm: extend forced shm destroy to support objects from several IPC nses

Subsystem: mm/slab-generic

    Yunfeng Ye <yeyunfeng@huawei.com>:
      mm: emit the "free" trace report before freeing memory in kmem_cache_free()

Subsystem: hexagon

    Nathan Chancellor <nathan@kernel.org>:
    Patch series "Fixes for ARCH=hexagon allmodconfig", v2:
      hexagon: export raw I/O routines for modules
      hexagon: clean up timer-regs.h
      hexagon: ignore vmlinux.lds

Subsystem: mm/kmemleak

    Rustam Kovhaev <rkovhaev@gmail.com>:
      mm: kmemleak: slob: respect SLAB_NOLEAKTRACE flag

Subsystem: mm/hugetlb

    Bui Quang Minh <minhquangbui99@gmail.com>:
      hugetlb: fix hugetlb cgroup refcounting during mremap

    Mina Almasry <almasrymina@google.com>:
      hugetlb, userfaultfd: fix reservation restore on userfaultfd error

Subsystem: mm/kasan

    Kees Cook <keescook@chromium.org>:
      kasan: test: silence intentional read overflow warnings

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
    Patch series "DAMON fixes":
      mm/damon/dbgfs: use '__GFP_NOWARN' for user-specified size buffer allocation
      mm/damon/dbgfs: fix missed use of damon_dbgfs_lock

Subsystem: mm/highmem

    Ard Biesheuvel <ardb@kernel.org>:
      kmap_local: don't assume kmap PTEs are linear arrays in memory

Subsystem: proc

    David Hildenbrand <david@redhat.com>:
      proc/vmcore: fix clearing user buffer by properly using clear_user()

 arch/arm/Kconfig                      |    1 
 arch/hexagon/include/asm/timer-regs.h |   26 ----
 arch/hexagon/include/asm/timex.h      |    3 
 arch/hexagon/kernel/.gitignore        |    1 
 arch/hexagon/kernel/time.c            |   12 +-
 arch/hexagon/lib/io.c                 |    4 
 fs/proc/vmcore.c                      |   20 ++-
 include/linux/hugetlb_cgroup.h        |   12 ++
 include/linux/ipc_namespace.h         |   15 ++
 include/linux/sched/task.h            |    2 
 ipc/shm.c                             |  189 +++++++++++++++++++++++++---------
 ipc/util.c                            |    6 -
 lib/test_kasan.c                      |    2 
 mm/Kconfig                            |    3 
 mm/damon/dbgfs.c                      |   20 ++-
 mm/highmem.c                          |   32 +++--
 mm/hugetlb.c                          |   11 +
 mm/slab.c                             |    3 
 mm/slab.h                             |    2 
 mm/slob.c                             |    3 
 mm/slub.c                             |    2 
 mm/swap.c                             |    1 
 22 files changed, 254 insertions(+), 116 deletions(-)

incoming

[Andrew Morton]

The post-linux-next material.

7 patches, based on debe436e77c72fcee804fb867f275e6d31aa999c.

Subsystems affected by this patch series:

  mm/debug
  mm/slab-generic
  mm/migration
  mm/memcg
  mm/kasan

Subsystem: mm/debug

    Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
      mm/page_owner.c: modify the type of argument "order" in some functions

Subsystem: mm/slab-generic

    Ingo Molnar <mingo@kernel.org>:
      mm: allow only SLUB on PREEMPT_RT

Subsystem: mm/migration

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: migrate: simplify the file-backed pages validation when migrating its mapping

    Alistair Popple <apopple@nvidia.com>:
      mm/migrate.c: remove MIGRATE_PFN_LOCKED

Subsystem: mm/memcg

    Christoph Hellwig <hch@lst.de>:
    Patch series "unexport memcg locking helpers":
      mm: unexport folio_memcg_{,un}lock
      mm: unexport {,un}lock_page_memcg

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      kasan: add kasan mode messages when kasan init

 Documentation/vm/hmm.rst                 |    2 
 arch/arm64/mm/kasan_init.c               |    2 
 arch/powerpc/kvm/book3s_hv_uvmem.c       |    4 
 drivers/gpu/drm/amd/amdkfd/kfd_migrate.c |    2 
 drivers/gpu/drm/nouveau/nouveau_dmem.c   |    4 
 include/linux/migrate.h                  |    1 
 include/linux/page_owner.h               |   12 +-
 init/Kconfig                             |    2 
 lib/test_hmm.c                           |    5 -
 mm/kasan/hw_tags.c                       |   14 ++
 mm/kasan/sw_tags.c                       |    2 
 mm/memcontrol.c                          |    4 
 mm/migrate.c                             |  151 +++++--------------------------
 mm/page_owner.c                          |    6 -
 14 files changed, 61 insertions(+), 150 deletions(-)

incoming

[Andrew Morton]

87 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813, plus
previously sent material.

Subsystems affected by this patch series:

  mm/pagecache
  mm/hugetlb
  procfs
  misc
  MAINTAINERS
  lib
  checkpatch
  binfmt
  kallsyms
  ramfs
  init
  codafs
  nilfs2
  hfs
  crash_dump
  signals
  seq_file
  fork
  sysvfs
  kcov
  gdb
  resource
  selftests
  ipc

Subsystem: mm/pagecache

    Johannes Weiner <hannes@cmpxchg.org>:
      vfs: keep inodes with page cache off the inode shrinker LRU

Subsystem: mm/hugetlb

    zhangyiru <zhangyiru3@huawei.com>:
      mm,hugetlb: remove mlock ulimit for SHM_HUGETLB

Subsystem: procfs

    Florian Weimer <fweimer@redhat.com>:
      procfs: do not list TID 0 in /proc/<pid>/task

    David Hildenbrand <david@redhat.com>:
      x86/xen: update xen_oldmem_pfn_is_ram() documentation
      x86/xen: simplify xen_oldmem_pfn_is_ram()
      x86/xen: print a warning when HVMOP_get_mem_type fails
      proc/vmcore: let pfn_is_ram() return a bool
      proc/vmcore: convert oldmem_pfn_is_ram callback to more generic vmcore callbacks
      virtio-mem: factor out hotplug specifics from virtio_mem_init() into virtio_mem_init_hotplug()
      virtio-mem: factor out hotplug specifics from virtio_mem_probe() into virtio_mem_init_hotplug()
      virtio-mem: factor out hotplug specifics from virtio_mem_remove() into virtio_mem_deinit_hotplug()
      virtio-mem: kdump mode to sanitize /proc/vmcore access

    Stephen Brennan <stephen.s.brennan@oracle.com>:
      proc: allow pid_revalidate() during LOOKUP_RCU

Subsystem: misc

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
    Patch series "kernel.h further split", v5:
      kernel.h: drop unneeded <linux/kernel.h> inclusion from other headers
      kernel.h: split out container_of() and typeof_member() macros
      include/kunit/test.h: replace kernel.h with the necessary inclusions
      include/linux/list.h: replace kernel.h with the necessary inclusions
      include/linux/llist.h: replace kernel.h with the necessary inclusions
      include/linux/plist.h: replace kernel.h with the necessary inclusions
      include/media/media-entity.h: replace kernel.h with the necessary inclusions
      include/linux/delay.h: replace kernel.h with the necessary inclusions
      include/linux/sbitmap.h: replace kernel.h with the necessary inclusions
      include/linux/radix-tree.h: replace kernel.h with the necessary inclusions
      include/linux/generic-radix-tree.h: replace kernel.h with the necessary inclusions

    Stephen Rothwell <sfr@canb.auug.org.au>:
      kernel.h: split out instruction pointer accessors

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      linux/container_of.h: switch to static_assert

    Colin Ian King <colin.i.king@googlemail.com>:
      mailmap: update email address for Colin King

Subsystem: MAINTAINERS

    Kees Cook <keescook@chromium.org>:
      MAINTAINERS: add "exec & binfmt" section with myself and Eric

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
    Patch series "Rectify file references for dt-bindings in MAINTAINERS", v5:
      MAINTAINERS: rectify entry for ARM/TOSHIBA VISCONTI ARCHITECTURE
      MAINTAINERS: rectify entry for HIKEY960 ONBOARD USB GPIO HUB DRIVER
      MAINTAINERS: rectify entry for INTEL KEEM BAY DRM DRIVER
      MAINTAINERS: rectify entry for ALLWINNER HARDWARE SPINLOCK SUPPORT

Subsystem: lib

    Imran Khan <imran.f.khan@oracle.com>:
    Patch series "lib, stackdepot: check stackdepot handle before accessing slabs", v2:
      lib, stackdepot: check stackdepot handle before accessing slabs
      lib, stackdepot: add helper to print stack entries
      lib, stackdepot: add helper to print stack entries into buffer

    Lucas De Marchi <lucas.demarchi@intel.com>:
      include/linux/string_helpers.h: add linux/string.h for strlen()

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: uninline simple_strntoull() as well

    Thomas Gleixner <tglx@linutronix.de>:
      mm/scatterlist: replace the !preemptible warning in sg_miter_stop()

Subsystem: checkpatch

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add a few sound ops structs

    Joe Perches <joe@perches.com>:
      checkpatch: improve EXPORT_SYMBOL test for EXPORT_SYMBOL_NS uses

    Peter Ujfalusi <peter.ujfalusi@linux.intel.com>:
      checkpatch: get default codespell dictionary path from package location

Subsystem: binfmt

    Kees Cook <keescook@chromium.org>:
      binfmt_elf: reintroduce using MAP_FIXED_NOREPLACE

    Alexey Dobriyan <adobriyan@gmail.com>:
      ELF: simplify STACK_ALLOC macro

Subsystem: kallsyms

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "sections: Unify kernel sections range check and use", v4:
      kallsyms: remove arch specific text and data check
      kallsyms: fix address-checks for kernel related range
      sections: move and rename core_kernel_data() to is_kernel_core_data()
      sections: move is_kernel_inittext() into sections.h
      x86: mm: rename __is_kernel_text() to is_x86_32_kernel_text()
      sections: provide internal __is_kernel() and __is_kernel_text() helper
      mm: kasan: use is_kernel() helper
      extable: use is_kernel_text() helper
      powerpc/mm: use core_kernel_text() helper
      microblaze: use is_kernel_text() helper
      alpha: use is_kernel_text() helper

Subsystem: ramfs

    yangerkun <yangerkun@huawei.com>:
      ramfs: fix mount source show for ramfs

Subsystem: init

    Andrew Halaney <ahalaney@redhat.com>:
      init: make unknown command line param message clearer

Subsystem: codafs

    Jan Harkes <jaharkes@cs.cmu.edu>:
    Patch series "Coda updates for -next":
      coda: avoid NULL pointer dereference from a bad inode
      coda: check for async upcall request using local state

    Alex Shi <alex.shi@linux.alibaba.com>:
      coda: remove err which no one care

    Jan Harkes <jaharkes@cs.cmu.edu>:
      coda: avoid flagging NULL inodes
      coda: avoid hidden code duplication in rename
      coda: avoid doing bad things on inode type changes during revalidation

    Xiyu Yang <xiyuyang19@fudan.edu.cn>:
      coda: convert from atomic_t to refcount_t on coda_vm_ops->refcnt

    Jing Yangyang <jing.yangyang@zte.com.cn>:
      coda: use vmemdup_user to replace the open code

    Jan Harkes <jaharkes@cs.cmu.edu>:
      coda: bump module version to 7.2

Subsystem: nilfs2

    Qing Wang <wangqing@vivo.com>:
    Patch series "nilfs2 updates":
      nilfs2: replace snprintf in show functions with sysfs_emit

    Ryusuke Konishi <konishi.ryusuke@gmail.com>:
      nilfs2: remove filenames from file comments

Subsystem: hfs

    Arnd Bergmann <arnd@arndb.de>:
      hfs/hfsplus: use WARN_ON for sanity check

Subsystem: crash_dump

    Changcheng Deng <deng.changcheng@zte.com.cn>:
      crash_dump: fix boolreturn.cocci warning

    Ye Guojin <ye.guojin@zte.com.cn>:
      crash_dump: remove duplicate include in crash_dump.h

Subsystem: signals

    Ye Guojin <ye.guojin@zte.com.cn>:
      signal: remove duplicate include in signal.h

Subsystem: seq_file

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      seq_file: move seq_escape() to a header

    Muchun Song <songmuchun@bytedance.com>:
      seq_file: fix passing wrong private data

Subsystem: fork

    Ran Xiaokai <ran.xiaokai@zte.com.cn>:
      kernel/fork.c: unshare(): use swap() to make code cleaner

Subsystem: sysvfs

    Pavel Skripkin <paskripkin@gmail.com>:
      sysv: use BUILD_BUG_ON instead of runtime check

Subsystem: kcov

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
    Patch series "kcov: PREEMPT_RT fixup + misc", v2:
      Documentation/kcov: include types.h in the example
      Documentation/kcov: define `ip' in the example
      kcov: allocate per-CPU memory on the relevant node
      kcov: avoid enable+disable interrupts if !in_task()
      kcov: replace local_irq_save() with a local_lock_t

Subsystem: gdb

    Douglas Anderson <dianders@chromium.org>:
      scripts/gdb: handle split debug for vmlinux

Subsystem: resource

    David Hildenbrand <david@redhat.com>:
    Patch series "virtio-mem: disallow mapping virtio-mem memory via /dev/mem", v5:
      kernel/resource: clean up and optimize iomem_is_exclusive()
      kernel/resource: disallow access to exclusive system RAM regions
      virtio-mem: disallow mapping virtio-mem memory via /dev/mem

Subsystem: selftests

    SeongJae Park <sjpark@amazon.de>:
      selftests/kselftest/runner/run_one(): allow running non-executable files

Subsystem: ipc

    Michal Clapinski <mclapinski@google.com>:
      ipc: check checkpoint_restore_ns_capable() to modify C/R proc files

    Manfred Spraul <manfred@colorfullife.com>:
      ipc/ipc_sysctl.c: remove fallback for !CONFIG_PROC_SYSCTL

 .mailmap                                             |    2 
 Documentation/dev-tools/kcov.rst                     |    5 
 MAINTAINERS                                          |   21 +
 arch/alpha/kernel/traps.c                            |    4 
 arch/microblaze/mm/pgtable.c                         |    3 
 arch/powerpc/mm/pgtable_32.c                         |    7 
 arch/riscv/lib/delay.c                               |    4 
 arch/s390/include/asm/facility.h                     |    4 
 arch/x86/kernel/aperture_64.c                        |   13 
 arch/x86/kernel/unwind_orc.c                         |    2 
 arch/x86/mm/init_32.c                                |   14 
 arch/x86/xen/mmu_hvm.c                               |   39 --
 drivers/gpu/drm/drm_dp_mst_topology.c                |    5 
 drivers/gpu/drm/drm_mm.c                             |    5 
 drivers/gpu/drm/i915/i915_vma.c                      |    5 
 drivers/gpu/drm/i915/intel_runtime_pm.c              |   20 -
 drivers/media/dvb-frontends/cxd2880/cxd2880_common.h |    1 
 drivers/virtio/Kconfig                               |    1 
 drivers/virtio/virtio_mem.c                          |  321 +++++++++++++------
 fs/binfmt_elf.c                                      |   33 +
 fs/coda/cnode.c                                      |   13 
 fs/coda/coda_linux.c                                 |   39 +-
 fs/coda/coda_linux.h                                 |    6 
 fs/coda/dir.c                                        |   20 -
 fs/coda/file.c                                       |   12 
 fs/coda/psdev.c                                      |   14 
 fs/coda/upcall.c                                     |    3 
 fs/hfs/inode.c                                       |    6 
 fs/hfsplus/inode.c                                   |   12 
 fs/hugetlbfs/inode.c                                 |   23 -
 fs/inode.c                                           |   46 +-
 fs/internal.h                                        |    1 
 fs/nilfs2/alloc.c                                    |    2 
 fs/nilfs2/alloc.h                                    |    2 
 fs/nilfs2/bmap.c                                     |    2 
 fs/nilfs2/bmap.h                                     |    2 
 fs/nilfs2/btnode.c                                   |    2 
 fs/nilfs2/btnode.h                                   |    2 
 fs/nilfs2/btree.c                                    |    2 
 fs/nilfs2/btree.h                                    |    2 
 fs/nilfs2/cpfile.c                                   |    2 
 fs/nilfs2/cpfile.h                                   |    2 
 fs/nilfs2/dat.c                                      |    2 
 fs/nilfs2/dat.h                                      |    2 
 fs/nilfs2/dir.c                                      |    2 
 fs/nilfs2/direct.c                                   |    2 
 fs/nilfs2/direct.h                                   |    2 
 fs/nilfs2/file.c                                     |    2 
 fs/nilfs2/gcinode.c                                  |    2 
 fs/nilfs2/ifile.c                                    |    2 
 fs/nilfs2/ifile.h                                    |    2 
 fs/nilfs2/inode.c                                    |    2 
 fs/nilfs2/ioctl.c                                    |    2 
 fs/nilfs2/mdt.c                                      |    2 
 fs/nilfs2/mdt.h                                      |    2 
 fs/nilfs2/namei.c                                    |    2 
 fs/nilfs2/nilfs.h                                    |    2 
 fs/nilfs2/page.c                                     |    2 
 fs/nilfs2/page.h                                     |    2 
 fs/nilfs2/recovery.c                                 |    2 
 fs/nilfs2/segbuf.c                                   |    2 
 fs/nilfs2/segbuf.h                                   |    2 
 fs/nilfs2/segment.c                                  |    2 
 fs/nilfs2/segment.h                                  |    2 
 fs/nilfs2/sufile.c                                   |    2 
 fs/nilfs2/sufile.h                                   |    2 
 fs/nilfs2/super.c                                    |    2 
 fs/nilfs2/sysfs.c                                    |   78 ++--
 fs/nilfs2/sysfs.h                                    |    2 
 fs/nilfs2/the_nilfs.c                                |    2 
 fs/nilfs2/the_nilfs.h                                |    2 
 fs/proc/base.c                                       |   21 -
 fs/proc/vmcore.c                                     |  109 ++++--
 fs/ramfs/inode.c                                     |   11 
 fs/seq_file.c                                        |   16 
 fs/sysv/super.c                                      |    6 
 include/asm-generic/sections.h                       |   75 +++-
 include/kunit/test.h                                 |   13 
 include/linux/bottom_half.h                          |    3 
 include/linux/container_of.h                         |   52 ++-
 include/linux/crash_dump.h                           |   30 +
 include/linux/delay.h                                |    2 
 include/linux/fs.h                                   |    1 
 include/linux/fwnode.h                               |    1 
 include/linux/generic-radix-tree.h                   |    3 
 include/linux/hugetlb.h                              |    6 
 include/linux/instruction_pointer.h                  |    8 
 include/linux/kallsyms.h                             |   21 -
 include/linux/kernel.h                               |   39 --
 include/linux/list.h                                 |    4 
 include/linux/llist.h                                |    4 
 include/linux/pagemap.h                              |   50 ++
 include/linux/plist.h                                |    5 
 include/linux/radix-tree.h                           |    4 
 include/linux/rwsem.h                                |    1 
 include/linux/sbitmap.h                              |   11 
 include/linux/seq_file.h                             |   19 +
 include/linux/signal.h                               |    1 
 include/linux/smp.h                                  |    1 
 include/linux/spinlock.h                             |    1 
 include/linux/stackdepot.h                           |    5 
 include/linux/string_helpers.h                       |    1 
 include/media/media-entity.h                         |    3 
 init/main.c                                          |    4 
 ipc/ipc_sysctl.c                                     |   42 +-
 ipc/shm.c                                            |    8 
 kernel/extable.c                                     |   33 -
 kernel/fork.c                                        |    9 
 kernel/kcov.c                                        |   40 +-
 kernel/locking/lockdep.c                             |    3 
 kernel/resource.c                                    |   54 ++-
 kernel/trace/ftrace.c                                |    2 
 lib/scatterlist.c                                    |   11 
 lib/stackdepot.c                                     |   46 ++
 lib/vsprintf.c                                       |    3 
 mm/Kconfig                                           |    7 
 mm/filemap.c                                         |    8 
 mm/kasan/report.c                                    |   17 -
 mm/memfd.c                                           |    4 
 mm/mmap.c                                            |    3 
 mm/page_owner.c                                      |   18 -
 mm/truncate.c                                        |   19 +
 mm/vmscan.c                                          |    7 
 mm/workingset.c                                      |   10 
 net/sysctl_net.c                                     |    2 
 scripts/checkpatch.pl                                |   33 +
 scripts/const_structs.checkpatch                     |    4 
 scripts/gdb/linux/symbols.py                         |    3 
 tools/testing/selftests/kselftest/runner.sh          |   28 +
 tools/testing/selftests/proc/.gitignore              |    1 
 tools/testing/selftests/proc/Makefile                |    2 
 tools/testing/selftests/proc/proc-tid0.c             |   81 ++++
 132 files changed, 1206 insertions(+), 681 deletions(-)

incoming

[Andrew Morton]

262 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813

Subsystems affected by this patch series:

  scripts
  ocfs2
  vfs
  mm/slab-generic
  mm/slab
  mm/slub
  mm/kconfig
  mm/dax
  mm/kasan
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/mremap
  mm/iomap
  mm/tracing
  mm/vmalloc
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/tools
  mm/memblock
  mm/oom-kill
  mm/hugetlbfs
  mm/migration
  mm/thp
  mm/readahead
  mm/nommu
  mm/ksm
  mm/vmstat
  mm/madvise
  mm/memory-hotplug
  mm/rmap
  mm/zsmalloc
  mm/highmem
  mm/zram
  mm/cleanups
  mm/kfence
  mm/damon

Subsystem: scripts

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

    Sven Eckelmann <sven@narfation.org>:
      scripts/spelling.txt: fix "mistake" version of "synchronization"

    weidonghui <weidonghui@allwinnertech.com>:
      scripts/decodecode: fix faulting instruction no print when opps.file is DOS format

Subsystem: ocfs2

    Chenyuan Mi <cymi20@fudan.edu.cn>:
      ocfs2: fix handle refcount leak in two exception handling paths

    Valentin Vidic <vvidic@valentin-vidic.from.hr>:
      ocfs2: cleanup journal init and shutdown

    Colin Ian King <colin.king@canonical.com>:
      ocfs2/dlm: remove redundant assignment of variable ret

    Jan Kara <jack@suse.cz>:
    Patch series "ocfs2: Truncate data corruption fix":
      ocfs2: fix data corruption on truncate
      ocfs2: do not zero pages beyond i_size

Subsystem: vfs

    Arnd Bergmann <arnd@arndb.de>:
      fs/posix_acl.c: avoid -Wempty-body warning

    Jia He <justin.he@arm.com>:
      d_path: fix Kernel doc validator complaining

Subsystem: mm/slab-generic

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move kvmalloc-related functions to slab.h

Subsystem: mm/slab

    Shi Lei <shi_lei@massclouds.com>:
      mm/slab.c: remove useless lines in enable_cpucache()

Subsystem: mm/slub

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      slub: add back check for free nonslab objects

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: change percpu partial accounting from objects to pages
      mm/slub: increase default cpu partial list sizes

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm, slub: use prefetchw instead of prefetch

Subsystem: mm/kconfig

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: disable NUMA_BALANCING_DEFAULT_ENABLED and TRANSPARENT_HUGEPAGE on PREEMPT_RT

Subsystem: mm/dax

    Christoph Hellwig <hch@lst.de>:
      mm: don't include <linux/dax.h> in <linux/mempolicy.h>

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
    Patch series "stackdepot, kasan, workqueue: Avoid expanding stackdepot slabs when holding raw_spin_lock", v2:
      lib/stackdepot: include gfp.h
      lib/stackdepot: remove unused function argument
      lib/stackdepot: introduce __stack_depot_save()
      kasan: common: provide can_alloc in kasan_save_stack()
      kasan: generic: introduce kasan_record_aux_stack_noalloc()
      workqueue, kasan: avoid alloc_pages() when recording stack

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      kasan: fix tag for large allocations when using CONFIG_SLAB

    Peter Collingbourne <pcc@google.com>:
      kasan: test: add memcpy test that avoids out-of-bounds write

Subsystem: mm/debug

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/smaps: Fixes and optimizations on shmem swap handling":
      mm/smaps: fix shmem pte hole swap calculation
      mm/smaps: use vma->vm_pgoff directly when counting partial swap
      mm/smaps: simplify shmem handling of pte holes

    Guo Ren <guoren@linux.alibaba.com>:
      mm: debug_vm_pgtable: don't use __P000 directly

    Kees Cook <keescook@chromium.org>:
      kasan: test: bypass __alloc_size checks
    Patch series "Add __alloc_size()", v3:
      rapidio: avoid bogus __alloc_size warning
      Compiler Attributes: add __alloc_size() for better bounds checking
      slab: clean up function prototypes
      slab: add __alloc_size attributes for better bounds checking
      mm/kvmalloc: add __alloc_size attributes for better bounds checking
      mm/vmalloc: add __alloc_size attributes for better bounds checking
      mm/page_alloc: add __alloc_size attributes for better bounds checking
      percpu: add __alloc_size attributes for better bounds checking

    Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
      mm/page_ext.c: fix a comment

Subsystem: mm/pagecache

    David Howells <dhowells@redhat.com>:
      mm: stop filemap_read() from grabbing a superfluous page

    Christoph Hellwig <hch@lst.de>:
    Patch series "simplify bdi unregistation":
      mm: export bdi_unregister
      mtd: call bdi_unregister explicitly
      fs: explicitly unregister per-superblock BDIs
      mm: don't automatically unregister bdis
      mm: simplify bdi refcounting

    Jens Axboe <axboe@kernel.dk>:
      mm: don't read i_size of inode unless we need it

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap.c: remove bogus VM_BUG_ON

    Jens Axboe <axboe@kernel.dk>:
      mm: move more expensive part of XA setup out of mapping check

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: further simplify __gup_device_huge()

Subsystem: mm/swap

    Xu Wang <vulab@iscas.ac.cn>:
      mm/swapfile: remove needless request_queue NULL pointer check

    Rafael Aquini <aquini@redhat.com>:
      mm/swapfile: fix an integer overflow in swap_show()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: optimise put_pages_list()

Subsystem: mm/memcg

    Peter Xu <peterx@redhat.com>:
      mm/memcg: drop swp_entry_t* in mc_handle_file_pte()

    Shakeel Butt <shakeelb@google.com>:
      memcg: flush stats only if updated
      memcg: unify memcg stat flushing

    Waiman Long <longman@redhat.com>:
      mm/memcg: remove obsolete memcg_free_kmem()

    Len Baker <len.baker@gmx.com>:
      mm/list_lru.c: prefer struct_size over open coded arithmetic

    Shakeel Butt <shakeelb@google.com>:
      memcg, kmem: further deprecate kmem.limit_in_bytes

    Muchun Song <songmuchun@bytedance.com>:
      mm: list_lru: remove holding lru lock
      mm: list_lru: fix the return value of list_lru_count_one()
      mm: memcontrol: remove kmemcg_id reparenting
      mm: memcontrol: remove the kmem states
      mm: list_lru: only add memcg-aware lrus to the global lru list

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "memcg: prohibit unconditional exceeding the limit of dying tasks", v3:
      mm, oom: pagefault_out_of_memory: don't force global OOM for dying tasks

    Michal Hocko <mhocko@suse.com>:
      mm, oom: do not trigger out_of_memory from the #PF

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: prohibit unconditional exceeding the limit of dying tasks

Subsystem: mm/pagemap

    Peng Liu <liupeng256@huawei.com>:
      mm/mmap.c: fix a data race of mm->total_vm

    Rolf Eike Beer <eb@emlix.com>:
      mm: use __pfn_to_section() instead of open coding it

    Amit Daniel Kachhap <amit.kachhap@arm.com>:
      mm/memory.c: avoid unnecessary kernel/user pointer conversion

    Nadav Amit <namit@vmware.com>:
      mm/memory.c: use correct VMA flags when freeing page-tables

    Peter Xu <peterx@redhat.com>:
    Patch series "mm: A few cleanup patches around zap, shmem and uffd", v4:
      mm/shmem: unconditionally set pte dirty in mfill_atomic_install_pte
      mm: clear vmf->pte after pte_unmap_same() returns
      mm: drop first_index/last_index in zap_details
      mm: add zap_skip_check_mapping() helper

    Qi Zheng <zhengqi.arch@bytedance.com>:
    Patch series "Do some code cleanups related to mm", v3:
      mm: introduce pmd_install() helper
      mm: remove redundant smp_wmb()

    Tiberiu A Georgescu <tiberiu.georgescu@nutanix.com>:
      Documentation: update pagemap with shmem exceptions

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "shoot lazy tlbs", v4:
      lazy tlb: introduce lazy mm refcount helper functions
      lazy tlb: allow lazy tlb mm refcounting to be configurable
      lazy tlb: shoot lazies, a non-refcounting lazy tlb option
      powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      memory: remove unused CONFIG_MEM_BLOCK_SIZE

Subsystem: mm/mprotect

    Liu Song <liu.song11@zte.com.cn>:
      mm/mprotect.c: avoid repeated assignment in do_mprotect_pkey()

Subsystem: mm/mremap

    Dmitry Safonov <dima@arista.com>:
      mm/mremap: don't account pages in vma_to_resize()

Subsystem: mm/iomap

    Lucas De Marchi <lucas.demarchi@intel.com>:
      include/linux/io-mapping.h: remove fallback for writecombine

Subsystem: mm/tracing

    Gang Li <ligang.bdlg@bytedance.com>:
      mm: mmap_lock: remove redundant newline  in TP_printk
      mm: mmap_lock: use DECLARE_EVENT_CLASS and DEFINE_EVENT_FN

Subsystem: mm/vmalloc

    Vasily Averin <vvs@virtuozzo.com>:
      mm/vmalloc: repair warn_alloc()s in __vmalloc_area_node()

    Peter Zijlstra <peterz@infradead.org>:
      mm/vmalloc: don't allow VM_NO_GUARD on vmap()

    Eric Dumazet <edumazet@google.com>:
      mm/vmalloc: make show_numa_info() aware of hugepage mappings
      mm/vmalloc: make sure to dump unpurged areas in /proc/vmallocinfo

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: do not adjust the search size for alignment overhead
      mm/vmalloc: check various alignments when debugging

    Vasily Averin <vvs@virtuozzo.com>:
      vmalloc: back off when the current task is OOM-killed

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      vmalloc: choose a better start address in vm_area_register_early()
      arm64: support page mapping percpu first chunk allocator
      kasan: arm64: fix pcpu_page_first_chunk crash with KASAN_VMALLOC

    Michal Hocko <mhocko@suse.com>:
      mm/vmalloc: be more explicit about supported gfp flags

    Chen Wandun <chenwandun@huawei.com>:
      mm/vmalloc: introduce alloc_pages_bulk_array_mempolicy to accelerate memory allocation

    Changcheng Deng <deng.changcheng@zte.com.cn>:
      lib/test_vmalloc.c: use swap() to make code cleaner

Subsystem: mm/pagealloc

    Eric Dumazet <edumazet@google.com>:
      mm/large system hash: avoid possible NULL deref in alloc_large_system_hash

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for page_alloc", v2:
      mm/page_alloc.c: remove meaningless VM_BUG_ON() in pindex_to_order()
      mm/page_alloc.c: simplify the code by using macro K()
      mm/page_alloc.c: fix obsolete comment in free_pcppages_bulk()
      mm/page_alloc.c: use helper function zone_spans_pfn()
      mm/page_alloc.c: avoid allocating highmem pages via alloc_pages_exact[_nid]

    Bharata B Rao <bharata@amd.com>:
    Patch series "Fix NUMA nodes fallback list ordering":
      mm/page_alloc: print node fallback order

    Krupa Ramakrishnan <krupa.ramakrishnan@amd.com>:
      mm/page_alloc: use accumulated load when building node fallback list

    Geert Uytterhoeven <geert+renesas@glider.be>:
    Patch series "Fix NUMA without SMP":
      mm: move node_reclaim_distance to fix NUMA without SMP
      mm: move fold_vm_numa_events() to fix NUMA without SMP

    Eric Dumazet <edumazet@google.com>:
      mm/page_alloc.c: do not acquire zone lock in is_free_buddy_page()

    Feng Tang <feng.tang@intel.com>:
      mm/page_alloc: detect allocation forbidden by cpuset and bail out early

    Liangcai Fan <liangcaifan19@gmail.com>:
      mm/page_alloc.c: show watermark_boost of zone in zoneinfo

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: create a new system state and fix core_kernel_text()
      mm: make generic arch_is_kernel_initmem_freed() do what it says
      powerpc: use generic version of arch_is_kernel_initmem_freed()
      s390: use generic version of arch_is_kernel_initmem_freed()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: page_alloc: use migrate_disable() in drain_local_pages_wq()

    Wang ShaoBo <bobo.shaobowang@huawei.com>:
      mm/page_alloc: use clamp() to simplify code

Subsystem: mm/memory-failure

    Marco Elver <elver@google.com>:
      mm: fix data race in PagePoisoned()

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      mm/memory_failure: constify static mm_walk_ops

    Yang Shi <shy828301@gmail.com>:
    Patch series "Solve silent data loss caused by poisoned page cache (shmem/tmpfs)", v5:
      mm: filemap: coding style cleanup for filemap_map_pmd()
      mm: hwpoison: refactor refcount check handling
      mm: shmem: don't truncate page if memory failure happens
      mm: hwpoison: handle non-anonymous THP correctly

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
      mm/hugetlb: drop __unmap_hugepage_range definition from hugetlb.h

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "hugetlb: add demote/split page functionality", v4:
      hugetlb: add demote hugetlb page sysfs interfaces
      mm/cma: add cma_pages_valid to determine if pages are in CMA
      hugetlb: be sure to free demoted CMA pages to CMA
      hugetlb: add demote bool to gigantic page routines
      hugetlb: add hugetlb demote page support

    Liangcai Fan <liangcaifan19@gmail.com>:
      mm: khugepaged: recalculate min_free_kbytes after stopping khugepaged

    Mina Almasry <almasrymina@google.com>:
      mm, hugepages: add mremap() support for hugepage backed vma
      mm, hugepages: add hugetlb vma mremap() test

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      hugetlb: support node specified when using cma for gigantic hugepages

    Ran Jianping <ran.jianping@zte.com.cn>:
      mm: remove duplicate include in hugepage-mremap.c

    Baolin Wang <baolin.wang@linux.alibaba.com>:
    Patch series "Some cleanups and improvements for hugetlb":
      hugetlb_cgroup: remove unused hugetlb_cgroup_from_counter macro
      hugetlb: replace the obsolete hugetlb_instantiation_mutex in the comments
      hugetlb: remove redundant validation in has_same_uncharge_info()
      hugetlb: remove redundant VM_BUG_ON() in add_reservation_in_range()

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: remove unnecessary set_page_count in prep_compound_gigantic_page

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "Small userfaultfd selftest fixups", v2:
      userfaultfd/selftests: don't rely on GNU extensions for random numbers
      userfaultfd/selftests: fix feature support detection
      userfaultfd/selftests: fix calculation of expected ioctls

Subsystem: mm/vmscan

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_isolation: fix potential missing call to unset_migratetype_isolate()
      mm/page_isolation: guard against possible putback unisolated page

    Kai Song <songkai01@inspur.com>:
      mm/vmscan.c: fix -Wunused-but-set-variable warning

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Remove dependency on congestion_wait in mm/", v5. Patch series:
      mm/vmscan: throttle reclaim until some writeback completes if congested
      mm/vmscan: throttle reclaim and compaction when too may pages are isolated
      mm/vmscan: throttle reclaim when no progress is being made
      mm/writeback: throttle based on page writeback instead of congestion
      mm/page_alloc: remove the throttling logic from the page allocator
      mm/vmscan: centralise timeout values for reclaim_throttle
      mm/vmscan: increase the timeout if page reclaim is not making progress
      mm/vmscan: delay waking of tasks throttled on NOPROGRESS

    Yuanzheng Song <songyuanzheng@huawei.com>:
      mm/vmpressure: fix data-race with memcg->socket_pressure

Subsystem: mm/tools

    Zhenliang Wei <weizhenliang@huawei.com>:
      tools/vm/page_owner_sort.c: count and sort by mem

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
    Patch series "tools/vm/page-types.c: a few improvements":
      tools/vm/page-types.c: make walk_file() aware of address range option
      tools/vm/page-types.c: move show_file() to summary output
      tools/vm/page-types.c: print file offset in hexadecimal

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "memblock: cleanup memblock_free interface", v2:
      arch_numa: simplify numa_distance allocation
      xen/x86: free_p2m_page: use memblock_free_ptr() to free a virtual pointer
      memblock: drop memblock_free_early_nid() and memblock_free_early()
      memblock: stop aliasing __memblock_free_late with memblock_free_late
      memblock: rename memblock_free to memblock_phys_free
      memblock: use memblock_free for freeing virtual pointers

Subsystem: mm/oom-kill

    Sultan Alsawaf <sultan@kerneltoast.com>:
      mm: mark the OOM reaper thread as freezable

Subsystem: mm/hugetlbfs

    Zhenguo Yao <yaozhenguo1@gmail.com>:
      hugetlbfs: extend the definition of hugepages parameter to support node allocation

Subsystem: mm/migration

    John Hubbard <jhubbard@nvidia.com>:
      mm/migrate: de-duplicate migrate_reason strings

    Yang Shi <shy828301@gmail.com>:
      mm: migrate: make demotion knob depend on migration

Subsystem: mm/thp

    "George G. Davis" <davis.george@siemens.com>:
      selftests/vm/transhuge-stress: fix ram size thinko

    Rongwei Wang <rongwei.wang@linux.alibaba.com>:
    Patch series "fix two bugs for file THP":
      mm, thp: lock filemap when truncating page cache
      mm, thp: fix incorrect unmap behavior for private pages

Subsystem: mm/readahead

    Lin Feng <linf@wangsu.com>:
      mm/readahead.c: fix incorrect comments for get_init_ra_size

Subsystem: mm/nommu

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: nommu: kill arch_get_unmapped_area()

Subsystem: mm/ksm

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      selftest/vm: fix ksm selftest to run with different NUMA topologies

    Pedro Demarchi Gomes <pedrodemargomes@gmail.com>:
      selftests: vm: add KSM huge pages merging time test

Subsystem: mm/vmstat

    Liu Shixin <liushixin2@huawei.com>:
      mm/vmstat: annotate data race for zone->free_area[order].nr_free

    Lin Feng <linf@wangsu.com>:
      mm: vmstat.c: make extfrag_index show more pretty

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
      selftests/vm: make MADV_POPULATE_(READ|WRITE) use in-tree headers

Subsystem: mm/memory-hotplug

    Tang Yizhou <tangyizhou@huawei.com>:
      mm/memory_hotplug: add static qualifier for online_policy_to_str()

    David Hildenbrand <david@redhat.com>:
    Patch series "memory-hotplug.rst: document the "auto-movable" online policy":
      memory-hotplug.rst: fix two instances of "movablecore" that should be "movable_node"
      memory-hotplug.rst: fix wrong /sys/module/memory_hotplug/parameters/ path
      memory-hotplug.rst: document the "auto-movable" online policy
    Patch series "mm/memory_hotplug: Kconfig and 32 bit cleanups":
      mm/memory_hotplug: remove CONFIG_X86_64_ACPI_NUMA dependency from CONFIG_MEMORY_HOTPLUG
      mm/memory_hotplug: remove CONFIG_MEMORY_HOTPLUG_SPARSE
      mm/memory_hotplug: restrict CONFIG_MEMORY_HOTPLUG to 64 bit
      mm/memory_hotplug: remove HIGHMEM leftovers
      mm/memory_hotplug: remove stale function declarations
      x86: remove memory hotplug support on X86_32
    Patch series "mm/memory_hotplug: full support for add_memory_driver_managed() with CONFIG_ARCH_KEEP_MEMBLOCK", v2:
      mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource()
      memblock: improve MEMBLOCK_HOTPLUG documentation
      memblock: allow to specify flags with memblock_add_node()
      memblock: add MEMBLOCK_DRIVER_MANAGED to mimic IORESOURCE_SYSRAM_DRIVER_MANAGED
      mm/memory_hotplug: indicate MEMBLOCK_DRIVER_MANAGED with IORESOURCE_SYSRAM_DRIVER_MANAGED

Subsystem: mm/rmap

    Alistair Popple <apopple@nvidia.com>:
      mm/rmap.c: avoid double faults migrating device private pages

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: close race window between zs_pool_dec_isolated() and zs_unregister_migration()

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem: remove deprecated kmap_atomic

Subsystem: mm/zram

    Jaewon Kim <jaewon31.kim@samsung.com>:
      zram_drv: allow reclaim on bio_alloc

    Dan Carpenter <dan.carpenter@oracle.com>:
      zram: off by one in read_block_state()

    Brian Geffon <bgeffon@google.com>:
      zram: introduce an aged idle interface

Subsystem: mm/cleanups

    Stephen Kitt <steve@sk2.org>:
      mm: remove HARDENED_USERCOPY_FALLBACK

    Mianhan Liu <liumh1@shanghaitech.edu.cn>:
      include/linux/mm.h: move nr_free_buffer_pages from swap.h to mm.h

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      stacktrace: move filter_irq_stacks() to kernel/stacktrace.c
      kfence: count unexpectedly skipped allocations
      kfence: move saving stack trace of allocations into __kfence_alloc()
      kfence: limit currently covered allocations when pool nearly full
      kfence: add note to documentation about skipping covered allocations
      kfence: test: use kunit_skip() to skip tests
      kfence: shorten critical sections of alloc/free
      kfence: always use static branches to guard kfence_alloc()
      kfence: default to dynamic branch instead of static keys mode

Subsystem: mm/damon

    Geert Uytterhoeven <geert@linux-m68k.org>:
      mm/damon: grammar s/works/work/

    SeongJae Park <sjpark@amazon.de>:
      Documentation/vm: move user guides to admin-guide/mm/

    SeongJae Park <sj@kernel.org>:
      MAINTAINERS: update SeongJae's email address

    SeongJae Park <sjpark@amazon.de>:
      docs/vm/damon: remove broken reference
      include/linux/damon.h: fix kernel-doc comments for 'damon_callback'

    SeongJae Park <sj@kernel.org>:
      mm/damon/core: print kdamond start log in debug mode only

    Changbin Du <changbin.du@gmail.com>:
      mm/damon: remove unnecessary do_exit() from kdamond
      mm/damon: needn't hold kdamond_lock to print pid of kdamond

    Colin Ian King <colin.king@canonical.com>:
      mm/damon/core: nullify pointer ctx->kdamond with a NULL

    SeongJae Park <sj@kernel.org>:
    Patch series "Implement Data Access Monitoring-based Memory Operation Schemes":
      mm/damon/core: account age of target regions
      mm/damon/core: implement DAMON-based Operation Schemes (DAMOS)
      mm/damon/vaddr: support DAMON-based Operation Schemes
      mm/damon/dbgfs: support DAMON-based Operation Schemes
      mm/damon/schemes: implement statistics feature
      selftests/damon: add 'schemes' debugfs tests
      Docs/admin-guide/mm/damon: document DAMON-based Operation Schemes
    Patch series "DAMON: Support Physical Memory Address Space Monitoring::
      mm/damon/dbgfs: allow users to set initial monitoring target regions
      mm/damon/dbgfs-test: add a unit test case for 'init_regions'
      Docs/admin-guide/mm/damon: document 'init_regions' feature
      mm/damon/vaddr: separate commonly usable functions
      mm/damon: implement primitives for physical address space monitoring
      mm/damon/dbgfs: support physical memory monitoring
      Docs/DAMON: document physical memory monitoring support

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      mm/damon/vaddr: constify static mm_walk_ops

    Rongwei Wang <rongwei.wang@linux.alibaba.com>:
      mm/damon/dbgfs: remove unnecessary variables

    SeongJae Park <sj@kernel.org>:
      mm/damon/paddr: support the pageout scheme
      mm/damon/schemes: implement size quota for schemes application speed control
      mm/damon/schemes: skip already charged targets and regions
      mm/damon/schemes: implement time quota
      mm/damon/dbgfs: support quotas of schemes
      mm/damon/selftests: support schemes quotas
      mm/damon/schemes: prioritize regions within the quotas
      mm/damon/vaddr,paddr: support pageout prioritization
      mm/damon/dbgfs: support prioritization weights
      tools/selftests/damon: update for regions prioritization of schemes
      mm/damon/schemes: activate schemes based on a watermarks mechanism
      mm/damon/dbgfs: support watermarks
      selftests/damon: support watermarks
      mm/damon: introduce DAMON-based Reclamation (DAMON_RECLAIM)
      Documentation/admin-guide/mm/damon: add a document for DAMON_RECLAIM

    Xin Hao <xhao@linux.alibaba.com>:
    Patch series "mm/damon: Fix some small bugs", v4:
      mm/damon: remove unnecessary variable initialization
      mm/damon/dbgfs: add adaptive_targets list check before enable monitor_on

    SeongJae Park <sj@kernel.org>:
    Patch series "Fix trivial nits in Documentation/admin-guide/mm":
      Docs/admin-guide/mm/damon/start: fix wrong example commands
      Docs/admin-guide/mm/damon/start: fix a wrong link
      Docs/admin-guide/mm/damon/start: simplify the content
      Docs/admin-guide/mm/pagemap: wordsmith page flags descriptions

    Changbin Du <changbin.du@gmail.com>:
      mm/damon: simplify stop mechanism

    Colin Ian King <colin.i.king@googlemail.com>:
      mm/damon: fix a few spelling mistakes in comments and a pr_debug message

    Changbin Du <changbin.du@gmail.com>:
      mm/damon: remove return value from before_terminate callback

 a/Documentation/admin-guide/blockdev/zram.rst                  |    8 
 a/Documentation/admin-guide/cgroup-v1/memory.rst               |   11 
 a/Documentation/admin-guide/kernel-parameters.txt              |   14 
 a/Documentation/admin-guide/mm/damon/index.rst                 |    1 
 a/Documentation/admin-guide/mm/damon/reclaim.rst               |  235 +++
 a/Documentation/admin-guide/mm/damon/start.rst                 |  140 +
 a/Documentation/admin-guide/mm/damon/usage.rst                 |  117 +
 a/Documentation/admin-guide/mm/hugetlbpage.rst                 |   42 
 a/Documentation/admin-guide/mm/memory-hotplug.rst              |  147 +-
 a/Documentation/admin-guide/mm/pagemap.rst                     |   75 -
 a/Documentation/core-api/memory-hotplug.rst                    |    3 
 a/Documentation/dev-tools/kfence.rst                           |   23 
 a/Documentation/translations/zh_CN/core-api/memory-hotplug.rst |    4 
 a/Documentation/vm/damon/design.rst                            |   29 
 a/Documentation/vm/damon/faq.rst                               |    5 
 a/Documentation/vm/damon/index.rst                             |    1 
 a/Documentation/vm/page_owner.rst                              |   23 
 a/MAINTAINERS                                                  |    2 
 a/Makefile                                                     |   15 
 a/arch/Kconfig                                                 |   28 
 a/arch/alpha/kernel/core_irongate.c                            |    6 
 a/arch/arc/mm/init.c                                           |    6 
 a/arch/arm/mach-hisi/platmcpm.c                                |    2 
 a/arch/arm/mach-rpc/ecard.c                                    |    2 
 a/arch/arm/mm/init.c                                           |    2 
 a/arch/arm64/Kconfig                                           |    4 
 a/arch/arm64/mm/kasan_init.c                                   |   16 
 a/arch/arm64/mm/mmu.c                                          |    4 
 a/arch/ia64/mm/contig.c                                        |    2 
 a/arch/ia64/mm/init.c                                          |    2 
 a/arch/m68k/mm/mcfmmu.c                                        |    3 
 a/arch/m68k/mm/motorola.c                                      |    6 
 a/arch/mips/loongson64/init.c                                  |    4 
 a/arch/mips/mm/init.c                                          |    6 
 a/arch/mips/sgi-ip27/ip27-memory.c                             |    3 
 a/arch/mips/sgi-ip30/ip30-setup.c                              |    6 
 a/arch/powerpc/Kconfig                                         |    1 
 a/arch/powerpc/configs/skiroot_defconfig                       |    1 
 a/arch/powerpc/include/asm/machdep.h                           |    2 
 a/arch/powerpc/include/asm/sections.h                          |   13 
 a/arch/powerpc/kernel/dt_cpu_ftrs.c                            |    8 
 a/arch/powerpc/kernel/paca.c                                   |    8 
 a/arch/powerpc/kernel/setup-common.c                           |    4 
 a/arch/powerpc/kernel/setup_64.c                               |    6 
 a/arch/powerpc/kernel/smp.c                                    |    2 
 a/arch/powerpc/mm/book3s64/radix_tlb.c                         |    4 
 a/arch/powerpc/mm/hugetlbpage.c                                |    9 
 a/arch/powerpc/platforms/powernv/pci-ioda.c                    |    4 
 a/arch/powerpc/platforms/powernv/setup.c                       |    4 
 a/arch/powerpc/platforms/pseries/setup.c                       |    2 
 a/arch/powerpc/platforms/pseries/svm.c                         |    9 
 a/arch/riscv/kernel/setup.c                                    |   10 
 a/arch/s390/include/asm/sections.h                             |   12 
 a/arch/s390/kernel/setup.c                                     |   11 
 a/arch/s390/kernel/smp.c                                       |    6 
 a/arch/s390/kernel/uv.c                                        |    2 
 a/arch/s390/mm/init.c                                          |    3 
 a/arch/s390/mm/kasan_init.c                                    |    2 
 a/arch/sh/boards/mach-ap325rxa/setup.c                         |    2 
 a/arch/sh/boards/mach-ecovec24/setup.c                         |    4 
 a/arch/sh/boards/mach-kfr2r09/setup.c                          |    2 
 a/arch/sh/boards/mach-migor/setup.c                            |    2 
 a/arch/sh/boards/mach-se/7724/setup.c                          |    4 
 a/arch/sparc/kernel/smp_64.c                                   |    4 
 a/arch/um/kernel/mem.c                                         |    4 
 a/arch/x86/Kconfig                                             |    6 
 a/arch/x86/kernel/setup.c                                      |    4 
 a/arch/x86/kernel/setup_percpu.c                               |    2 
 a/arch/x86/mm/init.c                                           |    2 
 a/arch/x86/mm/init_32.c                                        |   31 
 a/arch/x86/mm/kasan_init_64.c                                  |    4 
 a/arch/x86/mm/numa.c                                           |    2 
 a/arch/x86/mm/numa_emulation.c                                 |    2 
 a/arch/x86/xen/mmu_pv.c                                        |    8 
 a/arch/x86/xen/p2m.c                                           |    4 
 a/arch/x86/xen/setup.c                                         |    6 
 a/drivers/base/Makefile                                        |    2 
 a/drivers/base/arch_numa.c                                     |   96 +
 a/drivers/base/node.c                                          |    9 
 a/drivers/block/zram/zram_drv.c                                |   66 
 a/drivers/firmware/efi/memmap.c                                |    2 
 a/drivers/hwmon/occ/p9_sbe.c                                   |    1 
 a/drivers/macintosh/smu.c                                      |    2 
 a/drivers/mmc/core/mmc_test.c                                  |    1 
 a/drivers/mtd/mtdcore.c                                        |    1 
 a/drivers/of/kexec.c                                           |    4 
 a/drivers/of/of_reserved_mem.c                                 |    5 
 a/drivers/rapidio/devices/rio_mport_cdev.c                     |    9 
 a/drivers/s390/char/sclp_early.c                               |    4 
 a/drivers/usb/early/xhci-dbc.c                                 |   10 
 a/drivers/virtio/Kconfig                                       |    2 
 a/drivers/xen/swiotlb-xen.c                                    |    4 
 a/fs/d_path.c                                                  |    8 
 a/fs/exec.c                                                    |    4 
 a/fs/ocfs2/alloc.c                                             |   21 
 a/fs/ocfs2/dlm/dlmrecovery.c                                   |    1 
 a/fs/ocfs2/file.c                                              |    8 
 a/fs/ocfs2/inode.c                                             |    4 
 a/fs/ocfs2/journal.c                                           |   28 
 a/fs/ocfs2/journal.h                                           |    3 
 a/fs/ocfs2/super.c                                             |   40 
 a/fs/open.c                                                    |   16 
 a/fs/posix_acl.c                                               |    3 
 a/fs/proc/task_mmu.c                                           |   28 
 a/fs/super.c                                                   |    3 
 a/include/asm-generic/sections.h                               |   14 
 a/include/linux/backing-dev-defs.h                             |    3 
 a/include/linux/backing-dev.h                                  |    1 
 a/include/linux/cma.h                                          |    1 
 a/include/linux/compiler-gcc.h                                 |    8 
 a/include/linux/compiler_attributes.h                          |   10 
 a/include/linux/compiler_types.h                               |   12 
 a/include/linux/cpuset.h                                       |   17 
 a/include/linux/damon.h                                        |  258 +++
 a/include/linux/fs.h                                           |    1 
 a/include/linux/gfp.h                                          |    8 
 a/include/linux/highmem.h                                      |   28 
 a/include/linux/hugetlb.h                                      |   36 
 a/include/linux/io-mapping.h                                   |    6 
 a/include/linux/kasan.h                                        |    8 
 a/include/linux/kernel.h                                       |    1 
 a/include/linux/kfence.h                                       |   21 
 a/include/linux/memblock.h                                     |   48 
 a/include/linux/memcontrol.h                                   |    9 
 a/include/linux/memory.h                                       |   26 
 a/include/linux/memory_hotplug.h                               |    3 
 a/include/linux/mempolicy.h                                    |    5 
 a/include/linux/migrate.h                                      |   23 
 a/include/linux/migrate_mode.h                                 |   13 
 a/include/linux/mm.h                                           |   57 
 a/include/linux/mm_types.h                                     |    2 
 a/include/linux/mmzone.h                                       |   41 
 a/include/linux/node.h                                         |    4 
 a/include/linux/page-flags.h                                   |    2 
 a/include/linux/percpu.h                                       |    6 
 a/include/linux/sched/mm.h                                     |   25 
 a/include/linux/slab.h                                         |  181 +-
 a/include/linux/slub_def.h                                     |   13 
 a/include/linux/stackdepot.h                                   |    8 
 a/include/linux/stacktrace.h                                   |    1 
 a/include/linux/swap.h                                         |    1 
 a/include/linux/vmalloc.h                                      |   24 
 a/include/trace/events/mmap_lock.h                             |   50 
 a/include/trace/events/vmscan.h                                |   42 
 a/include/trace/events/writeback.h                             |    7 
 a/init/Kconfig                                                 |    2 
 a/init/initramfs.c                                             |    4 
 a/init/main.c                                                  |    6 
 a/kernel/cgroup/cpuset.c                                       |   23 
 a/kernel/cpu.c                                                 |    2 
 a/kernel/dma/swiotlb.c                                         |    6 
 a/kernel/exit.c                                                |    2 
 a/kernel/extable.c                                             |    2 
 a/kernel/fork.c                                                |   51 
 a/kernel/kexec_file.c                                          |    5 
 a/kernel/kthread.c                                             |   21 
 a/kernel/locking/lockdep.c                                     |   15 
 a/kernel/printk/printk.c                                       |    4 
 a/kernel/sched/core.c                                          |   37 
 a/kernel/sched/sched.h                                         |    4 
 a/kernel/sched/topology.c                                      |    1 
 a/kernel/stacktrace.c                                          |   30 
 a/kernel/tsacct.c                                              |    2 
 a/kernel/workqueue.c                                           |    2 
 a/lib/Kconfig.debug                                            |    2 
 a/lib/Kconfig.kfence                                           |   26 
 a/lib/bootconfig.c                                             |    2 
 a/lib/cpumask.c                                                |    6 
 a/lib/stackdepot.c                                             |   76 -
 a/lib/test_kasan.c                                             |   26 
 a/lib/test_kasan_module.c                                      |    2 
 a/lib/test_vmalloc.c                                           |    6 
 a/mm/Kconfig                                                   |   10 
 a/mm/backing-dev.c                                             |   65 
 a/mm/cma.c                                                     |   26 
 a/mm/compaction.c                                              |   12 
 a/mm/damon/Kconfig                                             |   24 
 a/mm/damon/Makefile                                            |    4 
 a/mm/damon/core.c                                              |  500 ++++++-
 a/mm/damon/dbgfs-test.h                                        |   56 
 a/mm/damon/dbgfs.c                                             |  486 +++++-
 a/mm/damon/paddr.c                                             |  275 +++
 a/mm/damon/prmtv-common.c                                      |  133 +
 a/mm/damon/prmtv-common.h                                      |   20 
 a/mm/damon/reclaim.c                                           |  356 ++++
 a/mm/damon/vaddr-test.h                                        |    2 
 a/mm/damon/vaddr.c                                             |  167 +-
 a/mm/debug.c                                                   |   20 
 a/mm/debug_vm_pgtable.c                                        |    7 
 a/mm/filemap.c                                                 |   78 -
 a/mm/gup.c                                                     |    5 
 a/mm/highmem.c                                                 |    6 
 a/mm/hugetlb.c                                                 |  713 +++++++++-
 a/mm/hugetlb_cgroup.c                                          |    3 
 a/mm/internal.h                                                |   26 
 a/mm/kasan/common.c                                            |    8 
 a/mm/kasan/generic.c                                           |   16 
 a/mm/kasan/kasan.h                                             |    2 
 a/mm/kasan/shadow.c                                            |    5 
 a/mm/kfence/core.c                                             |  214 ++-
 a/mm/kfence/kfence.h                                           |    2 
 a/mm/kfence/kfence_test.c                                      |   14 
 a/mm/khugepaged.c                                              |   10 
 a/mm/list_lru.c                                                |   58 
 a/mm/memblock.c                                                |   35 
 a/mm/memcontrol.c                                              |  217 +--
 a/mm/memory-failure.c                                          |  117 +
 a/mm/memory.c                                                  |  166 +-
 a/mm/memory_hotplug.c                                          |   57 
 a/mm/mempolicy.c                                               |  143 +-
 a/mm/migrate.c                                                 |   61 
 a/mm/mmap.c                                                    |    2 
 a/mm/mprotect.c                                                |    5 
 a/mm/mremap.c                                                  |   86 -
 a/mm/nommu.c                                                   |    6 
 a/mm/oom_kill.c                                                |   27 
 a/mm/page-writeback.c                                          |   13 
 a/mm/page_alloc.c                                              |  119 -
 a/mm/page_ext.c                                                |    2 
 a/mm/page_isolation.c                                          |   29 
 a/mm/percpu.c                                                  |   24 
 a/mm/readahead.c                                               |    2 
 a/mm/rmap.c                                                    |    8 
 a/mm/shmem.c                                                   |   44 
 a/mm/slab.c                                                    |   16 
 a/mm/slab_common.c                                             |    8 
 a/mm/slub.c                                                    |  117 -
 a/mm/sparse-vmemmap.c                                          |    2 
 a/mm/sparse.c                                                  |    6 
 a/mm/swap.c                                                    |   23 
 a/mm/swapfile.c                                                |    6 
 a/mm/userfaultfd.c                                             |    8 
 a/mm/vmalloc.c                                                 |  107 +
 a/mm/vmpressure.c                                              |    2 
 a/mm/vmscan.c                                                  |  194 ++
 a/mm/vmstat.c                                                  |   76 -
 a/mm/zsmalloc.c                                                |    7 
 a/net/ipv4/tcp.c                                               |    1 
 a/net/ipv4/udp.c                                               |    1 
 a/net/netfilter/ipvs/ip_vs_ctl.c                               |    1 
 a/net/openvswitch/meter.c                                      |    1 
 a/net/sctp/protocol.c                                          |    1 
 a/scripts/checkpatch.pl                                        |    3 
 a/scripts/decodecode                                           |    2 
 a/scripts/spelling.txt                                         |   18 
 a/security/Kconfig                                             |   14 
 a/tools/testing/selftests/damon/debugfs_attrs.sh               |   25 
 a/tools/testing/selftests/memory-hotplug/config                |    1 
 a/tools/testing/selftests/vm/.gitignore                        |    1 
 a/tools/testing/selftests/vm/Makefile                          |    1 
 a/tools/testing/selftests/vm/hugepage-mremap.c                 |  161 ++
 a/tools/testing/selftests/vm/ksm_tests.c                       |  154 ++
 a/tools/testing/selftests/vm/madv_populate.c                   |   15 
 a/tools/testing/selftests/vm/run_vmtests.sh                    |   11 
 a/tools/testing/selftests/vm/transhuge-stress.c                |    2 
 a/tools/testing/selftests/vm/userfaultfd.c                     |  157 +-
 a/tools/vm/page-types.c                                        |   38 
 a/tools/vm/page_owner_sort.c                                   |   94 +
 b/Documentation/admin-guide/mm/index.rst                       |    2 
 b/Documentation/vm/index.rst                                   |   26 
 260 files changed, 6448 insertions(+), 2327 deletions(-)

incoming

[Andrew Morton]

11 patches, based on 411a44c24a561e449b592ff631b7ae321f1eb559.

Subsystems affected by this patch series:

  mm/memcg
  mm/memory-failure
  mm/oom-kill
  ocfs2
  mm/secretmem
  mm/vmalloc
  mm/hugetlb
  mm/damon
  mm/tools

Subsystem: mm/memcg

    Shakeel Butt <shakeelb@google.com>:
      memcg: page_alloc: skip bulk allocator for __GFP_ACCOUNT

Subsystem: mm/memory-failure

    Yang Shi <shy828301@gmail.com>:
      mm: hwpoison: remove the unnecessary THP check
      mm: filemap: check if THP has hwpoisoned subpage for PMD page fault

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm/oom_kill.c: prevent a race between process_mrelease and exit_mmap

Subsystem: ocfs2

    Gautham Ananthakrishna <gautham.ananthakrishna@oracle.com>:
      ocfs2: fix race between searching chunks and release journal_head from buffer_head

Subsystem: mm/secretmem

    Kees Cook <keescook@chromium.org>:
      mm/secretmem: avoid letting secretmem_users drop to zero

Subsystem: mm/vmalloc

    Chen Wandun <chenwandun@huawei.com>:
      mm/vmalloc: fix numa spreading for large hash tables

Subsystem: mm/hugetlb

    Rongwei Wang <rongwei.wang@linux.alibaba.com>:
      mm, thp: bail out early in collapse_file for writeback page

    Yang Shi <shy828301@gmail.com>:
      mm: khugepaged: skip huge page collapse for special files

Subsystem: mm/damon

    SeongJae Park <sj@kernel.org>:
      mm/damon/core-test: fix wrong expectations for 'damon_split_regions_of()'

Subsystem: mm/tools

    David Yang <davidcomponentone@gmail.com>:
      tools/testing/selftests/vm/split_huge_page_test.c: fix application of sizeof to pointer

 fs/ocfs2/suballoc.c                               |   22 ++++++++++-------
 include/linux/page-flags.h                        |   23 ++++++++++++++++++
 mm/damon/core-test.h                              |    4 +--
 mm/huge_memory.c                                  |    2 +
 mm/khugepaged.c                                   |   26 +++++++++++++-------
 mm/memory-failure.c                               |   28 +++++++++++-----------
 mm/memory.c                                       |    9 +++++++
 mm/oom_kill.c                                     |   23 +++++++++---------
 mm/page_alloc.c                                   |    8 +++++-
 mm/secretmem.c                                    |    2 -
 mm/vmalloc.c                                      |   15 +++++++----
 tools/testing/selftests/vm/split_huge_page_test.c |    2 -
 12 files changed, 110 insertions(+), 54 deletions(-)

incoming

[Andrew Morton]

19 patches, based on 519d81956ee277b4419c723adfb154603c2565ba.

Subsystems affected by this patch series:

  mm/userfaultfd
  mm/migration
  ocfs2
  mm/memblock
  mm/mempolicy
  mm/slub
  binfmt
  vfs
  mm/secretmem
  mm/thp
  misc

Subsystem: mm/userfaultfd

    Peter Xu <peterx@redhat.com>:
      mm/userfaultfd: selftests: fix memory corruption with thp enabled

    Nadav Amit <namit@vmware.com>:
      userfaultfd: fix a race between writeprotect and exit_mmap()

Subsystem: mm/migration

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "mm/migrate: 5.15 fixes for automatic demotion", v2:
      mm/migrate: optimize hotplug-time demotion order updates
      mm/migrate: add CPU hotplug to demotion #ifdef

    Huang Ying <ying.huang@intel.com>:
      mm/migrate: fix CPUHP state to update node demotion order

Subsystem: ocfs2

    Jan Kara <jack@suse.cz>:
      ocfs2: fix data corruption after conversion from inline format

    Valentin Vidic <vvidic@valentin-vidic.from.hr>:
      ocfs2: mount fails with buffer overflow in strlen

Subsystem: mm/memblock

    Peng Fan <peng.fan@nxp.com>:
      memblock: check memory total_size

Subsystem: mm/mempolicy

    Eric Dumazet <edumazet@google.com>:
      mm/mempolicy: do not allow illegal MPOL_F_NUMA_BALANCING | MPOL_LOCAL in mbind()

Subsystem: mm/slub

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Fixups for slub":
      mm, slub: fix two bugs in slab_debug_trace_open()
      mm, slub: fix mismatch between reconstructed freelist depth and cnt
      mm, slub: fix potential memoryleak in kmem_cache_open()
      mm, slub: fix potential use-after-free in slab_debugfs_fops
      mm, slub: fix incorrect memcg slab count for bulk free

Subsystem: binfmt

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      elfcore: correct reference to CONFIG_UML

Subsystem: vfs

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      vfs: check fd has read access in kernel_read_file_from_fd()

Subsystem: mm/secretmem

    Sean Christopherson <seanjc@google.com>:
      mm/secretmem: fix NULL page->mapping dereference in page_is_secretmem()

Subsystem: mm/thp

    Marek Szyprowski <m.szyprowski@samsung.com>:
      mm/thp: decrease nr_thps in file's mapping on THP split

Subsystem: misc

    Andrej Shadura <andrew.shadura@collabora.co.uk>:
      mailmap: add Andrej Shadura

 .mailmap                                 |    2 +
 fs/kernel_read_file.c                    |    2 -
 fs/ocfs2/alloc.c                         |   46 ++++++-----------------
 fs/ocfs2/super.c                         |   14 +++++--
 fs/userfaultfd.c                         |   12 ++++--
 include/linux/cpuhotplug.h               |    4 ++
 include/linux/elfcore.h                  |    2 -
 include/linux/memory.h                   |    5 ++
 include/linux/secretmem.h                |    2 -
 mm/huge_memory.c                         |    6 ++-
 mm/memblock.c                            |    2 -
 mm/mempolicy.c                           |   16 ++------
 mm/migrate.c                             |   62 ++++++++++++++++++-------------
 mm/page_ext.c                            |    4 --
 mm/slab.c                                |    4 +-
 mm/slub.c                                |   31 ++++++++++++---
 tools/testing/selftests/vm/userfaultfd.c |   23 ++++++++++-
 17 files changed, 138 insertions(+), 99 deletions(-)

incoming

[Andrew Morton]

16 patches, based on 7d42e98182586f57f376406d033f05fe135edb75.

Subsystems affected by this patch series:

  mm/memory-failure
  mm/kasan
  mm/damon
  xtensa
  mm/shmem
  ocfs2
  scripts
  mm/tools
  lib
  mm/pagecache
  mm/debug
  sh
  mm/kasan
  mm/memory-failure
  mm/pagemap

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm, hwpoison: add is_free_buddy_page() in HWPoisonHandlable()

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      kasan: fix Kconfig check of CC_HAS_WORKING_NOSANITIZE_ADDRESS

Subsystem: mm/damon

    Adam Borowski <kilobyte@angband.pl>:
      mm/damon: don't use strnlen() with known-bogus source length

Subsystem: xtensa

    Guenter Roeck <linux@roeck-us.net>:
      xtensa: increase size of gcc stack frame check

Subsystem: mm/shmem

    Liu Yuntao <liuyuntao10@huawei.com>:
      mm/shmem.c: fix judgment error in shmem_is_huge()

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: drop acl cache for directories too

Subsystem: scripts

    Miles Chen <miles.chen@mediatek.com>:
      scripts/sorttable: riscv: fix undeclared identifier 'EM_RISCV' error

Subsystem: mm/tools

    Changbin Du <changbin.du@gmail.com>:
      tools/vm/page-types: remove dependency on opt_file for idle page tracking

Subsystem: lib

    Paul Menzel <pmenzel@molgen.mpg.de>:
      lib/zlib_inflate/inffast: check config in C to avoid unused function warning

Subsystem: mm/pagecache

    Minchan Kim <minchan@kernel.org>:
      mm: fs: invalidate bh_lrus for only cold path

Subsystem: mm/debug

    Weizhao Ouyang <o451686892@gmail.com>:
      mm/debug: sync up MR_CONTIG_RANGE and MR_LONGTERM_PIN
      mm/debug: sync up latest migrate_reason to migrate_reason_names

Subsystem: sh

    Geert Uytterhoeven <geert+renesas@glider.be>:
      sh: pgtable-3level: fix cast to pointer from integer of different size

Subsystem: mm/kasan

    Nathan Chancellor <nathan@kernel.org>:
      kasan: always respect CONFIG_KASAN_STACK

Subsystem: mm/memory-failure

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm/memory_failure: fix the missing pte_unmap() call

Subsystem: mm/pagemap

    Chen Jun <chenjun102@huawei.com>:
      mm: fix uninitialized use in overcommit_policy_handler

 arch/sh/include/asm/pgtable-3level.h |    2 +-
 fs/buffer.c                          |    8 ++++++--
 fs/ocfs2/dlmglue.c                   |    3 ++-
 include/linux/buffer_head.h          |    4 ++--
 include/linux/migrate.h              |    6 +++++-
 lib/Kconfig.debug                    |    2 +-
 lib/Kconfig.kasan                    |    2 ++
 lib/zlib_inflate/inffast.c           |   13 ++++++-------
 mm/damon/dbgfs-test.h                |   16 ++++++++--------
 mm/debug.c                           |    4 +++-
 mm/memory-failure.c                  |   12 ++++++------
 mm/shmem.c                           |    4 ++--
 mm/swap.c                            |   19 ++++++++++++++++---
 mm/util.c                            |    4 ++--
 scripts/Makefile.kasan               |    3 ++-
 scripts/sorttable.c                  |    4 ++++
 tools/vm/page-types.c                |    2 +-
 17 files changed, 69 insertions(+), 39 deletions(-)

Re: incoming

[Kees Cook]

On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote:
> On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> > 
> > More post linux-next material.
> > 
> > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> > 
> > Subsystems affected by this patch series:
> > 
> >   mm/slab-generic
> >   rapidio
> >   mm/debug
> > 
> > Subsystem: mm/slab-generic
> > 
> >     "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> >       mm: move kvmalloc-related functions to slab.h
> > 
> > Subsystem: rapidio
> > 
> >     Kees Cook <keescook@chromium.org>:
> >       rapidio: avoid bogus __alloc_size warning
> > 
> > Subsystem: mm/debug
> > 
> >     Kees Cook <keescook@chromium.org>:
> >     Patch series "Add __alloc_size() for better bounds checking", v2:
> >       Compiler Attributes: add __alloc_size() for better bounds checking
> >       checkpatch: add __alloc_size() to known $Attribute
> >       slab: clean up function declarations
> >       slab: add __alloc_size attributes for better bounds checking
> >       mm/page_alloc: add __alloc_size attributes for better bounds checking
> >       percpu: add __alloc_size attributes for better bounds checking
> >       mm/vmalloc: add __alloc_size attributes for better bounds checking
> 
> Hi,
> 
> FYI, in overnight build testing I found yet another corner case in
> GCC's handling of the __alloc_size attribute. It's the gift that keeps
> on giving. The fix is here:
> 
> https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/

I'm so glad it's Friday. Here's the v2 fix... *sigh*

https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/

-Kees

> 
> > 
> >  Makefile                                 |   15 +++
> >  drivers/of/kexec.c                       |    1 
> >  drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
> >  include/linux/compiler_attributes.h      |    6 +
> >  include/linux/gfp.h                      |    2 
> >  include/linux/mm.h                       |   34 --------
> >  include/linux/percpu.h                   |    3 
> >  include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
> >  include/linux/vmalloc.h                  |   11 ++
> >  scripts/checkpatch.pl                    |    3 
> >  10 files changed, 132 insertions(+), 74 deletions(-)
> > 
> 
> -- 
> Kees Cook

-- 
Kees Cook

Re: incoming

[Kees Cook]

On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> 
> More post linux-next material.
> 
> 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> 
> Subsystems affected by this patch series:
> 
>   mm/slab-generic
>   rapidio
>   mm/debug
> 
> Subsystem: mm/slab-generic
> 
>     "Matthew Wilcox (Oracle)" <willy@infradead.org>:
>       mm: move kvmalloc-related functions to slab.h
> 
> Subsystem: rapidio
> 
>     Kees Cook <keescook@chromium.org>:
>       rapidio: avoid bogus __alloc_size warning
> 
> Subsystem: mm/debug
> 
>     Kees Cook <keescook@chromium.org>:
>     Patch series "Add __alloc_size() for better bounds checking", v2:
>       Compiler Attributes: add __alloc_size() for better bounds checking
>       checkpatch: add __alloc_size() to known $Attribute
>       slab: clean up function declarations
>       slab: add __alloc_size attributes for better bounds checking
>       mm/page_alloc: add __alloc_size attributes for better bounds checking
>       percpu: add __alloc_size attributes for better bounds checking
>       mm/vmalloc: add __alloc_size attributes for better bounds checking

Hi,

FYI, in overnight build testing I found yet another corner case in
GCC's handling of the __alloc_size attribute. It's the gift that keeps
on giving. The fix is here:

https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/

> 
>  Makefile                                 |   15 +++
>  drivers/of/kexec.c                       |    1 
>  drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
>  include/linux/compiler_attributes.h      |    6 +
>  include/linux/gfp.h                      |    2 
>  include/linux/mm.h                       |   34 --------
>  include/linux/percpu.h                   |    3 
>  include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
>  include/linux/vmalloc.h                  |   11 ++
>  scripts/checkpatch.pl                    |    3 
>  10 files changed, 132 insertions(+), 74 deletions(-)
> 

-- 
Kees Cook

incoming

[Andrew Morton]

More post linux-next material.

9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.

Subsystems affected by this patch series:

  mm/slab-generic
  rapidio
  mm/debug

Subsystem: mm/slab-generic

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move kvmalloc-related functions to slab.h

Subsystem: rapidio

    Kees Cook <keescook@chromium.org>:
      rapidio: avoid bogus __alloc_size warning

Subsystem: mm/debug

    Kees Cook <keescook@chromium.org>:
    Patch series "Add __alloc_size() for better bounds checking", v2:
      Compiler Attributes: add __alloc_size() for better bounds checking
      checkpatch: add __alloc_size() to known $Attribute
      slab: clean up function declarations
      slab: add __alloc_size attributes for better bounds checking
      mm/page_alloc: add __alloc_size attributes for better bounds checking
      percpu: add __alloc_size attributes for better bounds checking
      mm/vmalloc: add __alloc_size attributes for better bounds checking

 Makefile                                 |   15 +++
 drivers/of/kexec.c                       |    1 
 drivers/rapidio/devices/rio_mport_cdev.c |    9 +-
 include/linux/compiler_attributes.h      |    6 +
 include/linux/gfp.h                      |    2 
 include/linux/mm.h                       |   34 --------
 include/linux/percpu.h                   |    3 
 include/linux/slab.h                     |  122 ++++++++++++++++++++++---------
 include/linux/vmalloc.h                  |   11 ++
 scripts/checkpatch.pl                    |    3 
 10 files changed, 132 insertions(+), 74 deletions(-)

incoming

[Andrew Morton]

A bunch of hotfixes, mostly cc:stable.


8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.

Subsystems affected by this patch series:

  mm/hmm
  mm/hugetlb
  mm/vmscan
  mm/pagealloc
  mm/pagemap
  mm/kmemleak
  mm/mempolicy
  mm/memblock

Subsystem: mm/hmm

    Li Zhijian <lizhijian@cn.fujitsu.com>:
      mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled

Subsystem: mm/hugetlb

    Liu Zixian <liuzixian4@huawei.com>:
      mm/hugetlb: initialize hugetlb_usage in mm_init

Subsystem: mm/vmscan

    Rik van Riel <riel@surriel.com>:
      mm,vmscan: fix divide by zero in get_scan_count

Subsystem: mm/pagealloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype

Subsystem: mm/pagemap

    Liam Howlett <liam.howlett@oracle.com>:
      mmap_lock: change trace and locking order

Subsystem: mm/kmemleak

    Naohiro Aota <naohiro.aota@wdc.com>:
      mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp

Subsystem: mm/mempolicy

    yanghui <yanghui.def@bytedance.com>:
      mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      nds32/setup: remove unused memblock_region variable in setup_memory()

 arch/nds32/kernel/setup.c |    1 -
 include/linux/hugetlb.h   |    9 +++++++++
 include/linux/mmap_lock.h |    8 ++++----
 kernel/fork.c             |    1 +
 mm/hmm.c                  |    5 ++++-
 mm/kmemleak.c             |    3 ++-
 mm/mempolicy.c            |   17 +++++++++++++----
 mm/page_alloc.c           |    4 +++-
 mm/vmscan.c               |    2 +-
 9 files changed, 37 insertions(+), 13 deletions(-)

incoming

[Andrew Morton]

This is the post-linux-next material, so it is based upon latest
upstream to catch the now-merged dependencies.

10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.

Subsystems affected by this patch series:

  mm/vmstat
  mm/migration
  compat

Subsystem: mm/vmstat

    Ingo Molnar <mingo@elte.hu>:
      mm/vmstat: protect per cpu variables with preempt disable on RT

Subsystem: mm/migration

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: migrate: introduce a local variable to get the number of pages
      mm: migrate: fix the incorrect function name in comments
      mm: migrate: change to use bool type for 'page_was_mapped'

Subsystem: compat

    Arnd Bergmann <arnd@arndb.de>:
    Patch series "compat: remove compat_alloc_user_space", v5:
      kexec: move locking into do_kexec_load
      kexec: avoid compat_alloc_user_space
      mm: simplify compat_sys_move_pages
      mm: simplify compat numa syscalls
      compat: remove some compat entry points
      arch: remove compat_alloc_user_space

 arch/arm64/include/asm/compat.h           |    5 
 arch/arm64/include/asm/uaccess.h          |   11 -
 arch/arm64/include/asm/unistd32.h         |   10 -
 arch/arm64/lib/Makefile                   |    2 
 arch/arm64/lib/copy_in_user.S             |   77 ----------
 arch/mips/cavium-octeon/octeon-memcpy.S   |    2 
 arch/mips/include/asm/compat.h            |    8 -
 arch/mips/include/asm/uaccess.h           |   26 ---
 arch/mips/kernel/syscalls/syscall_n32.tbl |   10 -
 arch/mips/kernel/syscalls/syscall_o32.tbl |   10 -
 arch/mips/lib/memcpy.S                    |   11 -
 arch/parisc/include/asm/compat.h          |    6 
 arch/parisc/include/asm/uaccess.h         |    2 
 arch/parisc/kernel/syscalls/syscall.tbl   |    8 -
 arch/parisc/lib/memcpy.c                  |    9 -
 arch/powerpc/include/asm/compat.h         |   16 --
 arch/powerpc/kernel/syscalls/syscall.tbl  |   10 -
 arch/s390/include/asm/compat.h            |   10 -
 arch/s390/include/asm/uaccess.h           |    3 
 arch/s390/kernel/syscalls/syscall.tbl     |   10 -
 arch/s390/lib/uaccess.c                   |   63 --------
 arch/sparc/include/asm/compat.h           |   19 --
 arch/sparc/kernel/process_64.c            |    2 
 arch/sparc/kernel/signal32.c              |   12 -
 arch/sparc/kernel/signal_64.c             |    8 -
 arch/sparc/kernel/syscalls/syscall.tbl    |   10 -
 arch/x86/entry/syscalls/syscall_32.tbl    |    4 
 arch/x86/entry/syscalls/syscall_64.tbl    |    2 
 arch/x86/include/asm/compat.h             |   13 -
 arch/x86/include/asm/uaccess_64.h         |    7 
 include/linux/compat.h                    |   39 +----
 include/linux/uaccess.h                   |   10 -
 include/uapi/asm-generic/unistd.h         |   10 -
 kernel/compat.c                           |   21 --
 kernel/kexec.c                            |  105 +++++---------
 kernel/sys_ni.c                           |    5 
 mm/mempolicy.c                            |  213 +++++++-----------------------
 mm/migrate.c                              |   69 +++++----
 mm/vmstat.c                               |   48 ++++++
 39 files changed, 243 insertions(+), 663 deletions(-)

Re: incoming

[Vlastimil Babka]

On 9/8/21 04:52, Andrew Morton wrote:
> Subsystem: mm/slub
> 
>     Vlastimil Babka <vbabka@suse.cz>:
>     Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
>       mm, slub: don't call flush_all() from slab_debug_trace_open()
>       mm, slub: allocate private object map for debugfs listings
>       mm, slub: allocate private object map for validate_slab_cache()
>       mm, slub: don't disable irq for debug_check_no_locks_freed()
>       mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
>       mm, slub: extract get_partial() from new_slab_objects()
>       mm, slub: dissolve new_slab_objects() into ___slab_alloc()
>       mm, slub: return slab page from get_partial() and set c->page afterwards
>       mm, slub: restructure new page checks in ___slab_alloc()
>       mm, slub: simplify kmem_cache_cpu and tid setup
>       mm, slub: move disabling/enabling irqs to ___slab_alloc()
>       mm, slub: do initial checks in ___slab_alloc() with irqs enabled
>       mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
>       mm, slub: restore irqs around calling new_slab()
>       mm, slub: validate slab from partial list or page allocator before making it cpu slab
>       mm, slub: check new pages with restored irqs
>       mm, slub: stop disabling irqs around get_partial()
>       mm, slub: move reset of c->page and freelist out of deactivate_slab()
>       mm, slub: make locking in deactivate_slab() irq-safe
>       mm, slub: call deactivate_slab() without disabling irqs
>       mm, slub: move irq control into unfreeze_partials()
>       mm, slub: discard slabs in unfreeze_partials() without irqs disabled
>       mm, slub: detach whole partial list at once in unfreeze_partials()
>       mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
>       mm, slub: only disable irq with spin_lock in __unfreeze_partials()
>       mm, slub: don't disable irqs in slub_cpu_dead()
>       mm, slab: split out the cpu offline variant of flush_slab()
> 
>     Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
>       mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
>       mm: slub: make object_map_lock a raw_spinlock_t
> 
>     Vlastimil Babka <vbabka@suse.cz>:
>       mm, slub: make slab_lock() disable irqs with PREEMPT_RT
>       mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
>       mm, slub: use migrate_disable() on PREEMPT_RT
>       mm, slub: convert kmem_cpu_slab protection to local_lock

For my own piece of mind, I've checked that this part (patches 1 to 33)
are identical to the v6 posting [1] and git version [2] that Mel and
Mike tested (replies to [1]).

[1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/
[2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git
tags/mm-slub-5.15-rc1

incoming

[Andrew Morton]

147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f.

Subsystems affected by this patch series:

  mm/slub
  mm/memory-hotplug
  mm/rmap
  mm/ioremap
  mm/highmem
  mm/cleanups
  mm/secretmem
  mm/kfence
  mm/damon
  alpha
  percpu
  procfs
  misc
  core-kernel
  MAINTAINERS
  lib
  bitops
  checkpatch
  epoll
  init
  nilfs2
  coredump
  fork
  pids
  criu
  kconfig
  selftests
  ipc
  mm/vmscan
  scripts

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
      mm, slub: don't call flush_all() from slab_debug_trace_open()
      mm, slub: allocate private object map for debugfs listings
      mm, slub: allocate private object map for validate_slab_cache()
      mm, slub: don't disable irq for debug_check_no_locks_freed()
      mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
      mm, slub: extract get_partial() from new_slab_objects()
      mm, slub: dissolve new_slab_objects() into ___slab_alloc()
      mm, slub: return slab page from get_partial() and set c->page afterwards
      mm, slub: restructure new page checks in ___slab_alloc()
      mm, slub: simplify kmem_cache_cpu and tid setup
      mm, slub: move disabling/enabling irqs to ___slab_alloc()
      mm, slub: do initial checks in ___slab_alloc() with irqs enabled
      mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
      mm, slub: restore irqs around calling new_slab()
      mm, slub: validate slab from partial list or page allocator before making it cpu slab
      mm, slub: check new pages with restored irqs
      mm, slub: stop disabling irqs around get_partial()
      mm, slub: move reset of c->page and freelist out of deactivate_slab()
      mm, slub: make locking in deactivate_slab() irq-safe
      mm, slub: call deactivate_slab() without disabling irqs
      mm, slub: move irq control into unfreeze_partials()
      mm, slub: discard slabs in unfreeze_partials() without irqs disabled
      mm, slub: detach whole partial list at once in unfreeze_partials()
      mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
      mm, slub: only disable irq with spin_lock in __unfreeze_partials()
      mm, slub: don't disable irqs in slub_cpu_dead()
      mm, slab: split out the cpu offline variant of flush_slab()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
      mm: slub: make object_map_lock a raw_spinlock_t

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: make slab_lock() disable irqs with PREEMPT_RT
      mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
      mm, slub: use migrate_disable() on PREEMPT_RT
      mm, slub: convert kmem_cpu_slab protection to local_lock

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3:
      memory-hotplug.rst: remove locking details from admin-guide
      memory-hotplug.rst: complete admin-guide overhaul

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE":
      mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE
      mm: memory_hotplug: cleanup after removal of pfn_valid_within()

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory":
      mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range()
      mm/memory_hotplug: remove nid parameter from arch_remove_memory()
      mm/memory_hotplug: remove nid parameter from remove_memory() and friends
      ACPI: memhotplug: memory resources cannot be enabled yet
    Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3:
      mm: track present early pages per zone
      mm/memory_hotplug: introduce "auto-movable" online policy
      drivers/base/memory: introduce "memory groups" to logically group memory blocks
      mm/memory_hotplug: track present pages in memory groups
      ACPI: memhotplug: use a single static memory group for a single memory device
      dax/kmem: use a single static memory group for a single probed unit
      virtio-mem: use a single dynamic memory group for a single virtio-mem device
      mm/memory_hotplug: memory group aware "auto-movable" online policy
      mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixups for memory hotplug":
      mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code

Subsystem: mm/rmap

    Muchun Song <songmuchun@bytedance.com>:
      mm: remove redundant compound_head() calling

Subsystem: mm/ioremap

    Christoph Hellwig <hch@lst.de>:
      riscv: only select GENERIC_IOREMAP if MMU support is enabled
    Patch series "small ioremap cleanups":
      mm: move ioremap_page_range to vmalloc.c
      mm: don't allow executable ioremap mappings

    Weizhao Ouyang <o451686892@gmail.com>:
      mm/early_ioremap.c: remove redundant early_ioremap_shutdown()

Subsystem: mm/highmem

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      highmem: don't disable preemption on RT in kmap_atomic()

Subsystem: mm/cleanups

    Changbin Du <changbin.du@gmail.com>:
      mm: in_irq() cleanup

    Muchun Song <songmuchun@bytedance.com>:
      mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1)

Subsystem: mm/secretmem

    Jordy Zomer <jordy@jordyzomer.github.io>:
      mm/secretmem: use refcount_t instead of atomic_t

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: show cpu and timestamp in alloc/free info
      kfence: test: fail fast if disabled at boot

Subsystem: mm/damon

    SeongJae Park <sjpark@amazon.de>:
    Patch series "Introduce Data Access MONitor (DAMON)", v34:
      mm: introduce Data Access MONitor (DAMON)
      mm/damon/core: implement region-based sampling
      mm/damon: adaptively adjust regions
      mm/idle_page_tracking: make PG_idle reusable
      mm/damon: implement primitives for the virtual memory address spaces
      mm/damon: add a tracepoint
      mm/damon: implement a debugfs-based user space interface
      mm/damon/dbgfs: export kdamond pid to the user space
      mm/damon/dbgfs: support multiple contexts
      Documentation: add documents for DAMON
      mm/damon: add kunit tests
      mm/damon: add user space selftests
      MAINTAINERS: update for DAMON

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: agp: make empty macros use do-while-0 style
      alpha: pci-sysfs: fix all kernel-doc warnings

Subsystem: percpu

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      percpu: remove export of pcpu_base_addr

Subsystem: procfs

    Feng Zhou <zhoufeng.zf@bytedance.com>:
      fs/proc/kcore.c: add mmap interface

    Christoph Hellwig <hch@lst.de>:
      proc: stop using seq_get_buf in proc_task_name

    Ohhoon Kwon <ohoono.kwon@samsung.com>:
      connector: send event on write to /proc/[pid]/comm

Subsystem: misc

    Colin Ian King <colin.king@canonical.com>:
      arch: Kconfig: fix spelling mistake "seperate" -> "separate"

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/once.h: fix trivia typo Not -> Note

    Daniel Lezcano <daniel.lezcano@linaro.org>:
    Patch series "Add Hz macros", v3:
      units: change from 'L' to 'UL'
      units: add the HZ macros
      thermal/drivers/devfreq_cooling: use HZ macros
      devfreq: use HZ macros
      iio/drivers/as73211: use HZ macros
      hwmon/drivers/mr75203: use HZ macros
      iio/drivers/hid-sensor: use HZ macros
      i2c/drivers/ov02q10: use HZ macros
      mtd/drivers/nand: use HZ macros
      phy/drivers/stm32: use HZ macros

Subsystem: core-kernel

    Yang Yang <yang.yang29@zte.com.cn>:
      kernel/acct.c: use dedicated helper to access rlimit values

    Pavel Skripkin <paskripkin@gmail.com>:
      profiling: fix shift-out-of-bounds bugs

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS: update ClangBuiltLinux mailing list
      Documentation/llvm: update mailing list
      Documentation/llvm: update IRC location

Subsystem: lib

    Geert Uytterhoeven <geert@linux-m68k.org>:
    Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements":
      math: make RATIONAL tristate
      math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it

    Matteo Croce <mcroce@microsoft.com>:
    Patch series "lib/string: optimized mem* functions", v2:
      lib/string: optimized memcpy
      lib/string: optimized memmove
      lib/string: optimized memset

    Daniel Latypov <dlatypov@google.com>:
      lib/test: convert test_sort.c to use KUnit

    Randy Dunlap <rdunlap@infradead.org>:
      lib/dump_stack: correct kernel-doc notation
      lib/iov_iter.c: fix kernel-doc warnings

Subsystem: bitops

    Yury Norov <yury.norov@gmail.com>:
    Patch series "Resend bitmap patches":
      bitops: protect find_first_{,zero}_bit properly
      bitops: move find_bit_*_le functions from le.h to find.h
      include: move find.h from asm_generic to linux
      arch: remove GENERIC_FIND_FIRST_BIT entirely
      lib: add find_first_and_bit()
      cpumask: use find_first_and_bit()
      all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate
      tools: sync tools/bitmap with mother linux
      cpumask: replace cpumask_next_* with cpumask_first_* where appropriate
      include/linux: move for_each_bit() macros from bitops.h to find.h
      find: micro-optimize for_each_{set,clear}_bit()
      bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      tools: rename bitmap_alloc() to bitmap_zalloc()

    Yury Norov <yury.norov@gmail.com>:
      mm/percpu: micro-optimize pcpu_is_populated()
      bitmap: unify find_bit operations
      lib: bitmap: add performance test for bitmap_print_to_pagebuf
      vsprintf: rework bitmap_list_string

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: support wide strings

    Mimi Zohar <zohar@linux.ibm.com>:
      checkpatch: make email address check case insensitive

    Joe Perches <joe@perches.com>:
      checkpatch: improve GIT_COMMIT_ID test

Subsystem: epoll

    Nicholas Piggin <npiggin@gmail.com>:
      fs/epoll: use a per-cpu counter for user's watches count

Subsystem: init

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      init: move usermodehelper_enable() to populate_rootfs()

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      trap: cleanup trap_init()

Subsystem: nilfs2

    Nanyong Sun <sunnanyong@huawei.com>:
    Patch series "nilfs2: fix incorrect usage of kobject":
      nilfs2: fix memory leak in nilfs_sysfs_create_device_group
      nilfs2: fix NULL pointer in nilfs_##name##_attr_release
      nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group
      nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group
      nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group
      nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group

    Zhen Lei <thunder.leizhen@huawei.com>:
      nilfs2: use refcount_dec_and_lock() to fix potential UAF

Subsystem: coredump

    David Oberhollenzer <david.oberhollenzer@sigma-star.at>:
      fs/coredump.c: log if a core dump is aborted due to changed file permissions

    QiuXi <qiuxi1@huawei.com>:
      coredump: fix memleak in dump_vma_snapshot()

Subsystem: fork

    Christoph Hellwig <hch@lst.de>:
      kernel/fork.c: unexport get_{mm,task}_exe_file

Subsystem: pids

    Takahiro Itazuri <itazur@amazon.com>:
      pid: cleanup the stale comment mentioning pidmap_init().

Subsystem: criu

    Cyrill Gorcunov <gorcunov@gmail.com>:
      prctl: allow to setup brk for et_dyn executables

Subsystem: kconfig

    Zenghui Yu <yuzenghui@huawei.com>:
      configs: remove the obsolete CONFIG_INPUT_POLLDEV

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH

Subsystem: selftests

    Greg Thelen <gthelen@google.com>:
      selftests/memfd: remove unused variable

Subsystem: ipc

    Rafael Aquini <aquini@redhat.com>:
      ipc: replace costly bailout check in sysvipc_find_ipc()

Subsystem: mm/vmscan

    Randy Dunlap <rdunlap@infradead.org>:
      mm/workingset: correct kernel-doc notations

Subsystem: scripts

    Randy Dunlap <rdunlap@infradead.org>:
      scripts: check_extable: fix typo in user error message

 a/Documentation/admin-guide/mm/damon/index.rst            |   15 
 a/Documentation/admin-guide/mm/damon/start.rst            |  114 +
 a/Documentation/admin-guide/mm/damon/usage.rst            |  112 +
 a/Documentation/admin-guide/mm/index.rst                  |    1 
 a/Documentation/admin-guide/mm/memory-hotplug.rst         |  842 ++++++-----
 a/Documentation/dev-tools/kfence.rst                      |   98 -
 a/Documentation/kbuild/llvm.rst                           |    5 
 a/Documentation/vm/damon/api.rst                          |   20 
 a/Documentation/vm/damon/design.rst                       |  166 ++
 a/Documentation/vm/damon/faq.rst                          |   51 
 a/Documentation/vm/damon/index.rst                        |   30 
 a/Documentation/vm/index.rst                              |    1 
 a/MAINTAINERS                                             |   17 
 a/arch/Kconfig                                            |    2 
 a/arch/alpha/include/asm/agp.h                            |    4 
 a/arch/alpha/include/asm/bitops.h                         |    2 
 a/arch/alpha/kernel/pci-sysfs.c                           |   12 
 a/arch/arc/Kconfig                                        |    1 
 a/arch/arc/include/asm/bitops.h                           |    1 
 a/arch/arc/kernel/traps.c                                 |    5 
 a/arch/arm/configs/dove_defconfig                         |    1 
 a/arch/arm/configs/pxa_defconfig                          |    1 
 a/arch/arm/include/asm/bitops.h                           |    1 
 a/arch/arm/kernel/traps.c                                 |    5 
 a/arch/arm64/Kconfig                                      |    1 
 a/arch/arm64/include/asm/bitops.h                         |    1 
 a/arch/arm64/mm/mmu.c                                     |    3 
 a/arch/csky/include/asm/bitops.h                          |    1 
 a/arch/h8300/include/asm/bitops.h                         |    1 
 a/arch/h8300/kernel/traps.c                               |    4 
 a/arch/hexagon/include/asm/bitops.h                       |    1 
 a/arch/hexagon/kernel/traps.c                             |    4 
 a/arch/ia64/include/asm/bitops.h                          |    2 
 a/arch/ia64/mm/init.c                                     |    3 
 a/arch/m68k/include/asm/bitops.h                          |    2 
 a/arch/mips/Kconfig                                       |    1 
 a/arch/mips/configs/lemote2f_defconfig                    |    1 
 a/arch/mips/configs/pic32mzda_defconfig                   |    1 
 a/arch/mips/configs/rt305x_defconfig                      |    1 
 a/arch/mips/configs/xway_defconfig                        |    1 
 a/arch/mips/include/asm/bitops.h                          |    1 
 a/arch/nds32/kernel/traps.c                               |    5 
 a/arch/nios2/kernel/traps.c                               |    5 
 a/arch/openrisc/include/asm/bitops.h                      |    1 
 a/arch/openrisc/kernel/traps.c                            |    5 
 a/arch/parisc/configs/generic-32bit_defconfig             |    1 
 a/arch/parisc/include/asm/bitops.h                        |    2 
 a/arch/parisc/kernel/traps.c                              |    4 
 a/arch/powerpc/include/asm/bitops.h                       |    2 
 a/arch/powerpc/include/asm/cputhreads.h                   |    2 
 a/arch/powerpc/kernel/traps.c                             |    5 
 a/arch/powerpc/mm/mem.c                                   |    3 
 a/arch/powerpc/platforms/pasemi/dma_lib.c                 |    4 
 a/arch/powerpc/platforms/pseries/hotplug-memory.c         |    9 
 a/arch/riscv/Kconfig                                      |    2 
 a/arch/riscv/include/asm/bitops.h                         |    1 
 a/arch/riscv/kernel/traps.c                               |    5 
 a/arch/s390/Kconfig                                       |    1 
 a/arch/s390/include/asm/bitops.h                          |    1 
 a/arch/s390/kvm/kvm-s390.c                                |    2 
 a/arch/s390/mm/init.c                                     |    3 
 a/arch/sh/include/asm/bitops.h                            |    1 
 a/arch/sh/mm/init.c                                       |    3 
 a/arch/sparc/include/asm/bitops_32.h                      |    1 
 a/arch/sparc/include/asm/bitops_64.h                      |    2 
 a/arch/um/kernel/trap.c                                   |    4 
 a/arch/x86/Kconfig                                        |    1 
 a/arch/x86/configs/i386_defconfig                         |    1 
 a/arch/x86/configs/x86_64_defconfig                       |    1 
 a/arch/x86/include/asm/bitops.h                           |    2 
 a/arch/x86/kernel/apic/vector.c                           |    4 
 a/arch/x86/mm/init_32.c                                   |    3 
 a/arch/x86/mm/init_64.c                                   |    3 
 a/arch/x86/um/Kconfig                                     |    1 
 a/arch/xtensa/include/asm/bitops.h                        |    1 
 a/block/blk-mq.c                                          |    2 
 a/drivers/acpi/acpi_memhotplug.c                          |   46 
 a/drivers/base/memory.c                                   |  231 ++-
 a/drivers/base/node.c                                     |    2 
 a/drivers/block/rnbd/rnbd-clt.c                           |    2 
 a/drivers/dax/kmem.c                                      |   43 
 a/drivers/devfreq/devfreq.c                               |    2 
 a/drivers/dma/ti/edma.c                                   |    2 
 a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c                   |    4 
 a/drivers/hwmon/ltc2992.c                                 |    3 
 a/drivers/hwmon/mr75203.c                                 |    2 
 a/drivers/iio/adc/ad7124.c                                |    2 
 a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c  |    3 
 a/drivers/iio/light/as73211.c                             |    3 
 a/drivers/infiniband/hw/irdma/hw.c                        |   16 
 a/drivers/media/cec/core/cec-core.c                       |    2 
 a/drivers/media/i2c/ov02a10.c                             |    2 
 a/drivers/media/mc/mc-devnode.c                           |    2 
 a/drivers/mmc/host/renesas_sdhi_core.c                    |    2 
 a/drivers/mtd/nand/raw/intel-nand-controller.c            |    2 
 a/drivers/net/virtio_net.c                                |    2 
 a/drivers/pci/controller/dwc/pci-dra7xx.c                 |    2 
 a/drivers/phy/st/phy-stm32-usbphyc.c                      |    2 
 a/drivers/scsi/lpfc/lpfc_sli.c                            |   10 
 a/drivers/soc/fsl/qbman/bman_portal.c                     |    2 
 a/drivers/soc/fsl/qbman/qman_portal.c                     |    2 
 a/drivers/soc/ti/k3-ringacc.c                             |    4 
 a/drivers/thermal/devfreq_cooling.c                       |    2 
 a/drivers/tty/n_tty.c                                     |    2 
 a/drivers/virt/acrn/ioreq.c                               |    3 
 a/drivers/virtio/virtio_mem.c                             |   26 
 a/fs/coredump.c                                           |   15 
 a/fs/eventpoll.c                                          |   18 
 a/fs/f2fs/segment.c                                       |    8 
 a/fs/nilfs2/sysfs.c                                       |   26 
 a/fs/nilfs2/the_nilfs.c                                   |    9 
 a/fs/ocfs2/cluster/heartbeat.c                            |    2 
 a/fs/ocfs2/dlm/dlmdomain.c                                |    4 
 a/fs/ocfs2/dlm/dlmmaster.c                                |   18 
 a/fs/ocfs2/dlm/dlmrecovery.c                              |    2 
 a/fs/ocfs2/dlm/dlmthread.c                                |    2 
 a/fs/proc/array.c                                         |   18 
 a/fs/proc/base.c                                          |    5 
 a/fs/proc/kcore.c                                         |   73 
 a/include/asm-generic/bitops.h                            |    1 
 a/include/asm-generic/bitops/find.h                       |  198 --
 a/include/asm-generic/bitops/le.h                         |   64 
 a/include/asm-generic/early_ioremap.h                     |    6 
 a/include/linux/bitmap.h                                  |   34 
 a/include/linux/bitops.h                                  |   34 
 a/include/linux/cpumask.h                                 |   46 
 a/include/linux/damon.h                                   |  290 +++
 a/include/linux/find.h                                    |  134 +
 a/include/linux/highmem-internal.h                        |   27 
 a/include/linux/memory.h                                  |   55 
 a/include/linux/memory_hotplug.h                          |   40 
 a/include/linux/mmzone.h                                  |   19 
 a/include/linux/once.h                                    |    2 
 a/include/linux/page-flags.h                              |   17 
 a/include/linux/page_ext.h                                |    2 
 a/include/linux/page_idle.h                               |    6 
 a/include/linux/pagemap.h                                 |    7 
 a/include/linux/sched/user.h                              |    3 
 a/include/linux/slub_def.h                                |    6 
 a/include/linux/threads.h                                 |    2 
 a/include/linux/units.h                                   |   10 
 a/include/linux/vmalloc.h                                 |    3 
 a/include/trace/events/damon.h                            |   43 
 a/include/trace/events/mmflags.h                          |    2 
 a/include/trace/events/page_ref.h                         |    4 
 a/init/initramfs.c                                        |    2 
 a/init/main.c                                             |    3 
 a/init/noinitramfs.c                                      |    2 
 a/ipc/util.c                                              |   16 
 a/kernel/acct.c                                           |    2 
 a/kernel/fork.c                                           |    2 
 a/kernel/profile.c                                        |   21 
 a/kernel/sys.c                                            |    7 
 a/kernel/time/clocksource.c                               |    4 
 a/kernel/user.c                                           |   25 
 a/lib/Kconfig                                             |    3 
 a/lib/Kconfig.debug                                       |    9 
 a/lib/dump_stack.c                                        |    3 
 a/lib/find_bit.c                                          |   21 
 a/lib/find_bit_benchmark.c                                |   21 
 a/lib/genalloc.c                                          |    2 
 a/lib/iov_iter.c                                          |    8 
 a/lib/math/Kconfig                                        |    2 
 a/lib/math/rational.c                                     |    3 
 a/lib/string.c                                            |  130 +
 a/lib/test_bitmap.c                                       |   37 
 a/lib/test_printf.c                                       |    2 
 a/lib/test_sort.c                                         |   40 
 a/lib/vsprintf.c                                          |   26 
 a/mm/Kconfig                                              |   15 
 a/mm/Makefile                                             |    4 
 a/mm/compaction.c                                         |   20 
 a/mm/damon/Kconfig                                        |   68 
 a/mm/damon/Makefile                                       |    5 
 a/mm/damon/core-test.h                                    |  253 +++
 a/mm/damon/core.c                                         |  748 ++++++++++
 a/mm/damon/dbgfs-test.h                                   |  126 +
 a/mm/damon/dbgfs.c                                        |  631 ++++++++
 a/mm/damon/vaddr-test.h                                   |  329 ++++
 a/mm/damon/vaddr.c                                        |  672 +++++++++
 a/mm/early_ioremap.c                                      |    5 
 a/mm/highmem.c                                            |    2 
 a/mm/ioremap.c                                            |   25 
 a/mm/kfence/core.c                                        |    3 
 a/mm/kfence/kfence.h                                      |    2 
 a/mm/kfence/kfence_test.c                                 |    3 
 a/mm/kfence/report.c                                      |   19 
 a/mm/kmemleak.c                                           |    2 
 a/mm/memory_hotplug.c                                     |  396 ++++-
 a/mm/memremap.c                                           |    5 
 a/mm/page_alloc.c                                         |   27 
 a/mm/page_ext.c                                           |   12 
 a/mm/page_idle.c                                          |   10 
 a/mm/page_isolation.c                                     |    7 
 a/mm/page_owner.c                                         |   14 
 a/mm/percpu.c                                             |   36 
 a/mm/rmap.c                                               |    6 
 a/mm/secretmem.c                                          |    9 
 a/mm/slab_common.c                                        |    2 
 a/mm/slub.c                                               | 1023 +++++++++-----
 a/mm/vmalloc.c                                            |   24 
 a/mm/workingset.c                                         |    2 
 a/net/ncsi/ncsi-manage.c                                  |    4 
 a/scripts/check_extable.sh                                |    2 
 a/scripts/checkpatch.pl                                   |   93 -
 a/tools/include/linux/bitmap.h                            |    4 
 a/tools/perf/bench/find-bit-bench.c                       |    2 
 a/tools/perf/builtin-c2c.c                                |    6 
 a/tools/perf/builtin-record.c                             |    2 
 a/tools/perf/tests/bitmap.c                               |    2 
 a/tools/perf/tests/mem2node.c                             |    2 
 a/tools/perf/util/affinity.c                              |    4 
 a/tools/perf/util/header.c                                |    4 
 a/tools/perf/util/metricgroup.c                           |    2 
 a/tools/perf/util/mmap.c                                  |    4 
 a/tools/testing/selftests/damon/Makefile                  |    7 
 a/tools/testing/selftests/damon/_chk_dependency.sh        |   28 
 a/tools/testing/selftests/damon/debugfs_attrs.sh          |   75 +
 a/tools/testing/selftests/kvm/dirty_log_perf_test.c       |    2 
 a/tools/testing/selftests/kvm/dirty_log_test.c            |    4 
 a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c |    2 
 a/tools/testing/selftests/memfd/memfd_test.c              |    2 
 b/MAINTAINERS                                             |    2 
 b/tools/include/asm-generic/bitops.h                      |    1 
 b/tools/include/linux/bitmap.h                            |    7 
 b/tools/include/linux/find.h                              |   81 +
 b/tools/lib/find_bit.c                                    |   20 
 227 files changed, 6695 insertions(+), 1875 deletions(-)

Re: incoming

[Andrew Morton]

On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote:

> 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.

Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f".

incoming

[Andrew Morton]

212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.

Subsystems affected by this patch series:

  ia64
  ocfs2
  block
  mm/slub
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mremap
  mm/bootmem
  mm/sparsemem
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/mempolicy
  mm/memblock
  mm/oom-kill
  mm/migration
  mm/ksm
  mm/percpu
  mm/vmstat
  mm/madvise

Subsystem: ia64

    Jason Wang <wangborong@cdjrlc.com>:
      ia64: fix typo in a comment

    Geert Uytterhoeven <geert+renesas@glider.be>:
    Patch series "ia64: Miscellaneous fixes and cleanups":
      ia64: fix #endif comment for reserve_elfcorehdr()
      ia64: make reserve_elfcorehdr() static
      ia64: make num_rsvd_regions static

Subsystem: ocfs2

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: remove an unnecessary condition

    Tuo Li <islituo@gmail.com>:
      ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info()

    Gang He <ghe@suse.com>:
      ocfs2: ocfs2_downconvert_lock failure results in deadlock

Subsystem: block

    kernel test robot <lkp@intel.com>:
      arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4:
      mm, slub: don't call flush_all() from slab_debug_trace_open()
      mm, slub: allocate private object map for debugfs listings
      mm, slub: allocate private object map for validate_slab_cache()
      mm, slub: don't disable irq for debug_check_no_locks_freed()
      mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
      mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab()
      mm, slub: extract get_partial() from new_slab_objects()
      mm, slub: dissolve new_slab_objects() into ___slab_alloc()
      mm, slub: return slab page from get_partial() and set c->page afterwards
      mm, slub: restructure new page checks in ___slab_alloc()
      mm, slub: simplify kmem_cache_cpu and tid setup
      mm, slub: move disabling/enabling irqs to ___slab_alloc()
      mm, slub: do initial checks in ___slab_alloc() with irqs enabled
      mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
      mm, slub: restore irqs around calling new_slab()
      mm, slub: validate slab from partial list or page allocator before making it cpu slab
      mm, slub: check new pages with restored irqs
      mm, slub: stop disabling irqs around get_partial()
      mm, slub: move reset of c->page and freelist out of deactivate_slab()
      mm, slub: make locking in deactivate_slab() irq-safe
      mm, slub: call deactivate_slab() without disabling irqs
      mm, slub: move irq control into unfreeze_partials()
      mm, slub: discard slabs in unfreeze_partials() without irqs disabled
      mm, slub: detach whole partial list at once in unfreeze_partials()
      mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
      mm, slub: only disable irq with spin_lock in __unfreeze_partials()
      mm, slub: don't disable irqs in slub_cpu_dead()
      mm, slab: make flush_slab() possible to call with irqs enabled

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
      mm: slub: make object_map_lock a raw_spinlock_t

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: optionally save/restore irqs in slab_[un]lock()/
      mm, slub: make slab_lock() disable irqs with PREEMPT_RT
      mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
      mm, slub: use migrate_disable() on PREEMPT_RT
      mm, slub: convert kmem_cpu_slab protection to local_lock

Subsystem: mm/debug

    Gavin Shan <gshan@redhat.com>:
    Patch series "mm/debug_vm_pgtable: Enhancements", v6:
      mm/debug_vm_pgtable: introduce struct pgtable_debug_args
      mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests
      mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests
      mm/debug_vm_pgtable: remove unused code
      mm/debug_vm_pgtable: fix corrupted page flag

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: report a more useful address for reclaim acquisition

    liuhailong <liuhailong@oppo.com>:
      mm: add kernel_misc_reclaimable in show_free_areas

Subsystem: mm/pagecache

    Jan Kara <jack@suse.cz>:
    Patch series "writeback: Fix bandwidth estimates", v4:
      writeback: track number of inodes under writeback
      writeback: reliably update bandwidth estimation
      writeback: fix bandwidth estimate for spiky workload
      writeback: rename domain_update_bandwidth()
      writeback: use READ_ONCE for unlocked reads of writeback stats

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: remove irqsave/restore locking from contexts with irqs enabled
      fs: drop_caches: fix skipping over shadow cache inodes
      fs: inode: count invalidated shadow pages in pginodesteal

    Shakeel Butt <shakeelb@google.com>:
      writeback: memcg: simplify cgroup_writeback_by_id

    Jing Yangyang <jing.yangyang@zte.com.cn>:
      include/linux/buffer_head.h: fix boolreturn.cocci warnings

Subsystem: mm/gup

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for gup":
      mm: gup: remove set but unused local variable major
      mm: gup: remove unneed local variable orig_refs
      mm: gup: remove useless BUG_ON in __get_user_pages()
      mm: gup: fix potential pgmap refcnt leak in __gup_device_huge()
      mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range()

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "A few gup refactorings and documentation updates", v3:
      mm/gup: documentation corrections for gup/pup
      mm/gup: small refactoring: simplify try_grab_page()
      mm/gup: remove try_get_page(), call try_get_compound_head() directly

Subsystem: mm/swap

    Hugh Dickins <hughd@google.com>:
      fs, mm: fix race in unlinking swapfile

    John Hubbard <jhubbard@nvidia.com>:
      mm: delete unused get_kernel_page()

Subsystem: mm/shmem

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      shmem: use raw_spinlock_t for ->stat_lock

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for shmem":
      shmem: remove unneeded variable ret
      shmem: remove unneeded header file
      shmem: remove unneeded function forward declaration
      shmem: include header file to declare swap_info

    Hugh Dickins <hughd@google.com>:
    Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups":
      huge tmpfs: fix fallocate(vanilla) advance over huge pages
      huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE
      huge tmpfs: remove shrinklist addition from shmem_setattr()
      huge tmpfs: revert shmem's use of transhuge_vma_enabled()
      huge tmpfs: move shmem_huge_enabled() upwards
      huge tmpfs: SGP_NOALLOC to stop collapse_file() on race
      huge tmpfs: shmem_is_huge(vma, inode, index)
      huge tmpfs: decide stat.st_blksize by shmem_is_huge()
      shmem: shmem_writepage() split unlikely i915 THP

Subsystem: mm/memcg

    Suren Baghdasaryan <surenb@google.com>:
      mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions
      mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config
      mm, memcg: inline swap-related functions to improve disabled memcg config

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: enable accounting for pids in nested pid namespaces

    Shakeel Butt <shakeelb@google.com>:
      memcg: switch lruvec stats to rstat
      memcg: infrastructure to flush memcg stats

    Yutian Yang <nglaive@gmail.com>:
      memcg: charge fs_context and legacy_fs_context

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "memcg accounting from OpenVZ", v7:
      memcg: enable accounting for mnt_cache entries
      memcg: enable accounting for pollfd and select bits arrays
      memcg: enable accounting for file lock caches
      memcg: enable accounting for fasync_cache
      memcg: enable accounting for new namesapces and struct nsproxy
      memcg: enable accounting of ipc resources
      memcg: enable accounting for signals
      memcg: enable accounting for posix_timers_cache slab
      memcg: enable accounting for ldt_struct objects

    Shakeel Butt <shakeelb@google.com>:
      memcg: cleanup racy sum avoidance code

    Vasily Averin <vvs@virtuozzo.com>:
      memcg: replace in_interrupt() by !in_task() in active_memcg()

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: memcontrol: set the correct memcg swappiness restriction

    Miaohe Lin <linmiaohe@huawei.com>:
      mm, memcg: remove unused functions
      mm, memcg: save some atomic ops when flush is already true

    Michal Hocko <mhocko@suse.com>:
      memcg: fix up drain_local_stock comment

    Shakeel Butt <shakeelb@google.com>:
      memcg: make memcg->event_list_lock irqsafe

Subsystem: mm/selftests

    Po-Hsu Lin <po-hsu.lin@canonical.com>:
      selftests/vm: use kselftest skip code for skipped tests

    Colin Ian King <colin.king@canonical.com>:
      selftests: Fix spelling mistake "cann't" -> "cannot"

Subsystem: mm/pagemap

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "shoot lazy tlbs", v4:
      lazy tlb: introduce lazy mm refcount helper functions
      lazy tlb: allow lazy tlb mm refcounting to be configurable
      lazy tlb: shoot lazies, a non-refcounting lazy tlb option
      powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN

    Christoph Hellwig <hch@lst.de>:
    Patch series "_kernel_dcache_page fixes and removal":
      mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data
      mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page
      scatterlist: replace flush_kernel_dcache_page with flush_dcache_page
      mm: remove flush_kernel_dcache_page

    Huang Ying <ying.huang@intel.com>:
      mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code

    Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
      mm: change fault_in_pages_* to have an unsigned size parameter

    Luigi Rizzo <lrizzo@google.com>:
      mm/pagemap: add mmap_assert_locked() annotations to find_vma*()

    "Liam R. Howlett" <Liam.Howlett@Oracle.com>:
      remap_file_pages: Use vma_lookup() instead of find_vma()

Subsystem: mm/mremap

    Chen Wandun <chenwandun@huawei.com>:
      mm/mremap: fix memory account on do_munmap() failure

Subsystem: mm/bootmem

    Muchun Song <songmuchun@bytedance.com>:
      mm/bootmem_info.c: mark __init on register_page_bootmem_info_section

Subsystem: mm/sparsemem

    Ohhoon Kwon <ohoono.kwon@samsung.com>:
    Patch series "mm: sparse: remove __section_nr() function", v4:
      mm: sparse: pass section_nr to section_mark_present
      mm: sparse: pass section_nr to find_memory_block
      mm: sparse: remove __section_nr() function

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/sparse: set SECTION_NID_SHIFT to 6

    Matthew Wilcox <willy@infradead.org>:
      include/linux/mmzone.h: avoid a warning in sparse memory support

    Miles Chen <miles.chen@mediatek.com>:
      mm/sparse: clarify pgdat_to_phys

Subsystem: mm/vmalloc

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: use batched page requests in bulk-allocator
      mm/vmalloc: remove gfpflags_allow_blocking() check
      lib/test_vmalloc.c: add a new 'nr_pages' parameter

    Chen Wandun <chenwandun@huawei.com>:
      mm/vmalloc: fix wrong behavior in vread

Subsystem: mm/kasan

    Woody Lin <woodylin@google.com>:
      mm/kasan: move kasan.fault to mm/kasan/report.c

    Andrey Konovalov <andreyknvl@gmail.com>:
    Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2:
      kasan: test: rework kmalloc_oob_right
      kasan: test: avoid writing invalid memory
      kasan: test: avoid corrupting memory via memset
      kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS
      kasan: test: only do kmalloc_uaf_memset for generic mode
      kasan: test: clean up ksize_uaf
      kasan: test: avoid corrupting memory in copy_user_test
      kasan: test: avoid corrupting memory in kasan_rcu_uaf

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: ensure consistency of memory map poisoning":
      mm/page_alloc: always initialize memory map for the holes
      microblaze: simplify pte_alloc_one_kernel()
      mm: introduce memmap_alloc() to unify memory map allocation
      memblock: stop poisoning raw allocations

    Nico Pache <npache@redhat.com>:
      mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc: make alloc_node_mem_map() __init rather than __ref

    Vasily Averin <vvs@virtuozzo.com>:
      mm/page_alloc.c: use in_task()

    "George G. Davis" <davis.george@siemens.com>:
      mm/page_isolation: tracing: trace all test_pages_isolated failures

Subsystem: mm/memory-failure

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups and fixup for hwpoison":
      mm/hwpoison: remove unneeded variable unmap_success
      mm/hwpoison: fix potential pte_unmap_unlock pte error
      mm/hwpoison: change argument struct page **hpagep to *hpage
      mm/hwpoison: fix some obsolete comments

    Yang Shi <shy828301@gmail.com>:
      mm: hwpoison: don't drop slab caches for offlining non-LRU page
      doc: hwpoison: correct the support for hugepage
      mm: hwpoison: dump page for unhandlable page

    Michael Wang <yun.wang@linux.alibaba.com>:
      mm: fix panic caused by __page_handle_poison()

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: simplify prep_compound_gigantic_page ref count racing code
      hugetlb: drop ref count earlier after page allocation
      hugetlb: before freeing hugetlb page set dtor to appropriate value
      hugetlb: fix hugetlb cgroup refcounting during vma split

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
    Patch series "userfaultfd: minor bug fixes":
      userfaultfd: change mmap_changing to atomic
      userfaultfd: prevent concurrent API initialization
      selftests/vm/userfaultfd: wake after copy failure

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "Migrate Pages in lieu of discard", v11:
      mm/numa: automatically generate node migration order
      mm/migrate: update node demotion order on hotplug events

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/migrate: enable returning precise migrate_pages() success count

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/migrate: demote pages during reclaim

    Yang Shi <yang.shi@linux.alibaba.com>:
      mm/vmscan: add page demotion counter

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: add helper for querying ability to age anonymous pages

    Keith Busch <kbusch@kernel.org>:
      mm/vmscan: Consider anonymous pages without swap

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: never demote for memcg reclaim

    Huang Ying <ying.huang@intel.com>:
      mm/migrate: add sysfs interface to enable reclaim migration

    Hui Su <suhui@zeku.com>:
      mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg()

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for vmscan", v2:
      mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed
      mm/vmscan: remove misleading setting to sc->priority
      mm/vmscan: remove unneeded return value of kswapd_run()
      mm/vmscan: add 'else' to remove check_pending label

    Vlastimil Babka <vbabka@suse.cz>:
      mm, vmscan: guarantee drop_slab_node() termination

Subsystem: mm/compaction

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: optimize proactive compaction deferrals
      mm: compaction: support triggering of proactive compaction by user

Subsystem: mm/mempolicy

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "Introduce multi-preference mempolicy", v7:
      mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes

    Feng Tang <feng.tang@intel.com>:
      mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY
      mm/mempolicy: advertise new MPOL_PREFERRED_MANY

    Feng Tang <feng.tang@intel.com>:
      mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies

    Vasily Averin <vvs@virtuozzo.com>:
      mm/mempolicy.c: use in_task() in mempolicy_slab_node()

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      memblock: make memblock_find_in_range method private

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm: introduce process_mrelease system call
      mm: wire up syscall process_mrelease

Subsystem: mm/migration

    Randy Dunlap <rdunlap@infradead.org>:
      mm/migrate: correct kernel-doc notation

Subsystem: mm/ksm

    Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>:
    Patch series "add KSM selftests":
      selftests: vm: add KSM merge test
      selftests: vm: add KSM unmerge test
      selftests: vm: add KSM zero page merging test
      selftests: vm: add KSM merging across nodes test
      mm: KSM: fix data type
    Patch series "add KSM performance tests", v3:
      selftests: vm: add KSM merging time test
      selftests: vm: add COW time test for KSM pages

Subsystem: mm/percpu

    Jing Xiangfeng <jingxiangfeng@huawei.com>:
      mm/percpu,c: remove obsolete comments of pcpu_chunk_populated()

Subsystem: mm/vmstat

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for vmstat":
      mm/vmstat: correct some wrong comments
      mm/vmstat: simplify the array size calculation
      mm/vmstat: remove unneeded return value

Subsystem: mm/madvise

    zhangkui <zhangkui@oppo.com>:
      mm/madvise: add MADV_WILLNEED to process_madvise()

 Documentation/ABI/testing/sysfs-kernel-mm-numa         |   24 
 Documentation/admin-guide/mm/numa_memory_policy.rst    |   15 
 Documentation/admin-guide/sysctl/vm.rst                |    3 
 Documentation/core-api/cachetlb.rst                    |   86 -
 Documentation/dev-tools/kasan.rst                      |   13 
 Documentation/translations/zh_CN/core-api/cachetlb.rst |    9 
 Documentation/vm/hwpoison.rst                          |    1 
 arch/Kconfig                                           |   28 
 arch/alpha/kernel/syscalls/syscall.tbl                 |    2 
 arch/arm/include/asm/cacheflush.h                      |    4 
 arch/arm/kernel/setup.c                                |   20 
 arch/arm/mach-rpc/ecard.c                              |    2 
 arch/arm/mm/flush.c                                    |   33 
 arch/arm/mm/nommu.c                                    |    6 
 arch/arm/tools/syscall.tbl                             |    2 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    2 
 arch/arm64/kvm/hyp/reserved_mem.c                      |    9 
 arch/arm64/mm/init.c                                   |   38 
 arch/csky/abiv1/cacheflush.c                           |   11 
 arch/csky/abiv1/inc/abi/cacheflush.h                   |    4 
 arch/csky/kernel/probes/kprobes.c                      |    3 
 arch/ia64/include/asm/meminit.h                        |    2 
 arch/ia64/kernel/acpi.c                                |    2 
 arch/ia64/kernel/setup.c                               |   55 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    2 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    2 
 arch/microblaze/include/asm/page.h                     |    3 
 arch/microblaze/include/asm/pgtable.h                  |    2 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    2 
 arch/microblaze/mm/init.c                              |   12 
 arch/microblaze/mm/pgtable.c                           |   17 
 arch/mips/include/asm/cacheflush.h                     |    8 
 arch/mips/kernel/setup.c                               |   14 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    2 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    2 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    2 
 arch/nds32/include/asm/cacheflush.h                    |    3 
 arch/nds32/mm/cacheflush.c                             |    9 
 arch/parisc/include/asm/cacheflush.h                   |    8 
 arch/parisc/kernel/cache.c                             |    3 
 arch/parisc/kernel/syscalls/syscall.tbl                |    2 
 arch/powerpc/Kconfig                                   |    1 
 arch/powerpc/kernel/smp.c                              |    2 
 arch/powerpc/kernel/syscalls/syscall.tbl               |    2 
 arch/powerpc/mm/book3s64/radix_tlb.c                   |    4 
 arch/powerpc/platforms/pseries/hotplug-memory.c        |    4 
 arch/riscv/mm/init.c                                   |   44 
 arch/s390/kernel/setup.c                               |    9 
 arch/s390/kernel/syscalls/syscall.tbl                  |    2 
 arch/s390/mm/fault.c                                   |    2 
 arch/sh/include/asm/cacheflush.h                       |    8 
 arch/sh/kernel/syscalls/syscall.tbl                    |    2 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    2 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    1 
 arch/x86/kernel/aperture_64.c                          |    5 
 arch/x86/kernel/ldt.c                                  |    6 
 arch/x86/mm/init.c                                     |   23 
 arch/x86/mm/numa.c                                     |    5 
 arch/x86/mm/numa_emulation.c                           |    5 
 arch/x86/realmode/init.c                               |    2 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    2 
 block/blk-map.c                                        |    2 
 drivers/acpi/tables.c                                  |    5 
 drivers/base/arch_numa.c                               |    5 
 drivers/base/memory.c                                  |    4 
 drivers/mmc/host/jz4740_mmc.c                          |    4 
 drivers/mmc/host/mmc_spi.c                             |    2 
 drivers/of/of_reserved_mem.c                           |   12 
 fs/drop_caches.c                                       |    3 
 fs/exec.c                                              |   12 
 fs/fcntl.c                                             |    3 
 fs/fs-writeback.c                                      |   28 
 fs/fs_context.c                                        |    4 
 fs/inode.c                                             |    2 
 fs/locks.c                                             |    6 
 fs/namei.c                                             |    8 
 fs/namespace.c                                         |    7 
 fs/ocfs2/dlmglue.c                                     |   14 
 fs/ocfs2/quota_global.c                                |    1 
 fs/ocfs2/quota_local.c                                 |    2 
 fs/pipe.c                                              |    2 
 fs/select.c                                            |    4 
 fs/userfaultfd.c                                       |  116 -
 include/linux/backing-dev-defs.h                       |    2 
 include/linux/backing-dev.h                            |   19 
 include/linux/buffer_head.h                            |    2 
 include/linux/compaction.h                             |    2 
 include/linux/highmem.h                                |    5 
 include/linux/hugetlb_cgroup.h                         |   12 
 include/linux/memblock.h                               |    2 
 include/linux/memcontrol.h                             |  118 +
 include/linux/memory.h                                 |    2 
 include/linux/mempolicy.h                              |   16 
 include/linux/migrate.h                                |   14 
 include/linux/mm.h                                     |   17 
 include/linux/mmzone.h                                 |    4 
 include/linux/page-flags.h                             |    9 
 include/linux/pagemap.h                                |    4 
 include/linux/sched/mm.h                               |   35 
 include/linux/shmem_fs.h                               |   25 
 include/linux/slub_def.h                               |    6 
 include/linux/swap.h                                   |   28 
 include/linux/syscalls.h                               |    1 
 include/linux/userfaultfd_k.h                          |    8 
 include/linux/vm_event_item.h                          |    2 
 include/linux/vmpressure.h                             |    2 
 include/linux/writeback.h                              |    4 
 include/trace/events/migrate.h                         |    3 
 include/uapi/asm-generic/unistd.h                      |    4 
 include/uapi/linux/mempolicy.h                         |    1 
 ipc/msg.c                                              |    2 
 ipc/namespace.c                                        |    2 
 ipc/sem.c                                              |    9 
 ipc/shm.c                                              |    2 
 kernel/cgroup/namespace.c                              |    2 
 kernel/cpu.c                                           |    2 
 kernel/exit.c                                          |    2 
 kernel/fork.c                                          |   51 
 kernel/kthread.c                                       |   21 
 kernel/nsproxy.c                                       |    2 
 kernel/pid_namespace.c                                 |    5 
 kernel/sched/core.c                                    |   37 
 kernel/sched/sched.h                                   |    4 
 kernel/signal.c                                        |    2 
 kernel/sys_ni.c                                        |    1 
 kernel/sysctl.c                                        |    2 
 kernel/time/namespace.c                                |    4 
 kernel/time/posix-timers.c                             |    4 
 kernel/user_namespace.c                                |    2 
 lib/scatterlist.c                                      |    5 
 lib/test_kasan.c                                       |   80 -
 lib/test_kasan_module.c                                |   20 
 lib/test_vmalloc.c                                     |    5 
 mm/backing-dev.c                                       |   11 
 mm/bootmem_info.c                                      |    4 
 mm/compaction.c                                        |   69 -
 mm/debug_vm_pgtable.c                                  |  982 +++++++++------
 mm/filemap.c                                           |   15 
 mm/gup.c                                               |  109 -
 mm/huge_memory.c                                       |   32 
 mm/hugetlb.c                                           |  173 ++
 mm/hwpoison-inject.c                                   |    2 
 mm/internal.h                                          |    9 
 mm/kasan/hw_tags.c                                     |   43 
 mm/kasan/kasan.h                                       |    1 
 mm/kasan/report.c                                      |   29 
 mm/khugepaged.c                                        |    2 
 mm/ksm.c                                               |    8 
 mm/madvise.c                                           |    1 
 mm/memblock.c                                          |   22 
 mm/memcontrol.c                                        |  234 +--
 mm/memory-failure.c                                    |   53 
 mm/memory_hotplug.c                                    |    2 
 mm/mempolicy.c                                         |  207 ++-
 mm/migrate.c                                           |  319 ++++
 mm/mmap.c                                              |    7 
 mm/mremap.c                                            |    2 
 mm/oom_kill.c                                          |   70 +
 mm/page-writeback.c                                    |  133 +-
 mm/page_alloc.c                                        |   62 
 mm/page_isolation.c                                    |   13 
 mm/percpu.c                                            |    3 
 mm/shmem.c                                             |  309 ++--
 mm/slab_common.c                                       |    2 
 mm/slub.c                                              | 1085 ++++++++++-------
 mm/sparse.c                                            |   46 
 mm/swap.c                                              |   22 
 mm/swapfile.c                                          |   14 
 mm/truncate.c                                          |   28 
 mm/userfaultfd.c                                       |   15 
 mm/vmalloc.c                                           |   79 -
 mm/vmpressure.c                                        |   10 
 mm/vmscan.c                                            |  220 ++-
 mm/vmstat.c                                            |   25 
 security/tomoyo/domain.c                               |   13 
 tools/testing/scatterlist/linux/mm.h                   |    1 
 tools/testing/selftests/vm/.gitignore                  |    1 
 tools/testing/selftests/vm/Makefile                    |    3 
 tools/testing/selftests/vm/charge_reserved_hugetlb.sh  |    5 
 tools/testing/selftests/vm/hugetlb_reparenting_test.sh |    5 
 tools/testing/selftests/vm/ksm_tests.c                 |  696 ++++++++++
 tools/testing/selftests/vm/mlock-random-test.c         |    2 
 tools/testing/selftests/vm/run_vmtests.sh              |   98 +
 tools/testing/selftests/vm/userfaultfd.c               |   13 
 186 files changed, 4488 insertions(+), 2281 deletions(-)

incoming

[Andrew Morton]

2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9.

Subsystems affected by this patch series:

  mm/memory-hotplug
  MAINTAINERS

Subsystem: mm/memory-hotplug

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory_hotplug: fix potential permanent lru cache disable

Subsystem: MAINTAINERS

    Namjae Jeon <namjae.jeon@samsung.com>:
      MAINTAINERS: exfat: update my email address

 MAINTAINERS         |    2 +-
 mm/memory_hotplug.c |    1 +
 2 files changed, 2 insertions(+), 1 deletion(-)

incoming

[Andrew Morton]

10 patches, based on 614cb2751d3150850d459bee596c397f344a7936.

Subsystems affected by this patch series:

  mm/shmem
  mm/pagealloc
  mm/tracing
  MAINTAINERS
  mm/memcg
  mm/memory-failure
  mm/vmscan
  mm/kfence
  mm/hugetlb

Subsystem: mm/shmem

    Yang Shi <shy828301@gmail.com>:
      Revert "mm/shmem: fix shmem_swapin() race with swapoff"
      Revert "mm: swap: check if swap backing device is congested or not"

Subsystem: mm/pagealloc

    Doug Berger <opendmb@gmail.com>:
      mm/page_alloc: don't corrupt pcppage_migratetype

Subsystem: mm/tracing

    Mike Rapoport <rppt@linux.ibm.com>:
      mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS: update ClangBuiltLinux IRC chat

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: retry with shake_page() for unhandlable pages

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: vmscan: fix missing psi annotation for node_reclaim()

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: don't pass page cache pages to restore_reserve_on_error

 MAINTAINERS                    |    2 +-
 include/linux/kfence.h         |    7 ++++---
 include/linux/memcontrol.h     |   29 +++++++++++++++--------------
 include/trace/events/mmflags.h |    4 +++-
 mm/hugetlb.c                   |   19 ++++++++++++++-----
 mm/memory-failure.c            |   12 +++++++++---
 mm/page_alloc.c                |   25 ++++++++++++-------------
 mm/shmem.c                     |   14 +-------------
 mm/swap_state.c                |    7 -------
 mm/vmscan.c                    |   30 ++++++++++++++++++++++--------
 10 files changed, 81 insertions(+), 68 deletions(-)

incoming

[Andrew Morton]

7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008.

Subsystems affected by this patch series:

  mm/kasan
  mm/slub
  mm/madvise
  mm/memcg
  lib

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
    Patch series "kasan, slub: reset tag when printing address", v3:
      kasan, kmemleak: reset tags when scanning block
      kasan, slub: reset tag when printing address

Subsystem: mm/slub

    Shakeel Butt <shakeelb@google.com>:
      slub: fix kmalloc_pagealloc_invalid_free unit test

    Vlastimil Babka <vbabka@suse.cz>:
      mm: slub: fix slub_debug disabling for list of slabs

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
      mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE)

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
      mm/memcg: fix incorrect flushing of lruvec data in obj_stock

Subsystem: lib

    Liang Wang <wangliang101@huawei.com>:
      lib: use PFN_PHYS() in devmem_is_allowed()

 lib/devmem_is_allowed.c |    2 +-
 mm/gup.c                |    7 +++++--
 mm/kmemleak.c           |    6 +++---
 mm/madvise.c            |    4 +++-
 mm/memcontrol.c         |    6 ++++--
 mm/slub.c               |   25 ++++++++++++++-----------
 6 files changed, 30 insertions(+), 20 deletions(-)

incoming

[Andrew Morton]

7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2.

Subsystems affected by this patch series:

  lib
  ocfs2
  mm/memcg
  mm/migration
  mm/slub
  mm/memcg

Subsystem: lib

    Matteo Croce <mcroce@microsoft.com>:
      lib/test_string.c: move string selftest in the Runtime Testing menu

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: fix zero out valid data
      ocfs2: issue zeroout to EOF blocks

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code

Subsystem: mm/migration

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/migrate: fix NR_ISOLATED corruption on 64-bit

Subsystem: mm/slub

    Shakeel Butt <shakeelb@google.com>:
      slub: fix unreclaimable slab stat for bulk free

Subsystem: mm/memcg

    Wang Hai <wanghai38@huawei.com>:
      mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook()

 fs/ocfs2/file.c   |  103 ++++++++++++++++++++++++++++++++----------------------
 lib/Kconfig       |    3 -
 lib/Kconfig.debug |    3 +
 mm/memcontrol.c   |    3 +
 mm/migrate.c      |    2 -
 mm/slab.h         |    2 -
 mm/slub.c         |   22 ++++++-----
 7 files changed, 81 insertions(+), 57 deletions(-)

incoming

[Andrew Morton]

15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55.

Subsystems affected by this patch series:

  mm/userfaultfd
  mm/kfence
  mm/highmem
  mm/pagealloc
  mm/memblock
  mm/pagecache
  mm/secretmem
  mm/pagemap
  mm/hugetlbfs

Subsystem: mm/userfaultfd

    Peter Collingbourne <pcc@google.com>:
    Patch series "userfaultfd: do not untag user pointers", v5:
      userfaultfd: do not untag user pointers
      selftest: use mmap instead of posix_memalign to allocate memory

Subsystem: mm/kfence

    Weizhao Ouyang <o451686892@gmail.com>:
      kfence: defer kfence_test_init to ensure that kunit debugfs is created

    Alexander Potapenko <glider@google.com>:
      kfence: move the size check to the beginning of __kfence_alloc()
      kfence: skip all GFP_ZONEMASK allocations

Subsystem: mm/highmem

    Christoph Hellwig <hch@lst.de>:
      mm: call flush_dcache_page() in memcpy_to_page() and memzero_page()
      mm: use kmap_local_page in memzero_page

Subsystem: mm/pagealloc

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions

Subsystem: mm/pagecache

    Roman Gushchin <guro@fb.com>:
      writeback, cgroup: remove wb from offline list before releasing refcnt
      writeback, cgroup: do not reparent dax inodes

Subsystem: mm/secretmem

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/secretmem: wire up ->set_page_dirty

Subsystem: mm/pagemap

    Muchun Song <songmuchun@bytedance.com>:
      mm: mmap_lock: fix disabling preemption directly

    Qi Zheng <zhengqi.arch@bytedance.com>:
      mm: fix the deadlock in finish_fault()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: fix mount mode command line processing

 Documentation/arm64/tagged-address-abi.rst |   26 ++++++++++++++++++--------
 fs/fs-writeback.c                          |    3 +++
 fs/hugetlbfs/inode.c                       |    2 +-
 fs/userfaultfd.c                           |   26 ++++++++++++--------------
 include/linux/highmem.h                    |    6 ++++--
 include/linux/memblock.h                   |    4 ++--
 mm/backing-dev.c                           |    2 +-
 mm/kfence/core.c                           |   19 ++++++++++++++++---
 mm/kfence/kfence_test.c                    |    2 +-
 mm/memblock.c                              |    3 ++-
 mm/memory.c                                |   11 ++++++++++-
 mm/mmap_lock.c                             |    4 ++--
 mm/page_alloc.c                            |   29 ++++++++++++++++-------------
 mm/secretmem.c                             |    1 +
 tools/testing/selftests/vm/userfaultfd.c   |    6 ++++--
 15 files changed, 93 insertions(+), 51 deletions(-)

incoming

[Andrew Morton]

13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e.

Subsystems affected by this patch series:

  mm/kasan
  mm/pagealloc
  mm/rmap
  mm/hmm
  hfs
  mm/hugetlb

Subsystem: mm/kasan

    Marco Elver <elver@google.com>:
      mm: move helper to check slub_debug_enabled

    Yee Lee <yee.lee@mediatek.com>:
      kasan: add memzero init for unaligned size at DEBUG

    Marco Elver <elver@google.com>:
      kasan: fix build by including kernel.h

Subsystem: mm/pagealloc

    Matteo Croce <mcroce@microsoft.com>:
      Revert "mm/page_alloc: make should_fail_alloc_page() static"

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: avoid page allocator recursion with pagesets.lock held

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/page_alloc: correct return value when failing at preparing

    Chuck Lever <chuck.lever@oracle.com>:
      mm/page_alloc: further fix __alloc_pages_bulk() return value

Subsystem: mm/rmap

    Christoph Hellwig <hch@lst.de>:
      mm: fix the try_to_unmap prototype for !CONFIG_MMU

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
      lib/test_hmm: remove set but unused page variable

Subsystem: hfs

    Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
    Patch series "hfs: fix various errors", v2:
      hfs: add missing clean-up in hfs_fill_super
      hfs: fix high memory mapping in hfs_bnode_read
      hfs: add lock nesting notation to hfs_find_init

Subsystem: mm/hugetlb

    Joao Martins <joao.m.martins@oracle.com>:
      mm/hugetlb: fix refs calculation from unaligned @vaddr

 fs/hfs/bfind.c        |   14 +++++++++++++-
 fs/hfs/bnode.c        |   25 ++++++++++++++++++++-----
 fs/hfs/btree.h        |    7 +++++++
 fs/hfs/super.c        |   10 +++++-----
 include/linux/kasan.h |    1 +
 include/linux/rmap.h  |    4 +++-
 lib/test_hmm.c        |    2 --
 mm/hugetlb.c          |    5 +++--
 mm/kasan/kasan.h      |   12 ++++++++++++
 mm/page_alloc.c       |   30 ++++++++++++++++++++++--------
 mm/slab.h             |   15 +++++++++++----
 mm/slub.c             |   14 --------------
 12 files changed, 97 insertions(+), 42 deletions(-)

incoming

[Andrew Morton]

54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d.

Subsystems affected by this patch series:

  lib
  mm/slub
  mm/secretmem
  mm/cleanups
  mm/init
  debug
  mm/pagemap
  mm/mremap

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/test: fix spelling mistakes
      lib: fix spelling mistakes
      lib: fix spelling mistakes in header files

Subsystem: mm/slub

    Nathan Chancellor <nathan@kernel.org>:
    Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN":
      hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script
      hexagon: use common DISCARDS macro
      hexagon: select ARCH_WANT_LD_ORPHAN_WARN

    Oliver Glitta <glittao@gmail.com>:
      mm/slub: use stackdepot to save stack trace in objects

Subsystem: mm/secretmem

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20:
      mmap: make mlock_future_check() global
      riscv/Kconfig: make direct map manipulation options depend on MMU
      set_memory: allow querying whether set_direct_map_*() is actually enabled
      mm: introduce memfd_secret system call to create "secret" memory areas
      PM: hibernate: disable when there are active secretmem users
      arch, mm: wire up memfd_secret system call where relevant
      secretmem: test: add basic selftest for memfd_secret(2)

Subsystem: mm/cleanups

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm: fix spelling mistakes in header files

Subsystem: mm/init

    Kefeng Wang <wangkefeng.wang@huawei.com>:
    Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3:
      mm: add setup_initial_init_mm() helper
      arc: convert to setup_initial_init_mm()
      arm: convert to setup_initial_init_mm()
      arm64: convert to setup_initial_init_mm()
      csky: convert to setup_initial_init_mm()
      h8300: convert to setup_initial_init_mm()
      m68k: convert to setup_initial_init_mm()
      nds32: convert to setup_initial_init_mm()
      nios2: convert to setup_initial_init_mm()
      openrisc: convert to setup_initial_init_mm()
      powerpc: convert to setup_initial_init_mm()
      riscv: convert to setup_initial_init_mm()
      s390: convert to setup_initial_init_mm()
      sh: convert to setup_initial_init_mm()
      x86: convert to setup_initial_init_mm()

Subsystem: debug

    Stephen Boyd <swboyd@chromium.org>:
    Patch series "Add build ID to stacktraces", v6:
      buildid: only consider GNU notes for build ID parsing
      buildid: add API to parse build ID out of buffer
      buildid: stash away kernels build ID on init
      dump_stack: add vmlinux build ID to stack traces
      module: add printk formats to add module build ID to stacktraces
      arm64: stacktrace: use %pSb for backtrace printing
      x86/dumpstack: use %pSb/%pBb for backtrace printing
      scripts/decode_stacktrace.sh: support debuginfod
      scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm
      scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path
      buildid: mark some arguments const
      buildid: fix kernel-doc notation
      kdump: use vmlinux_build_id to simplify

Subsystem: mm/pagemap

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t *
      mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t *

Subsystem: mm/mremap

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mrermap fixes", v2:
      selftest/mremap_test: update the test to handle pagesize other than 4K
      selftest/mremap_test: avoid crash with static build
      mm/mremap: convert huge PUD move to separate helper
      mm/mremap: don't enable optimized PUD move if page table levels is 2
      mm/mremap: use pmd/pud_poplulate to update page table entries
      mm/mremap: hold the rmap lock in write mode when moving page table entries.
    Patch series "Speedup mremap on ppc64", v8:
      mm/mremap: allow arch runtime override
      powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache
      powerpc/mm: enable HAVE_MOVE_PMD support

 Documentation/core-api/printk-formats.rst           |   11 
 arch/alpha/include/asm/pgtable.h                    |    8 
 arch/arc/mm/init.c                                  |    5 
 arch/arm/include/asm/pgtable-3level.h               |    2 
 arch/arm/kernel/setup.c                             |    5 
 arch/arm64/include/asm/Kbuild                       |    1 
 arch/arm64/include/asm/cacheflush.h                 |    6 
 arch/arm64/include/asm/kfence.h                     |    2 
 arch/arm64/include/asm/pgtable.h                    |    8 
 arch/arm64/include/asm/set_memory.h                 |   17 +
 arch/arm64/include/uapi/asm/unistd.h                |    1 
 arch/arm64/kernel/machine_kexec.c                   |    1 
 arch/arm64/kernel/setup.c                           |    5 
 arch/arm64/kernel/stacktrace.c                      |    2 
 arch/arm64/mm/mmu.c                                 |    7 
 arch/arm64/mm/pageattr.c                            |   13 
 arch/csky/kernel/setup.c                            |    5 
 arch/h8300/kernel/setup.c                           |    5 
 arch/hexagon/Kconfig                                |    1 
 arch/hexagon/kernel/vmlinux.lds.S                   |    9 
 arch/ia64/include/asm/pgtable.h                     |    4 
 arch/m68k/include/asm/motorola_pgtable.h            |    2 
 arch/m68k/kernel/setup_mm.c                         |    5 
 arch/m68k/kernel/setup_no.c                         |    5 
 arch/mips/include/asm/pgtable-64.h                  |    8 
 arch/nds32/kernel/setup.c                           |    5 
 arch/nios2/kernel/setup.c                           |    5 
 arch/openrisc/kernel/setup.c                        |    5 
 arch/parisc/include/asm/pgtable.h                   |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h        |   11 
 arch/powerpc/include/asm/book3s/64/tlbflush-radix.h |    2 
 arch/powerpc/include/asm/nohash/64/pgtable-4k.h     |    6 
 arch/powerpc/include/asm/nohash/64/pgtable.h        |    6 
 arch/powerpc/include/asm/tlb.h                      |    6 
 arch/powerpc/kernel/setup-common.c                  |    5 
 arch/powerpc/mm/book3s64/radix_hugetlbpage.c        |    8 
 arch/powerpc/mm/book3s64/radix_pgtable.c            |    6 
 arch/powerpc/mm/book3s64/radix_tlb.c                |   44 +-
 arch/powerpc/mm/pgtable_64.c                        |    4 
 arch/powerpc/platforms/Kconfig.cputype              |    2 
 arch/riscv/Kconfig                                  |    4 
 arch/riscv/include/asm/pgtable-64.h                 |    4 
 arch/riscv/include/asm/unistd.h                     |    1 
 arch/riscv/kernel/setup.c                           |    5 
 arch/s390/kernel/setup.c                            |    5 
 arch/sh/include/asm/pgtable-3level.h                |    4 
 arch/sh/kernel/setup.c                              |    5 
 arch/sparc/include/asm/pgtable_32.h                 |    6 
 arch/sparc/include/asm/pgtable_64.h                 |   10 
 arch/um/include/asm/pgtable-3level.h                |    2 
 arch/x86/entry/syscalls/syscall_32.tbl              |    1 
 arch/x86/entry/syscalls/syscall_64.tbl              |    1 
 arch/x86/include/asm/pgtable.h                      |    8 
 arch/x86/kernel/dumpstack.c                         |    2 
 arch/x86/kernel/setup.c                             |    5 
 arch/x86/mm/init_64.c                               |    4 
 arch/x86/mm/pat/set_memory.c                        |    4 
 arch/x86/mm/pgtable.c                               |    2 
 include/asm-generic/pgtable-nop4d.h                 |    2 
 include/asm-generic/pgtable-nopmd.h                 |    2 
 include/asm-generic/pgtable-nopud.h                 |    4 
 include/linux/bootconfig.h                          |    4 
 include/linux/buildid.h                             |   10 
 include/linux/compaction.h                          |    4 
 include/linux/cpumask.h                             |    2 
 include/linux/crash_core.h                          |   12 
 include/linux/debugobjects.h                        |    2 
 include/linux/hmm.h                                 |    2 
 include/linux/hugetlb.h                             |    6 
 include/linux/kallsyms.h                            |   21 +
 include/linux/list_lru.h                            |    4 
 include/linux/lru_cache.h                           |    8 
 include/linux/mm.h                                  |    3 
 include/linux/mmu_notifier.h                        |    8 
 include/linux/module.h                              |    9 
 include/linux/nodemask.h                            |    6 
 include/linux/percpu-defs.h                         |    2 
 include/linux/percpu-refcount.h                     |    2 
 include/linux/pgtable.h                             |    4 
 include/linux/scatterlist.h                         |    2 
 include/linux/secretmem.h                           |   54 +++
 include/linux/set_memory.h                          |   12 
 include/linux/shrinker.h                            |    2 
 include/linux/syscalls.h                            |    1 
 include/linux/vmalloc.h                             |    4 
 include/uapi/asm-generic/unistd.h                   |    7 
 include/uapi/linux/magic.h                          |    1 
 init/Kconfig                                        |    1 
 init/main.c                                         |    2 
 kernel/crash_core.c                                 |   50 ---
 kernel/kallsyms.c                                   |  104 +++++--
 kernel/module.c                                     |   42 ++
 kernel/power/hibernate.c                            |    5 
 kernel/sys_ni.c                                     |    2 
 lib/Kconfig.debug                                   |   17 -
 lib/asn1_encoder.c                                  |    2 
 lib/buildid.c                                       |   80 ++++-
 lib/devres.c                                        |    2 
 lib/dump_stack.c                                    |   13 
 lib/dynamic_debug.c                                 |    2 
 lib/fonts/font_pearl_8x8.c                          |    2 
 lib/kfifo.c                                         |    2 
 lib/list_sort.c                                     |    2 
 lib/nlattr.c                                        |    4 
 lib/oid_registry.c                                  |    2 
 lib/pldmfw/pldmfw.c                                 |    2 
 lib/reed_solomon/test_rslib.c                       |    2 
 lib/refcount.c                                      |    2 
 lib/rhashtable.c                                    |    2 
 lib/sbitmap.c                                       |    2 
 lib/scatterlist.c                                   |    4 
 lib/seq_buf.c                                       |    2 
 lib/sort.c                                          |    2 
 lib/stackdepot.c                                    |    2 
 lib/test_bitops.c                                   |    2 
 lib/test_bpf.c                                      |    2 
 lib/test_kasan.c                                    |    2 
 lib/test_kmod.c                                     |    6 
 lib/test_scanf.c                                    |    2 
 lib/vsprintf.c                                      |   10 
 mm/Kconfig                                          |    4 
 mm/Makefile                                         |    1 
 mm/gup.c                                            |   12 
 mm/init-mm.c                                        |    9 
 mm/internal.h                                       |    3 
 mm/mlock.c                                          |    3 
 mm/mmap.c                                           |    5 
 mm/mremap.c                                         |  108 ++++++-
 mm/secretmem.c                                      |  254 +++++++++++++++++
 mm/slub.c                                           |   79 +++--
 scripts/checksyscalls.sh                            |    4 
 scripts/decode_stacktrace.sh                        |   89 +++++-
 tools/testing/selftests/vm/.gitignore               |    1 
 tools/testing/selftests/vm/Makefile                 |    3 
 tools/testing/selftests/vm/memfd_secret.c           |  296 ++++++++++++++++++++
 tools/testing/selftests/vm/mremap_test.c            |  116 ++++---
 tools/testing/selftests/vm/run_vmtests.sh           |   17 +
 137 files changed, 1470 insertions(+), 442 deletions(-)

Re: incoming

[Linus Torvalds]

On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
> at the pulls and merges I've done since, this -mm series looks like
> the obvious culprit.

No, unless my bisection is wrong, the -mm branch is innocent, and was
discarded from the suspects on the very first bisection trial.

So never mind.

             Linus

Re: incoming

[Linus Torvalds]

On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> This is the rest of the -mm tree, less 66 patches which are dependent on
> things which are (or were recently) in linux-next.  I'll trickle that
> material over next week.

I haven't bisected this yet, but with the current -git I'm getting

   watchdog: BUG: soft lockup - CPU#41 stuck for 49s!

and the common call chain seems to be in flush_tlb_mm_range ->
on_each_cpu_cond_mask.

Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
at the pulls and merges I've done since, this -mm series looks like
the obvious culprit.

I'll go start bisection, but I thought I'd give a heads-up in case
somebody else has seen TLB-flush-related lockups and already figured
out the guilty party..

                 Linus

incoming

[Andrew Morton]

This is the rest of the -mm tree, less 66 patches which are dependent on
things which are (or were recently) in linux-next.  I'll trickle that
material over next week.


192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the
June 28 sendings.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/kconfig
  mm/proc
  mm/z3fold
  mm/zbud
  mm/ras
  mm/mempolicy
  mm/memblock
  mm/migration
  mm/thp
  mm/nommu
  mm/kconfig
  mm/madvise
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/zram
  mm/cleanups
  mm/kfence
  mm/hmm
  procfs
  sysctl
  misc
  core-kernel
  lib
  lz4
  checkpatch
  init
  kprobes
  nilfs2
  hfs
  signals
  exec
  kcov
  selftests
  compress/decompress
  ipc

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Free some vmemmap pages of HugeTLB page", v23:
      mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c
      mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP
      mm: hugetlb: gather discrete indexes of tail page
      mm: hugetlb: free the vmemmap pages associated with each HugeTLB page
      mm: hugetlb: defer freeing of HugeTLB pages
      mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page
      mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap
      mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled
      mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate

    Shixin Liu <liushixin2@huawei.com>:
      mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE
      mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for huge_memory:, v3:
      mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK
      mm/huge_memory.c: use page->deferred_list
      mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled()
      mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd
      mm/huge_memory.c: don't discard hugepage if other processes are mapping it

    Christophe Leroy <christophe.leroy@csgroup.eu>:
    Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2:
      mm/hugetlb: change parameters of arch_make_huge_pte()
      mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge
      mm/vmalloc: enable mapping of huge pages at pte level in vmap
      mm/vmalloc: enable mapping of huge pages at pte level in vmalloc
      powerpc/8xx: add support for huge pages on VMAP and VMALLOC

    Nanyong Sun <sunnanyong@huawei.com>:
      khugepaged: selftests: remove debug_cow

    Mina Almasry <almasrymina@google.com>:
      mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Split huge PMD mapping of vmemmap pages", v4:
      mm: sparsemem: split the huge PMD mapping of vmemmap pages
      mm: sparsemem: use huge PMD mapping for vmemmap pages
      mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "Fix prep_compound_gigantic_page ref count adjustment":
      hugetlb: remove prep_compound_huge_page cleanup
      hugetlb: address ref count racing in prep_compound_gigantic_page

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: disable pcp for page_handle_poison()

Subsystem: mm/userfaultfd

    Peter Xu <peterx@redhat.com>:
    Patch series "userfaultfd/selftests: A few cleanups", v2:
      userfaultfd/selftests: use user mode only
      userfaultfd/selftests: remove the time() check on delayed uffd
      userfaultfd/selftests: dropping VERIFY check in locking_thread
      userfaultfd/selftests: only dump counts if mode enabled
      userfaultfd/selftests: unify error handling
    Patch series "mm/uffd: Misc fix for uffd-wp and one more test":
      mm/thp: simplify copying of huge zero page pmd when fork
      mm/userfaultfd: fix uffd-wp special cases for fork()
      mm/userfaultfd: fail uffd-wp registration if not supported
      mm/pagemap: export uffd-wp protection information
      userfaultfd/selftests: add pagemap uffd-wp test

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling for shmem", v6:
      userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte
      userfaultfd/shmem: support minor fault registration for shmem
      userfaultfd/shmem: support UFFDIO_CONTINUE for shmem
      userfaultfd/shmem: advertise shmem minor fault support
      userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte()
      userfaultfd/selftests: use memfd_create for shmem test type
      userfaultfd/selftests: create alias mappings in the shmem test
      userfaultfd/selftests: reinitialize test context in each test
      userfaultfd/selftests: exercise minor fault handling shmem support

Subsystem: mm/vmscan

    Yu Zhao <yuzhao@google.com>:
      mm/vmscan.c: fix potential deadlock in reclaim_pages()
      include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: workingset: define macro WORKINGSET_SHIFT

Subsystem: mm/kconfig

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm/kconfig: move HOLES_IN_ZONE into mm

Subsystem: mm/proc

    Mike Rapoport <rppt@linux.ibm.com>:
      docs: proc.rst: meminfo: briefly describe gaps in memory accounting

    David Hildenbrand <david@redhat.com>:
    Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3:
      fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER
      fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM
      fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages
      mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline()
      virtio-mem: use page_offline_(start|end) when setting PageOffline()
      fs/proc/kcore: use page_offline_(freeze|thaw)

Subsystem: mm/z3fold

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for z3fold":
      mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS
      mm/z3fold: avoid possible underflow in z3fold_alloc()
      mm/z3fold: remove magic number in z3fold_create_pool()
      mm/z3fold: remove unused function handle_to_z3fold_header()
      mm/z3fold: fix potential memory leak in z3fold_destroy_pool()
      mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page

Subsystem: mm/zbud

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanups for zbud", v2:
      mm/zbud: reuse unbuddied[0] as buddied in zbud_pool
      mm/zbud: don't export any zbud API

Subsystem: mm/ras

    YueHaibing <yuehaibing@huawei.com>:
      mm/compaction: use DEVICE_ATTR_WO macro

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm: compaction: remove duplicate !list_empty(&sublist) check

    Wonhyuk Yang <vvghjk1234@gmail.com>:
      mm/compaction: fix 'limit' in fast_isolate_freepages

Subsystem: mm/mempolicy

    Feng Tang <feng.tang@intel.com>:
    Patch series "mm/mempolicy: some fix and semantics cleanup", v4:
      mm/mempolicy: cleanup nodemask intersection check for oom
      mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy
      mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy

    Yang Shi <shy828301@gmail.com>:
      mm: mempolicy: don't have to split pmd for huge zero page

    Ben Widawsky <ben.widawsky@intel.com>:
      mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4:
      include/linux/mmzone.h: add documentation for pfn_valid()
      memblock: update initialization of reserved pages
      arm64: decouple check whether pfn is in linear map from pfn_valid()
      arm64: drop pfn_valid_within() and simplify pfn_valid()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      arm64/mm: drop HAVE_ARCH_PFN_VALID

Subsystem: mm/migration

    Muchun Song <songmuchun@bytedance.com>:
      mm: migrate: fix missing update page_private to hugetlb_page_subpool

Subsystem: mm/thp

    Collin Fijalkovich <cfijalkovich@google.com>:
      mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs

    Yang Shi <shy828301@gmail.com>:
      mm: memory: add orig_pmd to struct vm_fault
      mm: memory: make numa_migrate_prep() non-static
      mm: thp: refactor NUMA fault handling
      mm: migrate: account THP NUMA migration counters correctly
      mm: migrate: don't split THP for misplaced NUMA page
      mm: migrate: check mapcount for THP instead of refcount
      mm: thp: skip make PMD PROT_NONE if THP migration is not supported

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2

    Yang Shi <shy828301@gmail.com>:
      mm: rmap: make try_to_unmap() void function

    Hugh Dickins <hughd@google.com>:
      mm/thp: remap_page() is only needed on anonymous THP
      mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/thp: fix strncpy warning

Subsystem: mm/nommu

    Chen Li <chenli@uniontech.com>:
      nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc

    Liam Howlett <liam.howlett@oracle.com>:
      mm/nommu: unexport do_munmap()

Subsystem: mm/kconfig

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: generalize ZONE_[DMA|DMA32]

Subsystem: mm/madvise

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2:
      mm: make variable names for populate_vma_page_range() consistent
      mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables
      MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT
      selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore
      selftests/vm: add test for MADV_POPULATE_(READ|WRITE)

Subsystem: mm/memory-hotplug

    Liam Mark <lmark@codeaurora.org>:
      mm/memory_hotplug: rate limit page migration warnings

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: drop unneeded locking

Subsystem: mm/zswap

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for zswap":
      mm/zswap.c: remove unused function zswap_debugfs_exit()
      mm/zswap.c: avoid unnecessary copy-in at map time
      mm/zswap.c: fix two bugs in zswap_writeback_entry()

Subsystem: mm/zsmalloc

    Zhaoyang Huang <zhaoyang.huang@unisoc.com>:
      mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for zsmalloc":
      mm/zsmalloc.c: remove confusing code in obj_free()
      mm/zsmalloc.c: improve readability for async_free_zspage()

Subsystem: mm/zram

    Yue Hu <huyue2@yulong.com>:
      zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK

Subsystem: mm/cleanups

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm: fix typos and grammar error in comments

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: define default value for FIRST_USER_ADDRESS

    Zhen Lei <thunder.leizhen@huawei.com>:
      mm: fix spelling mistakes

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Clean W=1 build warnings for mm/":
      mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages
      mm/vmalloc: include header for prototype of set_iounmap_nonlazy
      mm/page_alloc: make should_fail_alloc_page() static
      mm/mapping_dirty_helpers: remove double Note in kerneldoc
      mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection
      mm/memory_hotplug: fix kerneldoc comment for __try_online_node
      mm/memory_hotplug: fix kerneldoc comment for __remove_memory
      mm/zbud: add kerneldoc fields for zbud_pool
      mm/z3fold: add kerneldoc fields for z3fold_pool
      mm/swap: make swap_address_space an inline function
      mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations
      mm/page_alloc: move prototype for find_suitable_fallback
      mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/thp: define default pmd_pgtable()

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: unconditionally use unbound work queue

Subsystem: mm/hmm

    Alistair Popple <apopple@nvidia.com>:
    Patch series "Add support for SVM atomics in Nouveau", v11:
      mm: remove special swap entry functions
      mm/swapops: rework swap entry manipulation code
      mm/rmap: split try_to_munlock from try_to_unmap
      mm/rmap: split migration into its own function
      mm: rename migrate_pgmap_owner
      mm/memory.c: allow different return codes for copy_nonpresent_pte()
      mm: device exclusive memory access
      mm: selftests for exclusive device memory
      nouveau/svm: refactor nouveau_range_fault
      nouveau/svm: implement atomic SVM access

Subsystem: procfs

    Marcelo Henrique Cerri <marcelo.cerri@canonical.com>:
      proc: Avoid mixing integer types in mem_rw()

    ZHOUFENG <zhoufeng.zf@bytedance.com>:
      fs/proc/kcore.c: add mmap interface

    Kalesh Singh <kaleshsingh@google.com>:
      procfs: allow reading fdinfo with PTRACE_MODE_READ
      procfs/dmabuf: add inode number to /proc/*/fdinfo

Subsystem: sysctl

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      sysctl: remove redundant assignment to first

Subsystem: misc

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      drm: include only needed headers in ascii85.h

Subsystem: core-kernel

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out panic and oops helpers

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib: decompress_bunzip2: remove an unneeded semicolon

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
    Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3:
      lib/string_helpers: switch to use BIT() macro
      lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop
      lib/string_helpers: drop indentation level in string_escape_mem()
      lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII
      lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable
      lib/string_helpers: allow to append additional characters to be escaped
      lib/test-string_helpers: print flags in hexadecimal format
      lib/test-string_helpers: get rid of trailing comma in terminators
      lib/test-string_helpers: add test cases for new features
      MAINTAINERS: add myself as designated reviewer for generic string library
      seq_file: introduce seq_escape_mem()
      seq_file: add seq_escape_str() as replica of string_escape_str()
      seq_file: convert seq_escape() to use seq_escape_str()
      nfsd: avoid non-flexible API in seq_quote_mem()
      seq_file: drop unused *_escape_mem_ascii()

    Trent Piepho <tpiepho@gmail.com>:
      lib/math/rational.c: fix divide by zero
      lib/math/rational: add Kunit test cases

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib/decompressors: fix spelling mistakes
      lib/mpi: fix spelling mistakes

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: memscan() fixlet
      lib: uninline simple_strtoull()

    Matteo Croce <mcroce@microsoft.com>:
      lib/test_string.c: allow module removal

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out kstrtox() and simple_strtox() to a separate header

Subsystem: lz4

    Rajat Asthana <thisisrast7@gmail.com>:
      lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static

    Dimitri John Ledkov <dimitri.ledkov@canonical.com>:
      lib/decompress_unlz4.c: correctly handle zero-padding around initrds.

Subsystem: checkpatch

    Guenter Roeck <linux@roeck-us.net>:
      checkpatch: scripts/spdxcheck.py now requires python3

    Joe Perches <joe@perches.com>:
      checkpatch: improve the indented label test

    Guenter Roeck <linux@roeck-us.net>:
      checkpatch: do not complain about positive return values starting with EPOLL

Subsystem: init

    Andrew Halaney <ahalaney@redhat.com>:
      init: print out unknown kernel parameters

Subsystem: kprobes

    Barry Song <song.bao.hua@hisilicon.com>:
      kprobes: remove duplicated strong free_insn_page in x86 and s390

Subsystem: nilfs2

    Colin Ian King <colin.king@canonical.com>:
      nilfs2: remove redundant continue statement in a while-loop

Subsystem: hfs

    Zhen Lei <thunder.leizhen@huawei.com>:
      hfsplus: remove unnecessary oom message

    Chung-Chiang Cheng <shepjeng@gmail.com>:
      hfsplus: report create_date to kstat.btime

Subsystem: signals

    Al Viro <viro@zeniv.linux.org.uk>:
      x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned

Subsystem: exec

    Alexey Dobriyan <adobriyan@gmail.com>:
      exec: remove checks in __register_bimfmt()

Subsystem: kcov

    Marco Elver <elver@google.com>:
      kcov: add __no_sanitize_coverage to fix noinstr for all architectures

Subsystem: selftests

    Dave Hansen <dave.hansen@linux.intel.com>:
    Patch series "selftests/vm/pkeys: Bug fixes and a new test":
      selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random
      selftests/vm/pkeys: handle negative sys_pkey_alloc() return code
      selftests/vm/pkeys: refill shadow register after implicit kernel write
      selftests/vm/pkeys: exercise x86 XSAVE init state

Subsystem: compress/decompress

    Yu Kuai <yukuai3@huawei.com>:
      lib/decompressors: remove set but not used variabled 'level'

Subsystem: ipc

    Vasily Averin <vvs@virtuozzo.com>:
    Patch series "ipc: allocations cleanup", v2:
      ipc sem: use kvmalloc for sem_undo allocation
      ipc: use kmalloc for msg_queue and shmid_kernel

    Manfred Spraul <manfred@colorfullife.com>:
      ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock
      ipc/util.c: use binary search for max_idx

 Documentation/admin-guide/kernel-parameters.txt    |   35 
 Documentation/admin-guide/mm/hugetlbpage.rst       |   11 
 Documentation/admin-guide/mm/memory-hotplug.rst    |   13 
 Documentation/admin-guide/mm/pagemap.rst           |    2 
 Documentation/admin-guide/mm/userfaultfd.rst       |    3 
 Documentation/core-api/kernel-api.rst              |    7 
 Documentation/filesystems/proc.rst                 |   48 
 Documentation/vm/hmm.rst                           |   19 
 Documentation/vm/unevictable-lru.rst               |   33 
 MAINTAINERS                                        |   10 
 arch/alpha/Kconfig                                 |    5 
 arch/alpha/include/asm/pgalloc.h                   |    1 
 arch/alpha/include/asm/pgtable.h                   |    1 
 arch/alpha/include/uapi/asm/mman.h                 |    3 
 arch/alpha/kernel/setup.c                          |    2 
 arch/arc/include/asm/pgalloc.h                     |    2 
 arch/arc/include/asm/pgtable.h                     |    8 
 arch/arm/Kconfig                                   |    3 
 arch/arm/include/asm/pgalloc.h                     |    1 
 arch/arm64/Kconfig                                 |   15 
 arch/arm64/include/asm/hugetlb.h                   |    3 
 arch/arm64/include/asm/memory.h                    |    2 
 arch/arm64/include/asm/page.h                      |    4 
 arch/arm64/include/asm/pgalloc.h                   |    1 
 arch/arm64/include/asm/pgtable.h                   |    2 
 arch/arm64/kernel/setup.c                          |    1 
 arch/arm64/kvm/mmu.c                               |    2 
 arch/arm64/mm/hugetlbpage.c                        |    5 
 arch/arm64/mm/init.c                               |   51 
 arch/arm64/mm/ioremap.c                            |    4 
 arch/arm64/mm/mmu.c                                |   22 
 arch/csky/include/asm/pgalloc.h                    |    2 
 arch/csky/include/asm/pgtable.h                    |    1 
 arch/hexagon/include/asm/pgtable.h                 |    4 
 arch/ia64/Kconfig                                  |    7 
 arch/ia64/include/asm/pal.h                        |    1 
 arch/ia64/include/asm/pgalloc.h                    |    1 
 arch/ia64/include/asm/pgtable.h                    |    1 
 arch/m68k/Kconfig                                  |    5 
 arch/m68k/include/asm/mcf_pgalloc.h                |    2 
 arch/m68k/include/asm/mcf_pgtable.h                |    2 
 arch/m68k/include/asm/motorola_pgalloc.h           |    1 
 arch/m68k/include/asm/motorola_pgtable.h           |    2 
 arch/m68k/include/asm/pgtable_mm.h                 |    1 
 arch/m68k/include/asm/sun3_pgalloc.h               |    1 
 arch/microblaze/Kconfig                            |    4 
 arch/microblaze/include/asm/pgalloc.h              |    2 
 arch/microblaze/include/asm/pgtable.h              |    2 
 arch/mips/Kconfig                                  |   10 
 arch/mips/include/asm/pgalloc.h                    |    1 
 arch/mips/include/asm/pgtable-32.h                 |    1 
 arch/mips/include/asm/pgtable-64.h                 |    1 
 arch/mips/include/uapi/asm/mman.h                  |    3 
 arch/mips/kernel/relocate.c                        |    1 
 arch/mips/sgi-ip22/ip22-reset.c                    |    1 
 arch/mips/sgi-ip32/ip32-reset.c                    |    1 
 arch/nds32/include/asm/pgalloc.h                   |    5 
 arch/nios2/include/asm/pgalloc.h                   |    1 
 arch/nios2/include/asm/pgtable.h                   |    2 
 arch/openrisc/include/asm/pgalloc.h                |    2 
 arch/openrisc/include/asm/pgtable.h                |    1 
 arch/parisc/include/asm/pgalloc.h                  |    1 
 arch/parisc/include/asm/pgtable.h                  |    2 
 arch/parisc/include/uapi/asm/mman.h                |    3 
 arch/parisc/kernel/pdc_chassis.c                   |    1 
 arch/powerpc/Kconfig                               |    6 
 arch/powerpc/include/asm/book3s/pgtable.h          |    1 
 arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h   |    5 
 arch/powerpc/include/asm/nohash/32/mmu-8xx.h       |   43 
 arch/powerpc/include/asm/nohash/32/pgtable.h       |    1 
 arch/powerpc/include/asm/nohash/64/pgtable.h       |    2 
 arch/powerpc/include/asm/pgalloc.h                 |    5 
 arch/powerpc/include/asm/pgtable.h                 |    6 
 arch/powerpc/kernel/setup-common.c                 |    1 
 arch/powerpc/platforms/Kconfig.cputype             |    1 
 arch/riscv/Kconfig                                 |    5 
 arch/riscv/include/asm/pgalloc.h                   |    2 
 arch/riscv/include/asm/pgtable.h                   |    2 
 arch/s390/Kconfig                                  |    6 
 arch/s390/include/asm/pgalloc.h                    |    3 
 arch/s390/include/asm/pgtable.h                    |    5 
 arch/s390/kernel/ipl.c                             |    1 
 arch/s390/kernel/kprobes.c                         |    5 
 arch/s390/mm/pgtable.c                             |    2 
 arch/sh/include/asm/pgalloc.h                      |    1 
 arch/sh/include/asm/pgtable.h                      |    2 
 arch/sparc/Kconfig                                 |    5 
 arch/sparc/include/asm/pgalloc_32.h                |    1 
 arch/sparc/include/asm/pgalloc_64.h                |    1 
 arch/sparc/include/asm/pgtable_32.h                |    3 
 arch/sparc/include/asm/pgtable_64.h                |    8 
 arch/sparc/kernel/sstate.c                         |    1 
 arch/sparc/mm/hugetlbpage.c                        |    6 
 arch/sparc/mm/init_64.c                            |    1 
 arch/um/drivers/mconsole_kern.c                    |    1 
 arch/um/include/asm/pgalloc.h                      |    1 
 arch/um/include/asm/pgtable-2level.h               |    1 
 arch/um/include/asm/pgtable-3level.h               |    1 
 arch/um/kernel/um_arch.c                           |    1 
 arch/x86/Kconfig                                   |   17 
 arch/x86/include/asm/desc.h                        |    1 
 arch/x86/include/asm/pgalloc.h                     |    2 
 arch/x86/include/asm/pgtable_types.h               |    2 
 arch/x86/kernel/cpu/mshyperv.c                     |    1 
 arch/x86/kernel/kprobes/core.c                     |    6 
 arch/x86/kernel/setup.c                            |    1 
 arch/x86/mm/init_64.c                              |   21 
 arch/x86/mm/pgtable.c                              |   34 
 arch/x86/purgatory/purgatory.c                     |    2 
 arch/x86/xen/enlighten.c                           |    1 
 arch/xtensa/include/asm/pgalloc.h                  |    2 
 arch/xtensa/include/asm/pgtable.h                  |    1 
 arch/xtensa/include/uapi/asm/mman.h                |    3 
 arch/xtensa/platforms/iss/setup.c                  |    1 
 drivers/block/zram/zram_drv.h                      |    2 
 drivers/bus/brcmstb_gisb.c                         |    1 
 drivers/char/ipmi/ipmi_msghandler.c                |    1 
 drivers/clk/analogbits/wrpll-cln28hpc.c            |    4 
 drivers/edac/altera_edac.c                         |    1 
 drivers/firmware/google/gsmi.c                     |    1 
 drivers/gpu/drm/nouveau/include/nvif/if000c.h      |    1 
 drivers/gpu/drm/nouveau/nouveau_svm.c              |  162 ++-
 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h      |    1 
 drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c |    6 
 drivers/hv/vmbus_drv.c                             |    1 
 drivers/hwtracing/coresight/coresight-cpu-debug.c  |    1 
 drivers/leds/trigger/ledtrig-activity.c            |    1 
 drivers/leds/trigger/ledtrig-heartbeat.c           |    1 
 drivers/leds/trigger/ledtrig-panic.c               |    1 
 drivers/misc/bcm-vk/bcm_vk_dev.c                   |    1 
 drivers/misc/ibmasm/heartbeat.c                    |    1 
 drivers/misc/pvpanic/pvpanic.c                     |    1 
 drivers/net/ipa/ipa_smp2p.c                        |    1 
 drivers/parisc/power.c                             |    1 
 drivers/power/reset/ltc2952-poweroff.c             |    1 
 drivers/remoteproc/remoteproc_core.c               |    1 
 drivers/s390/char/con3215.c                        |    1 
 drivers/s390/char/con3270.c                        |    1 
 drivers/s390/char/sclp.c                           |    1 
 drivers/s390/char/sclp_con.c                       |    1 
 drivers/s390/char/sclp_vt220.c                     |    1 
 drivers/s390/char/zcore.c                          |    1 
 drivers/soc/bcm/brcmstb/pm/pm-arm.c                |    1 
 drivers/staging/olpc_dcon/olpc_dcon.c              |    1 
 drivers/video/fbdev/hyperv_fb.c                    |    1 
 drivers/virtio/virtio_mem.c                        |    2 
 fs/Kconfig                                         |   15 
 fs/exec.c                                          |    3 
 fs/hfsplus/inode.c                                 |    5 
 fs/hfsplus/xattr.c                                 |    1 
 fs/nfsd/nfs4state.c                                |    2 
 fs/nilfs2/btree.c                                  |    1 
 fs/open.c                                          |   13 
 fs/proc/base.c                                     |    6 
 fs/proc/fd.c                                       |   20 
 fs/proc/kcore.c                                    |  136 ++
 fs/proc/task_mmu.c                                 |   34 
 fs/seq_file.c                                      |   43 
 fs/userfaultfd.c                                   |   15 
 include/asm-generic/bug.h                          |    3 
 include/linux/ascii85.h                            |    3 
 include/linux/bootmem_info.h                       |   68 +
 include/linux/compat.h                             |    2 
 include/linux/compiler-clang.h                     |   17 
 include/linux/compiler-gcc.h                       |    6 
 include/linux/compiler_types.h                     |    2 
 include/linux/huge_mm.h                            |   74 -
 include/linux/hugetlb.h                            |   80 +
 include/linux/hugetlb_cgroup.h                     |   19 
 include/linux/kcore.h                              |    3 
 include/linux/kernel.h                             |  227 ----
 include/linux/kprobes.h                            |    1 
 include/linux/kstrtox.h                            |  155 ++
 include/linux/memblock.h                           |    4 
 include/linux/memory_hotplug.h                     |   27 
 include/linux/mempolicy.h                          |    9 
 include/linux/memremap.h                           |    2 
 include/linux/migrate.h                            |   27 
 include/linux/mm.h                                 |   18 
 include/linux/mm_types.h                           |    2 
 include/linux/mmu_notifier.h                       |   26 
 include/linux/mmzone.h                             |   27 
 include/linux/mpi.h                                |    4 
 include/linux/page-flags.h                         |   22 
 include/linux/panic.h                              |   98 +
 include/linux/panic_notifier.h                     |   12 
 include/linux/pgtable.h                            |   44 
 include/linux/rmap.h                               |   13 
 include/linux/seq_file.h                           |   10 
 include/linux/shmem_fs.h                           |   19 
 include/linux/signal.h                             |    2 
 include/linux/string.h                             |    7 
 include/linux/string_helpers.h                     |   31 
 include/linux/sunrpc/cache.h                       |    1 
 include/linux/swap.h                               |   19 
 include/linux/swapops.h                            |  171 +--
 include/linux/thread_info.h                        |    1 
 include/linux/userfaultfd_k.h                      |    5 
 include/linux/vmalloc.h                            |   15 
 include/linux/zbud.h                               |   23 
 include/trace/events/vmscan.h                      |   41 
 include/uapi/asm-generic/mman-common.h             |    3 
 include/uapi/linux/mempolicy.h                     |    1 
 include/uapi/linux/userfaultfd.h                   |    7 
 init/main.c                                        |   42 
 ipc/msg.c                                          |    6 
 ipc/sem.c                                          |   25 
 ipc/shm.c                                          |    6 
 ipc/util.c                                         |   44 
 ipc/util.h                                         |    3 
 kernel/hung_task.c                                 |    1 
 kernel/kexec_core.c                                |    1 
 kernel/kprobes.c                                   |    2 
 kernel/panic.c                                     |    1 
 kernel/rcu/tree.c                                  |    2 
 kernel/signal.c                                    |   14 
 kernel/sysctl.c                                    |    4 
 kernel/trace/trace.c                               |    1 
 lib/Kconfig.debug                                  |   12 
 lib/decompress_bunzip2.c                           |    6 
 lib/decompress_unlz4.c                             |    8 
 lib/decompress_unlzo.c                             |    3 
 lib/decompress_unxz.c                              |    2 
 lib/decompress_unzstd.c                            |    4 
 lib/kstrtox.c                                      |    5 
 lib/lz4/lz4_decompress.c                           |    2 
 lib/math/Makefile                                  |    1 
 lib/math/rational-test.c                           |   56 +
 lib/math/rational.c                                |   16 
 lib/mpi/longlong.h                                 |    4 
 lib/mpi/mpicoder.c                                 |    6 
 lib/mpi/mpiutil.c                                  |    2 
 lib/parser.c                                       |    1 
 lib/string.c                                       |    2 
 lib/string_helpers.c                               |  142 +-
 lib/test-string_helpers.c                          |  157 ++-
 lib/test_hmm.c                                     |  127 ++
 lib/test_hmm_uapi.h                                |    2 
 lib/test_string.c                                  |    5 
 lib/vsprintf.c                                     |    1 
 lib/xz/xz_dec_bcj.c                                |    2 
 lib/xz/xz_dec_lzma2.c                              |    8 
 lib/zlib_inflate/inffast.c                         |    2 
 lib/zstd/huf.h                                     |    2 
 mm/Kconfig                                         |   16 
 mm/Makefile                                        |    2 
 mm/bootmem_info.c                                  |  127 ++
 mm/compaction.c                                    |   20 
 mm/debug_vm_pgtable.c                              |  109 --
 mm/gup.c                                           |   58 +
 mm/hmm.c                                           |   12 
 mm/huge_memory.c                                   |  269 ++---
 mm/hugetlb.c                                       |  369 +++++--
 mm/hugetlb_vmemmap.c                               |  332 ++++++
 mm/hugetlb_vmemmap.h                               |   53 -
 mm/internal.h                                      |   29 
 mm/kfence/core.c                                   |    4 
 mm/khugepaged.c                                    |   20 
 mm/madvise.c                                       |   66 +
 mm/mapping_dirty_helpers.c                         |    2 
 mm/memblock.c                                      |   28 
 mm/memcontrol.c                                    |    4 
 mm/memory-failure.c                                |   38 
 mm/memory.c                                        |  239 +++-
 mm/memory_hotplug.c                                |  161 ---
 mm/mempolicy.c                                     |  323 ++----
 mm/migrate.c                                       |  268 +----
 mm/mlock.c                                         |   12 
 mm/mmap_lock.c                                     |   59 -
 mm/mprotect.c                                      |   18 
 mm/nommu.c                                         |    5 
 mm/oom_kill.c                                      |    2 
 mm/page_alloc.c                                    |    5 
 mm/page_vma_mapped.c                               |   15 
 mm/rmap.c                                          |  644 +++++++++---
 mm/shmem.c                                         |  125 --
 mm/sparse-vmemmap.c                                |  432 +++++++-
 mm/sparse.c                                        |    1 
 mm/swap.c                                          |    2 
 mm/swapfile.c                                      |    2 
 mm/userfaultfd.c                                   |  249 ++--
 mm/util.c                                          |   40 
 mm/vmalloc.c                                       |   37 
 mm/vmscan.c                                        |   20 
 mm/workingset.c                                    |   10 
 mm/z3fold.c                                        |   39 
 mm/zbud.c                                          |  235 ++--
 mm/zsmalloc.c                                      |    5 
 mm/zswap.c                                         |   26 
 scripts/checkpatch.pl                              |   16 
 tools/testing/selftests/vm/.gitignore              |    3 
 tools/testing/selftests/vm/Makefile                |    5 
 tools/testing/selftests/vm/hmm-tests.c             |  158 +++
 tools/testing/selftests/vm/khugepaged.c            |    4 
 tools/testing/selftests/vm/madv_populate.c         |  342 ++++++
 tools/testing/selftests/vm/pkey-x86.h              |    1 
 tools/testing/selftests/vm/protection_keys.c       |   85 +
 tools/testing/selftests/vm/run_vmtests.sh          |   16 
 tools/testing/selftests/vm/userfaultfd.c           | 1094 ++++++++++-----------
 299 files changed, 6277 insertions(+), 3183 deletions(-)

incoming

[Andrew Morton]

192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2.

Subsystems affected by this patch series:

  mm/gup
  mm/pagealloc
  kthread
  ia64
  scripts
  ntfs
  squashfs
  ocfs2
  z
  kernel/watchdog
  mm/slab
  mm/slub
  mm/kmemleak
  mm/dax
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/bootmem
  mm/dma
  mm/tracing
  mm/vmalloc
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/memory-failure

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mm/gup: fix try_grab_compound_head() race with split_huge_page()

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc: fix memory map initialization for descending nodes

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: correct return value of populated elements if bulk array is populated

Subsystem: kthread

    Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
      kthread: switch to new kerneldoc syntax for named variable macro argument

    Petr Mladek <pmladek@suse.com>:
      kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: headers: drop duplicated words

    Arnd Bergmann <arnd@arndb.de>:
      ia64: mca_drv: fix incorrect array size calculation

Subsystem: scripts

    "Steven Rostedt (VMware)" <rostedt@goodmis.org>:
    Patch series "streamline_config.pl: Fix Perl spacing":
      streamline_config.pl: make spacing consistent
      streamline_config.pl: add softtabstop=4 for vim users

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
      ntfs: fix validity check for file name attribute

Subsystem: squashfs

    Vincent Whitchurch <vincent.whitchurch@axis.com>:
      squashfs: add option to panic on errors

Subsystem: ocfs2

    Yang Yingliang <yangyingliang@huawei.com>:
      ocfs2: remove unnecessary INIT_LIST_HEAD()

Subsystem: z

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: fix snprintf() checking

    Colin Ian King <colin.king@canonical.com>:
      ocfs2: remove redundant assignment to pointer queue

    Wan Jiabing <wanjiabing@vivo.com>:
      ocfs2: remove repeated uptodate check for buffer

    Chen Huang <chenhuang5@huawei.com>:
      ocfs2: replace simple_strtoull() with kstrtoull()

    Colin Ian King <colin.king@canonical.com>:
      ocfs2: remove redundant initialization of variable ret

Subsystem: kernel/watchdog

    Wang Qing <wangqing@vivo.com>:
      kernel: watchdog: modify the explanation related to watchdog thread
      doc: watchdog: modify the explanation related to watchdog thread
      doc: watchdog: modify the doc related to "watchdog/%u"

Subsystem: mm/slab

    gumingtao <gumingtao1225@gmail.com>:
      slab: use __func__ to trace function name

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      kunit: make test->lock irq safe

    Oliver Glitta <glittao@gmail.com>:
      mm/slub, kunit: add a KUnit test for SLUB debugging functionality
      slub: remove resiliency_test() function

    Hyeonggon Yoo <42.hyeyoo@gmail.com>:
      mm, slub: change run-time assertion in kmalloc_index() to compile-time

    Stephen Boyd <swboyd@chromium.org>:
      slub: restore slub_debug=- behavior
      slub: actually use 'message' in restore_bytes()

    Joe Perches <joe@perches.com>:
      slub: indicate slab_fix() uses printf formats

    Stephen Boyd <swboyd@chromium.org>:
      slub: force on no_hash_pointers when slub_debug is enabled

    Faiyaz Mohammed <faiyazm@codeaurora.org>:
      mm: slub: move sysfs slab alloc/free interfaces to debugfs

    Georgi Djakov <quic_c_gdjako@quicinc.com>:
      mm/slub: add taint after the errors are printed

Subsystem: mm/kmemleak

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/kmemleak: fix possible wrong memory scanning period

Subsystem: mm/dax

    Jan Kara <jack@suse.cz>:
      dax: fix ENOMEM handling in grab_mapping_entry()

Subsystem: mm/debug

    Tang Bin <tangbin@cmss.chinamobile.com>:
      tools/vm/page_owner_sort.c: check malloc() return

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage()

    Nicolas Saenz Julienne <nsaenzju@redhat.com>:
      mm: mmap_lock: use local locks instead of disabling preemption

    Gavin Shan <gshan@redhat.com>:
    Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4:
      mm/page_reporting: fix code style in __page_reporting_request()
      mm/page_reporting: export reporting order as module parameter
      mm/page_reporting: allow driver to specify reporting order
      virtio_balloon: specify page reporting order if needed

Subsystem: mm/pagecache

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: page-writeback: kill get_writeback_state() comments

    Chi Wu <wuchi.zero@gmail.com>:
      mm/page-writeback: Fix performance when BDI's share of ratio is 0.
      mm/page-writeback: update the comment of Dirty position control
      mm/page-writeback: use __this_cpu_inc() in account_page_dirtied()

    Roman Gushchin <guro@fb.com>:
    Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9:
      writeback, cgroup: do not switch inodes with I_WILL_FREE flag
      writeback, cgroup: add smp_mb() to cgroup_writeback_umount()
      writeback, cgroup: increment isw_nr_in_flight before grabbing an inode
      writeback, cgroup: switch to rcu_work API in inode_switch_wbs()
      writeback, cgroup: keep list of inodes attached to bdi_writeback
      writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn()
      writeback, cgroup: support switching multiple inodes at once
      writeback, cgroup: release dying cgwbs by switching attached inodes

    Christoph Hellwig <hch@lst.de>:
    Patch series "remove the implicit .set_page_dirty default":
      fs: unexport __set_page_dirty
      fs: move ramfs_aops to libfs
      mm: require ->set_page_dirty to be explicitly wired up

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Further set_page_dirty cleanups":
      mm/writeback: move __set_page_dirty() to core mm
      mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers
      iomap: use __set_page_dirty_nobuffers
      fs: remove anon_set_page_dirty()
      fs: remove noop_set_page_dirty()
      mm: move page dirtying prototypes from mm.h

Subsystem: mm/gup

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2:
      mm/gup_benchmark: support threading

    Andrea Arcangeli <aarcange@redhat.com>:
      mm: gup: allow FOLL_PIN to scale in SMP
      mm: gup: pack has_pinned in MMF_HAS_PINNED

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: pagewalk: fix walk for hugepage tables

Subsystem: mm/swap

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "close various race windows for swap", v6:
      mm/swapfile: use percpu_ref to serialize against concurrent swapoff
      swap: fix do_swap_page() race with swapoff
      mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info()
      mm/shmem: fix shmem_swapin() race with swapoff
    Patch series "Cleanups for swap", v2:
      mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION
      mm/swap: remove unused local variable nr_shadows
      mm/swap_slots.c: delete meaningless forward declarations

    Huang Ying <ying.huang@intel.com>:
      mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info()
      mm: free idle swap cache page after COW
      swap: check mapping_empty() for swap cache before being freed

Subsystem: mm/memcg

    Waiman Long <longman@redhat.com>:
    Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6:
      mm/memcg: move mod_objcg_state() to memcontrol.c
      mm/memcg: cache vmstat data in percpu memcg_stock_pcp
      mm/memcg: improve refill_obj_stock() performance
      mm/memcg: optimize user context object stock access
    Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4:
      mm: memcg/slab: properly set up gfp flags for objcg pointer array
      mm: memcg/slab: create a new set of kmalloc-cg-<n> caches
      mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix root_mem_cgroup charging
    Patch series "memcontrol code cleanup and simplification", v3:
      mm: memcontrol: fix page charging in page replacement
      mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm
      mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec
      mm: memcontrol: simplify lruvec_holds_page_lru_lock
      mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec
      mm: memcontrol: simplify the logic of objcg pinning memcg
      mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock
      mm: vmscan: remove noinline_for_stack

    wenhuizhang <wenhui@gwmail.gwu.edu>:
      memcontrol: use flexible-array member

    Dan Schatzberg <schatzberg.dan@gmail.com>:
    Patch series "Charge loop device i/o to issuing cgroup", v14:
      loop: use worker per cgroup instead of kworker
      mm: charge active memcg when no mm is set
      loop: charge i/o to mem and blk cg

    Huilong Deng <denghuilong@cdjrlc.com>:
      mm: memcontrol: remove trailing semicolon in macros

Subsystem: mm/pagemap

    David Hildenbrand <david@redhat.com>:
    Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE":
      perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC
      binfmt: remove in-tree usage of MAP_EXECUTABLE
      mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff()

    Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>:
      mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap: introduce unlock_range() for code cleanup
      mm/mmap: use find_vma_intersection() in do_mmap() for overlap

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm/memory.c: fix comment of finish_mkwrite_fault()

    Liam Howlett <liam.howlett@oracle.com>:
    Patch series "mm: Add vma_lookup()", v2:
      mm: add vma_lookup(), update find_vma_intersection() comments
      drm/i915/selftests: use vma_lookup() in __igt_mmap()
      arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma()
      arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection()
      arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection()
      arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma()
      arch/mips/kernel/traps: use vma_lookup() instead of find_vma()
      arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush()
      x86/sgx: use vma_lookup() in sgx_encl_find()
      virt/kvm: use vma_lookup() instead of find_vma_intersection()
      vfio: use vma_lookup() instead of find_vma_intersection()
      net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive()
      drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages()
      media: videobuf2: use vma_lookup() in get_vaddr_frames()
      misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma()
      kernel/events/uprobes: use vma_lookup() in find_active_uprobe()
      lib/test_hmm: use vma_lookup() in dmirror_migrate()
      mm/ksm: use vma_lookup() in find_mergeable_vma()
      mm/migrate: use vma_lookup() in do_pages_stat_array()
      mm/mremap: use vma_lookup() in vma_to_resize()
      mm/memory.c: use vma_lookup() in __access_remote_vm()
      mm/mempolicy: use vma_lookup() in __access_remote_vm()

    Chen Li <chenli@uniontech.com>:
      mm: update legacy flush_tlb_* to use vma

Subsystem: mm/mprotect

    Peter Collingbourne <pcc@google.com>:
      mm: improve mprotect(R|W) efficiency on pages referenced once

Subsystem: mm/bootmem

    Souptick Joarder <jrdr.linux@gmail.com>:
      h8300: remove unused variable

Subsystem: mm/dma

    YueHaibing <yuehaibing@huawei.com>:
      mm/dmapool: use DEVICE_ATTR_RO macro

Subsystem: mm/tracing

    Vincent Whitchurch <vincent.whitchurch@axis.com>:
      mm, tracing: unify PFN format strings

Subsystem: mm/vmalloc

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
    Patch series "vmalloc() vs bulk allocator", v2:
      mm/page_alloc: add an alloc_pages_bulk_array_node() helper
      mm/vmalloc: switch to bulk allocator in __vmalloc_area_node()
      mm/vmalloc: print a warning message first on failure
      mm/vmalloc: remove quoted strings split across lines

    Uladzislau Rezki <urezki@gmail.com>:
      mm/vmalloc: fallback to a single page allocator

    Rafael Aquini <aquini@redhat.com>:
      mm: vmalloc: add cond_resched() in __vunmap()

Subsystem: mm/kasan

    Alexander Potapenko <glider@google.com>:
      printk: introduce dump_stack_lvl()
      kasan: use dump_stack_lvl(KERN_ERR) to print stacks

    David Gow <davidgow@google.com>:
      kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL()

    Daniel Axtens <dja@axtens.net>:
    Patch series "KASAN core changes for ppc64 radix KASAN", v16:
      kasan: allow an architecture to disable inline instrumentation
      kasan: allow architectures to provide an outline readiness check
      mm: define default MAX_PTRS_PER_* in include/pgtable.h
      kasan: use MAX_PTRS_PER_* for early shadow tables

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
    Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4:
      kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY
      kasan: integrate the common part of two KASAN tag-based modes
      kasan: add memory corruption identification support for hardware tag-based mode

Subsystem: mm/initialization

    Jungseung Lee <js07.lee@samsung.com>:
      mm: report which part of mem is being freed on initmem case

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/mmzone.h: simplify is_highmem_idx()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Constify struct page arguments":
      mm: make __dump_page static

    Aaron Tomlin <atomlin@redhat.com>:
      mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug: factor PagePoisoned out of __dump_page
      mm/page_owner: constify dump_page_owner
      mm: make compound_head const-preserving
      mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype
      mm: constify page_count and page_ref_count
      mm: optimise nth_page for contiguous memmap

    Heiner Kallweit <hkallweit1@gmail.com>:
      mm/page_alloc: switch to pr_debug

    Andrii Nakryiko <andrii@kernel.org>:
      kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: split per cpu page lists and zone stats
      mm/page_alloc: convert per-cpu list protection to local_lock
      mm/vmstat: convert NUMA statistics to basic NUMA counters
      mm/vmstat: inline NUMA event counter updates
      mm/page_alloc: batch the accounting updates in the bulk allocator
      mm/page_alloc: reduce duration that IRQs are disabled for VM counters
      mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok
      mm/page_alloc: avoid conflating IRQs disabled with zone->lock
      mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok

    Minchan Kim <minchan@kernel.org>:
      mm: page_alloc: dump migrate-failed pages only at -EBUSY

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2:
      mm/page_alloc: delete vm.percpu_pagelist_fraction
      mm/page_alloc: disassociate the pcp->high from pcp->batch
      mm/page_alloc: adjust pcp->high after CPU hotplug events
      mm/page_alloc: scale the number of pages that are batch freed
      mm/page_alloc: limit the number of pages on PCP lists when reclaim is active
      mm/page_alloc: introduce vm.percpu_pagelist_high_fraction

    Dong Aisheng <aisheng.dong@nxp.com>:
      mm: drop SECTION_SHIFT in code comments
      mm/page_alloc: improve memmap_pages dbg msg

    Liu Shixin <liushixin2@huawei.com>:
      mm/page_alloc: fix counting of managed_pages

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Allow high order pages to be stored on PCP", v2:
      mm/page_alloc: move free_the_page

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "Remove DISCONTIGMEM memory model", v3:
      alpha: remove DISCONTIGMEM and NUMA
      arc: update comment about HIGHMEM implementation
      arc: remove support for DISCONTIGMEM
      m68k: remove support for DISCONTIGMEM
      mm: remove CONFIG_DISCONTIGMEM
      arch, mm: remove stale mentions of DISCONIGMEM
      docs: remove description of DISCONTIGMEM
      mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA
      mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: allow high-order pages to be stored on the per-cpu lists
      mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: send SIGBUS with error virutal address
      mm,hwpoison: make get_hwpoison_page() call get_any_page()

 Documentation/admin-guide/kernel-parameters.txt    |    6 
 Documentation/admin-guide/lockup-watchdogs.rst     |    4 
 Documentation/admin-guide/sysctl/kernel.rst        |   10 
 Documentation/admin-guide/sysctl/vm.rst            |   52 -
 Documentation/dev-tools/kasan.rst                  |    9 
 Documentation/vm/memory-model.rst                  |   45 
 arch/alpha/Kconfig                                 |   22 
 arch/alpha/include/asm/machvec.h                   |    6 
 arch/alpha/include/asm/mmzone.h                    |  100 --
 arch/alpha/include/asm/pgtable.h                   |    4 
 arch/alpha/include/asm/topology.h                  |   39 
 arch/alpha/kernel/core_marvel.c                    |   53 -
 arch/alpha/kernel/core_wildfire.c                  |   29 
 arch/alpha/kernel/pci_iommu.c                      |   29 
 arch/alpha/kernel/proto.h                          |    8 
 arch/alpha/kernel/setup.c                          |   16 
 arch/alpha/kernel/sys_marvel.c                     |    5 
 arch/alpha/kernel/sys_wildfire.c                   |    5 
 arch/alpha/mm/Makefile                             |    2 
 arch/alpha/mm/init.c                               |    3 
 arch/alpha/mm/numa.c                               |  223 ----
 arch/arc/Kconfig                                   |   13 
 arch/arc/include/asm/mmzone.h                      |   40 
 arch/arc/kernel/troubleshoot.c                     |    8 
 arch/arc/mm/init.c                                 |   21 
 arch/arm/include/asm/tlbflush.h                    |   13 
 arch/arm/mm/tlb-v6.S                               |    2 
 arch/arm/mm/tlb-v7.S                               |    2 
 arch/arm64/Kconfig                                 |    2 
 arch/arm64/kvm/mmu.c                               |    2 
 arch/h8300/kernel/setup.c                          |    2 
 arch/ia64/Kconfig                                  |    2 
 arch/ia64/include/asm/pal.h                        |    2 
 arch/ia64/include/asm/spinlock.h                   |    2 
 arch/ia64/include/asm/uv/uv_hub.h                  |    2 
 arch/ia64/kernel/efi_stub.S                        |    2 
 arch/ia64/kernel/mca_drv.c                         |    2 
 arch/ia64/kernel/topology.c                        |    5 
 arch/ia64/mm/numa.c                                |    5 
 arch/m68k/Kconfig.cpu                              |   10 
 arch/m68k/include/asm/mmzone.h                     |   10 
 arch/m68k/include/asm/page.h                       |    2 
 arch/m68k/include/asm/page_mm.h                    |   35 
 arch/m68k/include/asm/tlbflush.h                   |    2 
 arch/m68k/kernel/sys_m68k.c                        |    4 
 arch/m68k/mm/init.c                                |   20 
 arch/mips/Kconfig                                  |    2 
 arch/mips/include/asm/mmzone.h                     |    8 
 arch/mips/include/asm/page.h                       |    2 
 arch/mips/kernel/traps.c                           |    4 
 arch/mips/mm/init.c                                |    7 
 arch/nds32/include/asm/memory.h                    |    6 
 arch/openrisc/include/asm/tlbflush.h               |    2 
 arch/powerpc/Kconfig                               |    2 
 arch/powerpc/include/asm/mmzone.h                  |    4 
 arch/powerpc/kernel/setup_64.c                     |    2 
 arch/powerpc/kernel/smp.c                          |    2 
 arch/powerpc/kexec/core.c                          |    4 
 arch/powerpc/kvm/book3s_hv.c                       |    4 
 arch/powerpc/kvm/book3s_hv_uvmem.c                 |    2 
 arch/powerpc/mm/Makefile                           |    2 
 arch/powerpc/mm/mem.c                              |    4 
 arch/riscv/Kconfig                                 |    2 
 arch/s390/Kconfig                                  |    2 
 arch/s390/include/asm/pgtable.h                    |    2 
 arch/sh/include/asm/mmzone.h                       |    4 
 arch/sh/kernel/topology.c                          |    2 
 arch/sh/mm/Kconfig                                 |    2 
 arch/sh/mm/init.c                                  |    2 
 arch/sparc/Kconfig                                 |    2 
 arch/sparc/include/asm/mmzone.h                    |    4 
 arch/sparc/kernel/smp_64.c                         |    2 
 arch/sparc/mm/init_64.c                            |   12 
 arch/x86/Kconfig                                   |    2 
 arch/x86/ia32/ia32_aout.c                          |    4 
 arch/x86/kernel/cpu/mce/core.c                     |   13 
 arch/x86/kernel/cpu/sgx/encl.h                     |    4 
 arch/x86/kernel/setup_percpu.c                     |    6 
 arch/x86/mm/init_32.c                              |    4 
 arch/xtensa/include/asm/page.h                     |    4 
 arch/xtensa/include/asm/tlbflush.h                 |    4 
 drivers/base/node.c                                |   18 
 drivers/block/loop.c                               |  270 ++++-
 drivers/block/loop.h                               |   15 
 drivers/dax/device.c                               |    2 
 drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c            |    4 
 drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c |    2 
 drivers/media/common/videobuf2/frame_vector.c      |    2 
 drivers/misc/sgi-gru/grufault.c                    |    4 
 drivers/vfio/vfio_iommu_type1.c                    |    2 
 drivers/virtio/virtio_balloon.c                    |   17 
 fs/adfs/inode.c                                    |    1 
 fs/affs/file.c                                     |    2 
 fs/bfs/file.c                                      |    1 
 fs/binfmt_aout.c                                   |    4 
 fs/binfmt_elf.c                                    |    2 
 fs/binfmt_elf_fdpic.c                              |   11 
 fs/binfmt_flat.c                                   |    2 
 fs/block_dev.c                                     |    1 
 fs/buffer.c                                        |   25 
 fs/configfs/inode.c                                |    8 
 fs/dax.c                                           |    3 
 fs/ecryptfs/mmap.c                                 |   13 
 fs/exfat/inode.c                                   |    1 
 fs/ext2/inode.c                                    |    4 
 fs/ext4/inode.c                                    |    2 
 fs/fat/inode.c                                     |    1 
 fs/fs-writeback.c                                  |  366 +++++---
 fs/fuse/dax.c                                      |    3 
 fs/gfs2/aops.c                                     |    2 
 fs/gfs2/meta_io.c                                  |    2 
 fs/hfs/inode.c                                     |    2 
 fs/hfsplus/inode.c                                 |    2 
 fs/hpfs/file.c                                     |    1 
 fs/iomap/buffered-io.c                             |   27 
 fs/jfs/inode.c                                     |    1 
 fs/kernfs/inode.c                                  |    8 
 fs/libfs.c                                         |   44 
 fs/minix/inode.c                                   |    1 
 fs/nilfs2/mdt.c                                    |    1 
 fs/ntfs/inode.c                                    |    2 
 fs/ocfs2/aops.c                                    |    4 
 fs/ocfs2/cluster/heartbeat.c                       |    7 
 fs/ocfs2/cluster/nodemanager.c                     |    2 
 fs/ocfs2/dlm/dlmmaster.c                           |    2 
 fs/ocfs2/filecheck.c                               |    6 
 fs/ocfs2/stackglue.c                               |    8 
 fs/omfs/file.c                                     |    1 
 fs/proc/task_mmu.c                                 |    2 
 fs/ramfs/inode.c                                   |    9 
 fs/squashfs/block.c                                |    5 
 fs/squashfs/squashfs_fs_sb.h                       |    1 
 fs/squashfs/super.c                                |   86 +
 fs/sysv/itree.c                                    |    1 
 fs/udf/file.c                                      |    1 
 fs/udf/inode.c                                     |    1 
 fs/ufs/inode.c                                     |    1 
 fs/xfs/xfs_aops.c                                  |    4 
 fs/zonefs/super.c                                  |    4 
 include/asm-generic/memory_model.h                 |   37 
 include/asm-generic/pgtable-nop4d.h                |    1 
 include/asm-generic/topology.h                     |    2 
 include/kunit/test.h                               |    5 
 include/linux/backing-dev-defs.h                   |   20 
 include/linux/cpuhotplug.h                         |    2 
 include/linux/fs.h                                 |    6 
 include/linux/gfp.h                                |   13 
 include/linux/iomap.h                              |    1 
 include/linux/kasan.h                              |    7 
 include/linux/kernel.h                             |    2 
 include/linux/kthread.h                            |    2 
 include/linux/memblock.h                           |    6 
 include/linux/memcontrol.h                         |   60 -
 include/linux/mm.h                                 |   53 -
 include/linux/mm_types.h                           |   10 
 include/linux/mman.h                               |    2 
 include/linux/mmdebug.h                            |    3 
 include/linux/mmzone.h                             |   96 +-
 include/linux/page-flags.h                         |   10 
 include/linux/page_owner.h                         |    6 
 include/linux/page_ref.h                           |    4 
 include/linux/page_reporting.h                     |    3 
 include/linux/pageblock-flags.h                    |    2 
 include/linux/pagemap.h                            |    4 
 include/linux/pgtable.h                            |   22 
 include/linux/printk.h                             |    5 
 include/linux/sched/coredump.h                     |    8 
 include/linux/slab.h                               |   59 +
 include/linux/swap.h                               |   19 
 include/linux/swapops.h                            |    5 
 include/linux/vmstat.h                             |   69 -
 include/linux/writeback.h                          |    1 
 include/trace/events/cma.h                         |    4 
 include/trace/events/filemap.h                     |    2 
 include/trace/events/kmem.h                        |   12 
 include/trace/events/page_pool.h                   |    4 
 include/trace/events/pagemap.h                     |    4 
 include/trace/events/vmscan.h                      |    2 
 kernel/cgroup/cgroup.c                             |    1 
 kernel/crash_core.c                                |    4 
 kernel/events/core.c                               |    2 
 kernel/events/uprobes.c                            |    4 
 kernel/fork.c                                      |    1 
 kernel/kthread.c                                   |   19 
 kernel/sysctl.c                                    |   16 
 kernel/watchdog.c                                  |   12 
 lib/Kconfig.debug                                  |   15 
 lib/Kconfig.kasan                                  |   16 
 lib/Makefile                                       |    1 
 lib/dump_stack.c                                   |   20 
 lib/kunit/test.c                                   |   18 
 lib/slub_kunit.c                                   |  152 +++
 lib/test_hmm.c                                     |    5 
 lib/test_kasan.c                                   |   11 
 lib/vsprintf.c                                     |    2 
 mm/Kconfig                                         |   38 
 mm/backing-dev.c                                   |   66 +
 mm/compaction.c                                    |    2 
 mm/debug.c                                         |   27 
 mm/debug_vm_pgtable.c                              |   63 +
 mm/dmapool.c                                       |    5 
 mm/filemap.c                                       |    2 
 mm/gup.c                                           |   81 +
 mm/hugetlb.c                                       |    2 
 mm/internal.h                                      |    9 
 mm/kasan/Makefile                                  |    4 
 mm/kasan/common.c                                  |    6 
 mm/kasan/generic.c                                 |    3 
 mm/kasan/hw_tags.c                                 |   22 
 mm/kasan/init.c                                    |    6 
 mm/kasan/kasan.h                                   |   12 
 mm/kasan/report.c                                  |    6 
 mm/kasan/report_hw_tags.c                          |    5 
 mm/kasan/report_sw_tags.c                          |   45 
 mm/kasan/report_tags.c                             |   51 +
 mm/kasan/shadow.c                                  |    6 
 mm/kasan/sw_tags.c                                 |   45 
 mm/kasan/tags.c                                    |   59 +
 mm/kfence/kfence_test.c                            |    5 
 mm/kmemleak.c                                      |   18 
 mm/ksm.c                                           |    6 
 mm/memblock.c                                      |    8 
 mm/memcontrol.c                                    |  385 ++++++--
 mm/memory-failure.c                                |  344 +++++--
 mm/memory.c                                        |   22 
 mm/memory_hotplug.c                                |    6 
 mm/mempolicy.c                                     |    4 
 mm/migrate.c                                       |    4 
 mm/mmap.c                                          |   54 -
 mm/mmap_lock.c                                     |   33 
 mm/mprotect.c                                      |   52 +
 mm/mremap.c                                        |    5 
 mm/nommu.c                                         |    2 
 mm/page-writeback.c                                |   89 +
 mm/page_alloc.c                                    |  950 +++++++++++++--------
 mm/page_ext.c                                      |    2 
 mm/page_owner.c                                    |    2 
 mm/page_reporting.c                                |   19 
 mm/page_reporting.h                                |    5 
 mm/pagewalk.c                                      |   58 +
 mm/shmem.c                                         |   18 
 mm/slab.h                                          |   24 
 mm/slab_common.c                                   |   60 -
 mm/slub.c                                          |  420 +++++----
 mm/sparse.c                                        |    2 
 mm/swap.c                                          |    4 
 mm/swap_slots.c                                    |    2 
 mm/swap_state.c                                    |   20 
 mm/swapfile.c                                      |  177 +--
 mm/vmalloc.c                                       |  181 ++--
 mm/vmscan.c                                        |   43 
 mm/vmstat.c                                        |  282 ++----
 mm/workingset.c                                    |    2 
 net/ipv4/tcp.c                                     |    4 
 scripts/kconfig/streamline_config.pl               |   76 -
 scripts/link-vmlinux.sh                            |    4 
 scripts/spelling.txt                               |   16 
 tools/testing/selftests/vm/gup_test.c              |   96 +-
 tools/vm/page_owner_sort.c                         |    4 
 virt/kvm/kvm_main.c                                |    2 
 260 files changed, 3989 insertions(+), 2996 deletions(-)

incoming

[Andrew Morton]

24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6.

Subsystems affected by this patch series:

  mm/thp
  nilfs2
  mm/vmalloc
  kthread
  mm/hugetlb
  mm/memory-failure
  mm/pagealloc
  MAINTAINERS
  mailmap

Subsystem: mm/thp

    Hugh Dickins <hughd@google.com>:
    Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes":
      mm: page_vma_mapped_walk(): use page for pvmw->page
      mm: page_vma_mapped_walk(): settle PageHuge on entry
      mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd
      mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block
      mm: page_vma_mapped_walk(): crossing page table boundary
      mm: page_vma_mapped_walk(): add a level of indentation
      mm: page_vma_mapped_walk(): use goto instead of while (1)
      mm: page_vma_mapped_walk(): get vma_address_end() earlier
      mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes
      mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk()

Subsystem: nilfs2

    Pavel Skripkin <paskripkin@gmail.com>:
      nilfs2: fix memory leak in nilfs_sysfs_delete_device_group

Subsystem: mm/vmalloc

    Claudio Imbrenda <imbrenda@linux.ibm.com>:
    Patch series "mm: add vmalloc_no_huge and use it", v4:
      mm/vmalloc: add vmalloc_no_huge
      KVM: s390: prepare for hugepage vmalloc

    Daniel Axtens <dja@axtens.net>:
      mm/vmalloc: unbreak kasan vmalloc support

Subsystem: kthread

    Petr Mladek <pmladek@suse.com>:
    Patch series "kthread_worker: Fix race between kthread_mod_delayed_work():
      kthread_worker: split code for canceling the delayed work timer
      kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()

Subsystem: mm/hugetlb

    Hugh Dickins <hughd@google.com>:
      mm, futex: fix shared futex pgoff on shmem huge page

Subsystem: mm/memory-failure

    Tony Luck <tony.luck@intel.com>:
    Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5:
      mm/memory-failure: use a mutex to avoid memory_failure() races

    Aili Yao <yaoaili@kingsoft.com>:
      mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm/hwpoison: do not lock page again when me_huge_page() successfully recovers

Subsystem: mm/pagealloc

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array

    Mel Gorman <mgorman@techsingularity.net>:
      mm/page_alloc: do bulk array bounds check after checking populated elements

Subsystem: MAINTAINERS

    Marek Behún <kabel@kernel.org>:
      MAINTAINERS: fix Marek's identity again

Subsystem: mailmap

    Marek Behún <kabel@kernel.org>:
      mailmap: add Marek's other e-mail address and identity without diacritics

 .mailmap                |    2 
 MAINTAINERS             |    4 
 arch/s390/kvm/pv.c      |    7 +
 fs/nilfs2/sysfs.c       |    1 
 include/linux/hugetlb.h |   16 ---
 include/linux/pagemap.h |   13 +-
 include/linux/vmalloc.h |    1 
 kernel/futex.c          |    3 
 kernel/kthread.c        |   81 ++++++++++------
 mm/hugetlb.c            |    5 -
 mm/memory-failure.c     |   83 +++++++++++------
 mm/page_alloc.c         |    6 +
 mm/page_vma_mapped.c    |  233 +++++++++++++++++++++++++++---------------------
 mm/vmalloc.c            |   41 ++++++--
 14 files changed, 297 insertions(+), 199 deletions(-)

incoming

[Andrew Morton]

18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71.

Subsystems affected by this patch series:

  mm/memory-failure
  mm/swap
  mm/slub
  mm/hugetlb
  mm/memory-failure
  coredump
  mm/slub
  mm/thp
  mm/sparsemem

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: fix race with hugetlb page allocation

Subsystem: mm/swap

    Peter Xu <peterx@redhat.com>:
      mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare

Subsystem: mm/slub

    Kees Cook <keescook@chromium.org>:
    Patch series "Actually fix freelist pointer vs redzoning", v4:
      mm/slub: clarify verification reporting
      mm/slub: fix redzoning for small allocations
      mm/slub: actually fix freelist pointer vs redzoning

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: expand restore_reserve_on_error functionality

Subsystem: mm/memory-failure

    yangerkun <yangerkun@huawei.com>:
      mm/memory-failure: make sure wait for page writeback in memory_failure

Subsystem: coredump

    Pingfan Liu <kernelfans@gmail.com>:
      crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo

Subsystem: mm/slub

    Andrew Morton <akpm@linux-foundation.org>:
      mm/slub.c: include swab.h

Subsystem: mm/thp

    Xu Yu <xuyu@linux.alibaba.com>:
      mm, thp: use head page in __migration_entry_wait()

    Hugh Dickins <hughd@google.com>:
    Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10:
      mm/thp: fix __split_huge_pmd_locked() on shmem migration entry
      mm/thp: make is_huge_zero_pmd() safe and quicker
      mm/thp: try_to_unmap() use TTU_SYNC for safe splitting
      mm/thp: fix vma_address() if virtual address below file offset

    Jue Wang <juew@google.com>:
      mm/thp: fix page_address_in_vma() on file THP tails

    Hugh Dickins <hughd@google.com>:
      mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page()

    Yang Shi <shy828301@gmail.com>:
      mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split

Subsystem: mm/sparsemem

    Miles Chen <miles.chen@mediatek.com>:
      mm/sparse: fix check_usemap_section_nr warnings

 Documentation/vm/slub.rst |   10 +--
 fs/hugetlbfs/inode.c      |    1 
 include/linux/huge_mm.h   |    8 ++
 include/linux/hugetlb.h   |    8 ++
 include/linux/mm.h        |    3 +
 include/linux/rmap.h      |    1 
 include/linux/swapops.h   |   15 +++--
 kernel/crash_core.c       |    1 
 mm/huge_memory.c          |   58 ++++++++++---------
 mm/hugetlb.c              |  137 +++++++++++++++++++++++++++++++++++++---------
 mm/internal.h             |   51 ++++++++++++-----
 mm/memory-failure.c       |   36 +++++++++++-
 mm/memory.c               |   41 +++++++++++++
 mm/migrate.c              |    1 
 mm/page_vma_mapped.c      |   27 +++++----
 mm/pgtable-generic.c      |    5 -
 mm/rmap.c                 |   41 +++++++++----
 mm/slab_common.c          |    3 -
 mm/slub.c                 |   37 +++++-------
 mm/sparse.c               |   13 +++-
 mm/swapfile.c             |    2 
 mm/truncate.c             |   43 ++++++--------
 22 files changed, 388 insertions(+), 154 deletions(-)

incoming

[Andrew Morton]

13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c.

Subsystems affected by this patch series:

  mips
  mm/kfence
  init
  mm/debug
  mm/pagealloc
  mm/memory-hotplug
  mm/hugetlb
  proc
  mm/kasan
  mm/hugetlb
  lib
  ocfs2
  mailmap

Subsystem: mips

    Thomas Bogendoerfer <tsbogend@alpha.franken.de>:
      Revert "MIPS: make userspace mapping young by default"

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: use TASK_IDLE when awaiting allocation

Subsystem: init

    Mark Rutland <mark.rutland@arm.com>:
      pid: take a reference when initializing `cad_pid`

Subsystem: mm/debug

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests()

Subsystem: mm/pagealloc

    Ding Hui <dinghui@sangfor.com.cn>:
      mm/page_alloc: fix counting of free pages after take off from buddy

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64

Subsystem: mm/hugetlb

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      hugetlb: pass head page to remove_hugetlb_page()

Subsystem: proc

    David Matlack <dmatlack@google.com>:
      proc: add .gitignore for proc-subset-pid selftest

Subsystem: mm/kasan

    Yu Kuai <yukuai3@huawei.com>:
      mm/kasan/init.c: fix doc warning

Subsystem: mm/hugetlb

    Mina Almasry <almasrymina@google.com>:
      mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY

Subsystem: lib

    YueHaibing <yuehaibing@huawei.com>:
      lib: crc64: fix kernel-doc warning

Subsystem: ocfs2

    Junxiao Bi <junxiao.bi@oracle.com>:
      ocfs2: fix data corruption by fallocate

Subsystem: mailmap

    Michel Lespinasse <michel@lespinasse.org>:
      mailmap: use private address for Michel Lespinasse

 .mailmap                                |    3 +
 arch/mips/mm/cache.c                    |   30 ++++++++---------
 drivers/base/memory.c                   |    6 +--
 fs/ocfs2/file.c                         |   55 +++++++++++++++++++++++++++++---
 include/linux/pgtable.h                 |    8 ++++
 init/main.c                             |    2 -
 lib/crc64.c                             |    2 -
 mm/debug_vm_pgtable.c                   |    4 +-
 mm/hugetlb.c                            |   16 +++++++--
 mm/kasan/init.c                         |    4 +-
 mm/kfence/core.c                        |    6 +--
 mm/memory.c                             |    4 ++
 mm/page_alloc.c                         |    2 +
 tools/testing/selftests/proc/.gitignore |    1 
 14 files changed, 107 insertions(+), 36 deletions(-)

incoming

[Andrew Morton]

10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c.

Subsystems affected by this patch series:

  mm/pagealloc
  mm/gup
  ipc
  selftests
  mm/kasan
  kernel/watchdog
  bitmap
  procfs
  lib
  mm/userfaultfd

Subsystem: mm/pagealloc

    Arnd Bergmann <arnd@arndb.de>:
      mm/shuffle: fix section mismatch warning

Subsystem: mm/gup

    Michal Hocko <mhocko@suse.com>:
      Revert "mm/gup: check page posion status for coredump."

Subsystem: ipc

    Varad Gautam <varad.gautam@suse.com>:
      ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry

Subsystem: selftests

    Yang Yingliang <yangyingliang@huawei.com>:
      tools/testing/selftests/exec: fix link error

Subsystem: mm/kasan

    Alexander Potapenko <glider@google.com>:
      kasan: slab: always reset the tag in get_freepointer_safe()

Subsystem: kernel/watchdog

    Petr Mladek <pmladek@suse.com>:
      watchdog: reliable handling of timestamps

Subsystem: bitmap

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      linux/bits.h: fix compilation error with GENMASK

Subsystem: procfs

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: remove Alexey from MAINTAINERS

Subsystem: lib

    Zhen Lei <thunder.leizhen@huawei.com>:
      lib: kunit: suppress a compilation warning of frame size

Subsystem: mm/userfaultfd

    Mike Kravetz <mike.kravetz@oracle.com>:
      userfaultfd: hugetlbfs: fix new flag usage in error path

 MAINTAINERS                           |    1 -
 fs/hugetlbfs/inode.c                  |    2 +-
 include/linux/bits.h                  |    2 +-
 include/linux/const.h                 |    8 ++++++++
 include/linux/minmax.h                |   10 ++--------
 ipc/mqueue.c                          |    6 ++++--
 ipc/msg.c                             |    6 ++++--
 ipc/sem.c                             |    6 ++++--
 kernel/watchdog.c                     |   34 ++++++++++++++++++++--------------
 lib/Makefile                          |    1 +
 mm/gup.c                              |    4 ----
 mm/internal.h                         |   20 --------------------
 mm/shuffle.h                          |    4 ++--
 mm/slub.c                             |    1 +
 mm/userfaultfd.c                      |   28 ++++++++++++++--------------
 tools/include/linux/bits.h            |    2 +-
 tools/include/linux/const.h           |    8 ++++++++
 tools/testing/selftests/exec/Makefile |    6 +++---
 18 files changed, 74 insertions(+), 75 deletions(-)

incoming

[Andrew Morton]

13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/slub
  resource
  squashfs
  mm/userfaultfd
  mm/ksm
  mm/pagealloc
  mm/kasan
  mm/pagemap
  hfsplus
  modprobe
  mm/ioremap

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2:
      mm/hugetlb: fix F_SEAL_FUTURE_WRITE
      mm/hugetlb: fix cow where page writtable in child

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: move slub_debug static key enabling outside slab_mutex

Subsystem: resource

    Alistair Popple <apopple@nvidia.com>:
      kernel/resource: fix return code check in __request_free_mem_region

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix divide error in calculate_skip()

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: release page in error path to avoid BUG_ON

Subsystem: mm/ksm

    Hugh Dickins <hughd@google.com>:
      ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()"

Subsystem: mm/pagealloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix struct page layout on 32-bit systems

Subsystem: mm/kasan

    Peter Collingbourne <pcc@google.com>:
      kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled

Subsystem: mm/pagemap

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap: fix readahead return types

Subsystem: hfsplus

    Jouni Roivas <jouni.roivas@tuxera.com>:
      hfsplus: prevent corruption in shrinking truncate

Subsystem: modprobe

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      docs: admin-guide: update description for kernel.modprobe sysctl

Subsystem: mm/ioremap

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm/ioremap: fix iomap_max_page_shift

 Documentation/admin-guide/sysctl/kernel.rst |    9 ++++---
 fs/hfsplus/extents.c                        |    7 +++--
 fs/hugetlbfs/inode.c                        |    5 ++++
 fs/iomap/buffered-io.c                      |    4 +--
 fs/squashfs/file.c                          |    6 ++--
 include/linux/mm.h                          |   32 ++++++++++++++++++++++++++
 include/linux/mm_types.h                    |    4 +--
 include/linux/pagemap.h                     |    6 ++--
 include/net/page_pool.h                     |   12 +++++++++
 kernel/resource.c                           |    2 -
 lib/test_kasan.c                            |   29 ++++++++++++++++++-----
 mm/hugetlb.c                                |    1 
 mm/ioremap.c                                |    6 ++--
 mm/ksm.c                                    |    3 +-
 mm/shmem.c                                  |   34 ++++++++++++----------------
 mm/slab_common.c                            |   10 ++++++++
 mm/slub.c                                   |    9 -------
 net/core/page_pool.c                        |   12 +++++----
 18 files changed, 129 insertions(+), 62 deletions(-)

Re: incoming

[Linus Torvalds]

On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> I've been wobbly about the secretmem patches due to doubts about
> whether the feature is sufficiently useful to justify inclusion, but
> developers are now weighing in with helpful information and I've asked Mike
> for an extensively updated [0/n] changelog.  This will take a few days
> to play out so it is possible that I will prevail upon you for a post-rc1
> merge.

Oh, much too late for this release by now.

> If that's a problem, there's always 5.13-rc1.

5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time -
and version numbers - fly.

             Linus

incoming

[Andrew Morton]

This is everything else from -mm for this merge window, with the
possible exception of Mike Rapoport's "secretmem" syscall patch series
(https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org).

I've been wobbly about the secretmem patches due to doubts about
whether the feature is sufficiently useful to justify inclusion, but
developers are now weighing in with helpful information and I've asked Mike
for an extensively updated [0/n] changelog.  This will take a few days
to play out so it is possible that I will prevail upon you for a post-rc1
merge.  If that's a problem, there's always 5.13-rc1.

91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Thanks.



Subsystems affected by this patch series:

  alpha
  procfs
  sysctl
  misc
  core-kernel
  bitmap
  lib
  compat
  checkpatch
  epoll
  isofs
  nilfs2
  hpfs
  exit
  fork
  kexec
  gcov
  panic
  delayacct
  gdb
  resource
  selftests
  async
  initramfs
  ipc
  mm/cleanups
  drivers/char
  mm/slub
  spelling

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: eliminate old-style function definitions
      alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h>

Subsystem: procfs

    Colin Ian King <colin.king@canonical.com>:
      fs/proc/generic.c: fix incorrect pde_is_permanent check

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: save LOC in __xlate_proc_name()
      proc: mandate ->proc_lseek in "struct proc_ops"
      proc: delete redundant subset=pid check
      selftests: proc: test subset=pid

Subsystem: sysctl

    zhouchuangao <zhouchuangao@vivo.com>:
      proc/sysctl: fix function name error in comments

Subsystem: misc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include: remove pagemap.h from blkdev.h

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: drop inclusion in bitmap.h

    Wan Jiabing <wanjiabing@vivo.com>:
      linux/profile.h: remove unnecessary declaration

Subsystem: core-kernel

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      kernel/async.c: fix pr_debug statement
      kernel/cred.c: make init_groups static

Subsystem: bitmap

    Yury Norov <yury.norov@gmail.com>:
    Patch series "lib/find_bit: fast path for small bitmaps", v6:
      tools: disable -Wno-type-limits
      tools: bitmap: sync function declarations with the kernel
      tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel
      arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300
      lib: extend the scope of small_const_nbits() macro
      tools: sync small_const_nbits() macro with the kernel
      lib: inline _find_next_bit() wrappers
      tools: sync find_next_bit implementation
      lib: add fast path for find_next_*_bit()
      lib: add fast path for find_first_*_bit() and find_last_bit()
      tools: sync lib/find_bit implementation
      MAINTAINERS: add entry for the bitmap API

Subsystem: lib

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      lib/bch.c: fix a typo in the file bch.c

    Wang Qing <wangqing@vivo.com>:
      lib: fix inconsistent indenting in process_bit1()

    ToastC <mrtoastcheng@gmail.com>:
      lib/list_sort.c: fix typo in function description

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      lib/genalloc.c: Fix a typo

    Richard Fitzgerald <rf@opensource.cirrus.com>:
      lib: crc8: pointer to data block should be const

    Zqiang <qiang.zhang@windriver.com>:
      lib: stackdepot: turn depot_lock spinlock to raw_spinlock

    Alex Shi <alexs@kernel.org>:
      lib/percpu_counter: tame kernel-doc compile warning
      lib/genalloc: add parameter description to fix doc compile warning

    Randy Dunlap <rdunlap@infradead.org>:
      lib: parser: clean up kernel-doc

Subsystem: compat

    Masahiro Yamada <masahiroy@kernel.org>:
      include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx()

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: warn when missing newline in return sysfs_emit() formats

    Vincent Mailhol <mailhol.vincent@wanadoo.fr>:
      checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      checkpatch: improve ALLOC_ARRAY_ARGS test

Subsystem: epoll

    Davidlohr Bueso <dave@stgolabs.net>:
    Patch series "fs/epoll: restore user-visible behavior upon event ready":
      kselftest: introduce new epoll test case
      fs/epoll: restore waking from ep_done_scan()

Subsystem: isofs

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      isofs: fix fall-through warnings for Clang

Subsystem: nilfs2

    Liu xuzhi <liu.xuzhi@zte.com.cn>:
      fs/nilfs2: fix misspellings using codespell tool

    Lu Jialin <lujialin4@huawei.com>:
      nilfs2: fix typos in comments

Subsystem: hpfs

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      hpfs: replace one-element array with flexible-array member

Subsystem: exit

    Jim Newsome <jnewsome@torproject.org>:
      do_wait: make PIDTYPE_PID case O(1) instead of O(n)

Subsystem: fork

    Rolf Eike Beer <eb@emlix.com>:
      kernel/fork.c: simplify copy_mm()

    Xiaofeng Cao <cxfcosmos@gmail.com>:
      kernel/fork.c: fix typos

Subsystem: kexec

    Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>:
      kernel/crash_core: add crashkernel=auto for vmcore creation

    Joe LeVeque <jolevequ@microsoft.com>:
      kexec: Add kexec reboot string

    Jia-Ju Bai <baijiaju1990@gmail.com>:
      kernel: kexec_file: fix error return code of kexec_calculate_store_digests()

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      kexec: dump kmessage before machine_kexec

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      gcov: combine common code
      gcov: simplify buffer allocation
      gcov: use kvmalloc()

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: clang: drop support for clang-10 and older

Subsystem: panic

    He Ying <heying24@huawei.com>:
      smp: kernel/panic.c - silence warnings

Subsystem: delayacct

    Yafang Shao <laoar.shao@gmail.com>:
      delayacct: clear right task's flag after blkio completes

Subsystem: gdb

    Johannes Berg <johannes.berg@intel.com>:
      gdb: lx-symbols: store the abspath()

    Barry Song <song.bao.hua@hisilicon.com>:
    Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2:
      scripts/gdb: document lx_current is only supported by x86
      scripts/gdb: add lx_current support for arm64

Subsystem: resource

    David Hildenbrand <david@redhat.com>:
    Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2:
      kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources
      kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources
      kernel/resource: remove first_lvl / siblings_only logic

    Alistair Popple <apopple@nvidia.com>:
      kernel/resource: allow region_intersects users to hold resource_lock
      kernel/resource: refactor __request_region to allow external locking
      kernel/resource: fix locking in request_free_mem_region

Subsystem: selftests

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      selftests: remove duplicate include

Subsystem: async

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
      kernel/async.c: stop guarding pr_debug() statements
      kernel/async.c: remove async_unregister_domain()

Subsystem: initramfs

    Rasmus Villemoes <linux@rasmusvillemoes.dk>:
    Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3:
      init/initramfs.c: do unpacking asynchronously
      modules: add CONFIG_MODPROBE_PATH

Subsystem: ipc

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ipc/sem.c: mundane typo fixes

Subsystem: mm/cleanups

    Shijie Luo <luoshijie1@huawei.com>:
      mm: fix some typos and code style problems

Subsystem: drivers/char

    David Hildenbrand <david@redhat.com>:
    Patch series "drivers/char: remove /dev/kmem for good":
      drivers/char: remove /dev/kmem for good
      mm: remove xlate_dev_kmem_ptr()
      mm/vmalloc: remove vwrite()

Subsystem: mm/slub

    Maninder Singh <maninder1.s@samsung.com>:
      arm: print alloc free paths for address in registers

Subsystem: spelling

    Drew Fustini <drew@beagleboard.org>:
      scripts/spelling.txt: add "overlfow"

    zuoqilin <zuoqilin@yulong.com>:
      scripts/spelling.txt: Add "diabled" typo

    Drew Fustini <drew@beagleboard.org>:
      scripts/spelling.txt: add "overflw"

    Colin Ian King <colin.king@canonical.com>:
      mm/slab.c: fix spelling mistake "disired" -> "desired"

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      include/linux/pgtable.h: few spelling fixes

    zhouchuangao <zhouchuangao@vivo.com>:
      kernel/umh.c: fix some spelling mistakes

    Xiaofeng Cao <cxfcosmos@gmail.com>:
      kernel/user_namespace.c: fix typos

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      kernel/up.c: fix typo

    Xiaofeng Cao <caoxiaofeng@yulong.com>:
      kernel/sys.c: fix typo

    dingsenjie <dingsenjie@yulong.com>:
      fs: fat: fix spelling typo of values

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ipc/sem.c: spelling fix

    Masahiro Yamada <masahiroy@kernel.org>:
      treewide: remove editor modelines and cruft

    Ingo Molnar <mingo@kernel.org>:
      mm: fix typos in comments

    Lu Jialin <lujialin4@huawei.com>:
      mm: fix typos in comments

 Documentation/admin-guide/devices.txt                         |    2 
 Documentation/admin-guide/kdump/kdump.rst                     |    3 
 Documentation/admin-guide/kernel-parameters.txt               |   18 
 Documentation/dev-tools/gdb-kernel-debugging.rst              |    4 
 MAINTAINERS                                                   |   16 
 arch/Kconfig                                                  |   20 
 arch/alpha/include/asm/io.h                                   |    5 
 arch/alpha/kernel/pc873xx.c                                   |    4 
 arch/alpha/lib/csum_partial_copy.c                            |    1 
 arch/arm/configs/dove_defconfig                               |    1 
 arch/arm/configs/magician_defconfig                           |    1 
 arch/arm/configs/moxart_defconfig                             |    1 
 arch/arm/configs/mps2_defconfig                               |    1 
 arch/arm/configs/mvebu_v5_defconfig                           |    1 
 arch/arm/configs/xcep_defconfig                               |    1 
 arch/arm/include/asm/bug.h                                    |    1 
 arch/arm/include/asm/io.h                                     |    5 
 arch/arm/kernel/process.c                                     |   11 
 arch/arm/kernel/traps.c                                       |    1 
 arch/h8300/include/asm/bitops.h                               |    8 
 arch/hexagon/configs/comet_defconfig                          |    1 
 arch/hexagon/include/asm/io.h                                 |    1 
 arch/ia64/include/asm/io.h                                    |    1 
 arch/ia64/include/asm/uaccess.h                               |   18 
 arch/m68k/atari/time.c                                        |    7 
 arch/m68k/configs/amcore_defconfig                            |    1 
 arch/m68k/include/asm/bitops.h                                |    6 
 arch/m68k/include/asm/io_mm.h                                 |    5 
 arch/mips/include/asm/io.h                                    |    5 
 arch/openrisc/configs/or1ksim_defconfig                       |    1 
 arch/parisc/include/asm/io.h                                  |    5 
 arch/parisc/include/asm/pdc_chassis.h                         |    1 
 arch/powerpc/include/asm/io.h                                 |    5 
 arch/s390/include/asm/io.h                                    |    5 
 arch/sh/configs/edosk7705_defconfig                           |    1 
 arch/sh/configs/se7206_defconfig                              |    1 
 arch/sh/configs/sh2007_defconfig                              |    1 
 arch/sh/configs/sh7724_generic_defconfig                      |    1 
 arch/sh/configs/sh7770_generic_defconfig                      |    1 
 arch/sh/configs/sh7785lcr_32bit_defconfig                     |    1 
 arch/sh/include/asm/bitops.h                                  |    5 
 arch/sh/include/asm/io.h                                      |    5 
 arch/sparc/configs/sparc64_defconfig                          |    1 
 arch/sparc/include/asm/io_64.h                                |    5 
 arch/um/drivers/cow.h                                         |    7 
 arch/xtensa/configs/xip_kc705_defconfig                       |    1 
 block/blk-settings.c                                          |    1 
 drivers/auxdisplay/panel.c                                    |    7 
 drivers/base/firmware_loader/main.c                           |    2 
 drivers/block/brd.c                                           |    1 
 drivers/block/loop.c                                          |    1 
 drivers/char/Kconfig                                          |   10 
 drivers/char/mem.c                                            |  231 --------
 drivers/gpu/drm/qxl/qxl_drv.c                                 |    1 
 drivers/isdn/capi/kcapi_proc.c                                |    1 
 drivers/md/bcache/super.c                                     |    1 
 drivers/media/usb/pwc/pwc-uncompress.c                        |    3 
 drivers/net/ethernet/adaptec/starfire.c                       |    8 
 drivers/net/ethernet/amd/atarilance.c                         |    8 
 drivers/net/ethernet/amd/pcnet32.c                            |    7 
 drivers/net/wireless/intersil/hostap/hostap_proc.c            |    1 
 drivers/net/wireless/intersil/orinoco/orinoco_nortel.c        |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_pci.c           |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_plx.c           |    8 
 drivers/net/wireless/intersil/orinoco/orinoco_tmd.c           |    8 
 drivers/nvdimm/btt.c                                          |    1 
 drivers/nvdimm/pmem.c                                         |    1 
 drivers/parport/parport_ip32.c                                |   12 
 drivers/platform/x86/dell/dell_rbu.c                          |    3 
 drivers/scsi/53c700.c                                         |    1 
 drivers/scsi/53c700.h                                         |    1 
 drivers/scsi/ch.c                                             |    6 
 drivers/scsi/esas2r/esas2r_main.c                             |    1 
 drivers/scsi/ips.c                                            |   20 
 drivers/scsi/ips.h                                            |   20 
 drivers/scsi/lasi700.c                                        |    1 
 drivers/scsi/megaraid/mbox_defs.h                             |    2 
 drivers/scsi/megaraid/mega_common.h                           |    2 
 drivers/scsi/megaraid/megaraid_mbox.c                         |    2 
 drivers/scsi/megaraid/megaraid_mbox.h                         |    2 
 drivers/scsi/qla1280.c                                        |   12 
 drivers/scsi/scsicam.c                                        |    1 
 drivers/scsi/sni_53c710.c                                     |    1 
 drivers/video/fbdev/matrox/matroxfb_base.c                    |    9 
 drivers/video/fbdev/vga16fb.c                                 |   10 
 fs/configfs/configfs_internal.h                               |    4 
 fs/configfs/dir.c                                             |    4 
 fs/configfs/file.c                                            |    4 
 fs/configfs/inode.c                                           |    4 
 fs/configfs/item.c                                            |    4 
 fs/configfs/mount.c                                           |    4 
 fs/configfs/symlink.c                                         |    4 
 fs/eventpoll.c                                                |    6 
 fs/fat/fatent.c                                               |    2 
 fs/hpfs/hpfs.h                                                |    3 
 fs/isofs/rock.c                                               |    1 
 fs/nfs/dir.c                                                  |    7 
 fs/nfs/nfs4proc.c                                             |    6 
 fs/nfs/nfs4renewd.c                                           |    6 
 fs/nfs/nfs4state.c                                            |    6 
 fs/nfs/nfs4xdr.c                                              |    6 
 fs/nfsd/nfs4proc.c                                            |    6 
 fs/nfsd/nfs4xdr.c                                             |    6 
 fs/nfsd/xdr4.h                                                |    6 
 fs/nilfs2/cpfile.c                                            |    2 
 fs/nilfs2/ioctl.c                                             |    4 
 fs/nilfs2/segment.c                                           |    4 
 fs/nilfs2/the_nilfs.c                                         |    2 
 fs/ocfs2/acl.c                                                |    4 
 fs/ocfs2/acl.h                                                |    4 
 fs/ocfs2/alloc.c                                              |    4 
 fs/ocfs2/alloc.h                                              |    4 
 fs/ocfs2/aops.c                                               |    4 
 fs/ocfs2/aops.h                                               |    4 
 fs/ocfs2/blockcheck.c                                         |    4 
 fs/ocfs2/blockcheck.h                                         |    4 
 fs/ocfs2/buffer_head_io.c                                     |    4 
 fs/ocfs2/buffer_head_io.h                                     |    4 
 fs/ocfs2/cluster/heartbeat.c                                  |    4 
 fs/ocfs2/cluster/heartbeat.h                                  |    4 
 fs/ocfs2/cluster/masklog.c                                    |    4 
 fs/ocfs2/cluster/masklog.h                                    |    4 
 fs/ocfs2/cluster/netdebug.c                                   |    4 
 fs/ocfs2/cluster/nodemanager.c                                |    4 
 fs/ocfs2/cluster/nodemanager.h                                |    4 
 fs/ocfs2/cluster/ocfs2_heartbeat.h                            |    4 
 fs/ocfs2/cluster/ocfs2_nodemanager.h                          |    4 
 fs/ocfs2/cluster/quorum.c                                     |    4 
 fs/ocfs2/cluster/quorum.h                                     |    4 
 fs/ocfs2/cluster/sys.c                                        |    4 
 fs/ocfs2/cluster/sys.h                                        |    4 
 fs/ocfs2/cluster/tcp.c                                        |    4 
 fs/ocfs2/cluster/tcp.h                                        |    4 
 fs/ocfs2/cluster/tcp_internal.h                               |    4 
 fs/ocfs2/dcache.c                                             |    4 
 fs/ocfs2/dcache.h                                             |    4 
 fs/ocfs2/dir.c                                                |    4 
 fs/ocfs2/dir.h                                                |    4 
 fs/ocfs2/dlm/dlmapi.h                                         |    4 
 fs/ocfs2/dlm/dlmast.c                                         |    4 
 fs/ocfs2/dlm/dlmcommon.h                                      |    4 
 fs/ocfs2/dlm/dlmconvert.c                                     |    4 
 fs/ocfs2/dlm/dlmconvert.h                                     |    4 
 fs/ocfs2/dlm/dlmdebug.c                                       |    4 
 fs/ocfs2/dlm/dlmdebug.h                                       |    4 
 fs/ocfs2/dlm/dlmdomain.c                                      |    4 
 fs/ocfs2/dlm/dlmdomain.h                                      |    4 
 fs/ocfs2/dlm/dlmlock.c                                        |    4 
 fs/ocfs2/dlm/dlmmaster.c                                      |    4 
 fs/ocfs2/dlm/dlmrecovery.c                                    |    4 
 fs/ocfs2/dlm/dlmthread.c                                      |    4 
 fs/ocfs2/dlm/dlmunlock.c                                      |    4 
 fs/ocfs2/dlmfs/dlmfs.c                                        |    4 
 fs/ocfs2/dlmfs/userdlm.c                                      |    4 
 fs/ocfs2/dlmfs/userdlm.h                                      |    4 
 fs/ocfs2/dlmglue.c                                            |    4 
 fs/ocfs2/dlmglue.h                                            |    4 
 fs/ocfs2/export.c                                             |    4 
 fs/ocfs2/export.h                                             |    4 
 fs/ocfs2/extent_map.c                                         |    4 
 fs/ocfs2/extent_map.h                                         |    4 
 fs/ocfs2/file.c                                               |    4 
 fs/ocfs2/file.h                                               |    4 
 fs/ocfs2/filecheck.c                                          |    4 
 fs/ocfs2/filecheck.h                                          |    4 
 fs/ocfs2/heartbeat.c                                          |    4 
 fs/ocfs2/heartbeat.h                                          |    4 
 fs/ocfs2/inode.c                                              |    4 
 fs/ocfs2/inode.h                                              |    4 
 fs/ocfs2/journal.c                                            |    4 
 fs/ocfs2/journal.h                                            |    4 
 fs/ocfs2/localalloc.c                                         |    4 
 fs/ocfs2/localalloc.h                                         |    4 
 fs/ocfs2/locks.c                                              |    4 
 fs/ocfs2/locks.h                                              |    4 
 fs/ocfs2/mmap.c                                               |    4 
 fs/ocfs2/move_extents.c                                       |    4 
 fs/ocfs2/move_extents.h                                       |    4 
 fs/ocfs2/namei.c                                              |    4 
 fs/ocfs2/namei.h                                              |    4 
 fs/ocfs2/ocfs1_fs_compat.h                                    |    4 
 fs/ocfs2/ocfs2.h                                              |    4 
 fs/ocfs2/ocfs2_fs.h                                           |    4 
 fs/ocfs2/ocfs2_ioctl.h                                        |    4 
 fs/ocfs2/ocfs2_lockid.h                                       |    4 
 fs/ocfs2/ocfs2_lockingver.h                                   |    4 
 fs/ocfs2/refcounttree.c                                       |    4 
 fs/ocfs2/refcounttree.h                                       |    4 
 fs/ocfs2/reservations.c                                       |    4 
 fs/ocfs2/reservations.h                                       |    4 
 fs/ocfs2/resize.c                                             |    4 
 fs/ocfs2/resize.h                                             |    4 
 fs/ocfs2/slot_map.c                                           |    4 
 fs/ocfs2/slot_map.h                                           |    4 
 fs/ocfs2/stack_o2cb.c                                         |    4 
 fs/ocfs2/stack_user.c                                         |    4 
 fs/ocfs2/stackglue.c                                          |    4 
 fs/ocfs2/stackglue.h                                          |    4 
 fs/ocfs2/suballoc.c                                           |    4 
 fs/ocfs2/suballoc.h                                           |    4 
 fs/ocfs2/super.c                                              |    4 
 fs/ocfs2/super.h                                              |    4 
 fs/ocfs2/symlink.c                                            |    4 
 fs/ocfs2/symlink.h                                            |    4 
 fs/ocfs2/sysfile.c                                            |    4 
 fs/ocfs2/sysfile.h                                            |    4 
 fs/ocfs2/uptodate.c                                           |    4 
 fs/ocfs2/uptodate.h                                           |    4 
 fs/ocfs2/xattr.c                                              |    4 
 fs/ocfs2/xattr.h                                              |    4 
 fs/proc/generic.c                                             |   13 
 fs/proc/inode.c                                               |   18 
 fs/proc/proc_sysctl.c                                         |    2 
 fs/reiserfs/procfs.c                                          |   10 
 include/asm-generic/bitops/find.h                             |  108 +++
 include/asm-generic/bitops/le.h                               |   38 +
 include/asm-generic/bitsperlong.h                             |   12 
 include/asm-generic/io.h                                      |   11 
 include/linux/align.h                                         |   15 
 include/linux/async.h                                         |    1 
 include/linux/bitmap.h                                        |   11 
 include/linux/bitops.h                                        |   12 
 include/linux/blkdev.h                                        |    1 
 include/linux/compat.h                                        |    1 
 include/linux/configfs.h                                      |    4 
 include/linux/crc8.h                                          |    2 
 include/linux/cred.h                                          |    1 
 include/linux/delayacct.h                                     |   20 
 include/linux/fs.h                                            |    2 
 include/linux/genl_magic_func.h                               |    1 
 include/linux/genl_magic_struct.h                             |    1 
 include/linux/gfp.h                                           |    2 
 include/linux/init_task.h                                     |    1 
 include/linux/initrd.h                                        |    2 
 include/linux/kernel.h                                        |    9 
 include/linux/mm.h                                            |    2 
 include/linux/mmzone.h                                        |    2 
 include/linux/pgtable.h                                       |   10 
 include/linux/proc_fs.h                                       |    1 
 include/linux/profile.h                                       |    3 
 include/linux/smp.h                                           |    8 
 include/linux/swap.h                                          |    1 
 include/linux/vmalloc.h                                       |    7 
 include/uapi/linux/if_bonding.h                               |   11 
 include/uapi/linux/nfs4.h                                     |    6 
 include/xen/interface/elfnote.h                               |   10 
 include/xen/interface/hvm/hvm_vcpu.h                          |   10 
 include/xen/interface/io/xenbus.h                             |   10 
 init/Kconfig                                                  |   12 
 init/initramfs.c                                              |   38 +
 init/main.c                                                   |    1 
 ipc/sem.c                                                     |   12 
 kernel/async.c                                                |   68 --
 kernel/configs/android-base.config                            |    1 
 kernel/crash_core.c                                           |    7 
 kernel/cred.c                                                 |    2 
 kernel/exit.c                                                 |   67 ++
 kernel/fork.c                                                 |   23 
 kernel/gcov/Kconfig                                           |    1 
 kernel/gcov/base.c                                            |   49 +
 kernel/gcov/clang.c                                           |  282 ----------
 kernel/gcov/fs.c                                              |  146 ++++-
 kernel/gcov/gcc_4_7.c                                         |  173 ------
 kernel/gcov/gcov.h                                            |   14 
 kernel/kexec_core.c                                           |    4 
 kernel/kexec_file.c                                           |    4 
 kernel/kmod.c                                                 |    2 
 kernel/resource.c                                             |  198 ++++---
 kernel/sys.c                                                  |   14 
 kernel/umh.c                                                  |    8 
 kernel/up.c                                                   |    2 
 kernel/user_namespace.c                                       |    6 
 lib/bch.c                                                     |    2 
 lib/crc8.c                                                    |    2 
 lib/decompress_unlzma.c                                       |    2 
 lib/find_bit.c                                                |   68 --
 lib/genalloc.c                                                |    7 
 lib/list_sort.c                                               |    2 
 lib/parser.c                                                  |   61 +-
 lib/percpu_counter.c                                          |    2 
 lib/stackdepot.c                                              |    6 
 mm/balloon_compaction.c                                       |    4 
 mm/compaction.c                                               |    4 
 mm/filemap.c                                                  |    2 
 mm/gup.c                                                      |    2 
 mm/highmem.c                                                  |    2 
 mm/huge_memory.c                                              |    6 
 mm/hugetlb.c                                                  |    6 
 mm/internal.h                                                 |    2 
 mm/kasan/kasan.h                                              |    8 
 mm/kasan/quarantine.c                                         |    4 
 mm/kasan/shadow.c                                             |    4 
 mm/kfence/report.c                                            |    2 
 mm/khugepaged.c                                               |    2 
 mm/ksm.c                                                      |    6 
 mm/madvise.c                                                  |    4 
 mm/memcontrol.c                                               |   18 
 mm/memory-failure.c                                           |    2 
 mm/memory.c                                                   |   18 
 mm/mempolicy.c                                                |    6 
 mm/migrate.c                                                  |    8 
 mm/mmap.c                                                     |    4 
 mm/mprotect.c                                                 |    2 
 mm/mremap.c                                                   |    2 
 mm/nommu.c                                                    |   10 
 mm/oom_kill.c                                                 |    2 
 mm/page-writeback.c                                           |    4 
 mm/page_alloc.c                                               |   16 
 mm/page_owner.c                                               |    2 
 mm/page_vma_mapped.c                                          |    2 
 mm/percpu-internal.h                                          |    2 
 mm/percpu.c                                                   |    2 
 mm/pgalloc-track.h                                            |    6 
 mm/rmap.c                                                     |    2 
 mm/slab.c                                                     |    8 
 mm/slub.c                                                     |    2 
 mm/swap.c                                                     |    4 
 mm/swap_slots.c                                               |    2 
 mm/swap_state.c                                               |    2 
 mm/vmalloc.c                                                  |  124 ----
 mm/vmstat.c                                                   |    2 
 mm/z3fold.c                                                   |    2 
 mm/zpool.c                                                    |    2 
 mm/zsmalloc.c                                                 |    6 
 samples/configfs/configfs_sample.c                            |    2 
 scripts/checkpatch.pl                                         |   15 
 scripts/gdb/linux/cpus.py                                     |   23 
 scripts/gdb/linux/symbols.py                                  |    3 
 scripts/spelling.txt                                          |    3 
 tools/include/asm-generic/bitops/find.h                       |   85 ++-
 tools/include/asm-generic/bitsperlong.h                       |    3 
 tools/include/linux/bitmap.h                                  |   18 
 tools/lib/bitmap.c                                            |    4 
 tools/lib/find_bit.c                                          |   56 -
 tools/scripts/Makefile.include                                |    1 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   44 +
 tools/testing/selftests/kvm/lib/sparsebit.c                   |    1 
 tools/testing/selftests/mincore/mincore_selftest.c            |    1 
 tools/testing/selftests/powerpc/mm/tlbie_test.c               |    1 
 tools/testing/selftests/proc/Makefile                         |    1 
 tools/testing/selftests/proc/proc-subset-pid.c                |  121 ++++
 tools/testing/selftests/proc/read.c                           |    4 
 tools/usb/hcd-tests.sh                                        |    2 
 343 files changed, 1383 insertions(+), 2119 deletions(-)

Re: incoming

[Anshuman Khandual]

On 5/5/21 11:14 PM, Andrew Morton wrote:
> On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> 
>> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>>> Let me resend right now with the same in-reply-to.  Hopefully they will
>>> land in the correct place.
>> Well, you re-sent it twice, and I have three copies in my own mailbox,
>> bot they still don't show up on the mm-commits mailing list.
>>
>> So the list hates them for some odd reason.
>>
>> I've picked them up locally, but adding Konstantin to the participants
>> to see if he can see what's up.
>>
>> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
>> series of 143. Odd.
> It's weird.  They don't turn up on linux-mm either, and that's running
> at kvack.org, also majordomo.  They don't get through when sent with
> either heirloom-mailx or with sylpheed.
> 
> Also, it seems that when Anshuman originally sent the patch, linux-mm
> and linux-kernel didn't send it back out.  So perhaps a spam filter
> triggered?
> 
> I'm seeing
> 
> https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
> 
> which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
> server massacred that patch series.  Searching
> https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
> email series.

Yeah these patches faced problem from the very beginning getting
into the MM/LKML list for some strange reason.

Re: incoming

[Andrew Morton]

[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]

On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to.  Hopefully they will
> > land in the correct place.
> 
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
> 
> So the list hates them for some odd reason.
> 
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
> 
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.

It's weird.  They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo.  They don't get through when sent with
either heirloom-mailx or with sylpheed.

Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out.  So perhaps a spam filter
triggered?

I'm seeing

https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/

which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series.  Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.

One of the emails (as sent my me) is attached, if that helps.



[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]

Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
	USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
	by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
	for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
	by localhost.localdomain with IMAP (fetchmail-6.3.26)
	for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
	 by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
	 Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
  by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
	by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
    by mx6.messagingengine.com (Authentication Milter) with ESMTP
    id 14870833D7F;
    Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
    1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
    yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
    djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
    Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
    RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
    tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
    messagingengine.com; h=date:from:to:subject:message-id
    :in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
    uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
    gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
    Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
    YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
    zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
    7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
    smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
    header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
    header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
    policy.applied-disposition=none policy.evaluated-disposition=none
    (p=none,d=none,d.eval=none) policy.policy-from=p
    header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
    smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
    (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
    smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
    x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
    header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
    policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
    (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
    smtp.bits=256/256;
    x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
    arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
      smtp.remote-ip=209.85.215.198;
    bimi=skipped (DMARC did not pass);
    dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
      header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
      header.s=korg x-bits=1024;
    dmarc=none policy.published-domain-policy=none
      policy.applied-disposition=none policy.evaluated-disposition=none
      (p=none,d=none,d.eval=none) policy.policy-from=p
      header.from=linux-foundation.org;
    iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
    spf=pass smtp.mailfrom=akpm@linux-foundation.org
      smtp.helo=mail-pg1-f198.google.com;
    x-aligned-from=pass (Address match);
    x-arc-spf=pass
      (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
      smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
      x-arc-domain=google.com (Trusted from aar.1.google.com);
    x-csa=none;
    x-google-dkim=fail (message has been altered, 2048-bit rsa key)
      header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
    x-me-sender=none;
    x-ptr=pass smtp.helo=mail-pg1-f198.google.com
      policy.ptr=mail-pg1-f198.google.com;
    x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
      (MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
    x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
      smtp.bits=256/256;
    x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
    fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
    rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
    hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
    peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
    honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
    geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
    enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
    uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
    iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
    ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
    epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
    (linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
    receiver=mx6.messagingengine.com;
    identity=mailfrom;
    envelope-from="akpm@linux-foundation.org";
    helo=mail-pg1-f198.google.com;
    client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
	(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
	 key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
	(No client certificate requested)
	by mx6.messagingengine.com (Postfix) with ESMTPS
	for <akpm@mbx.kernel.org>; Tue,  4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
        for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
        d=1e100.net; s=20161025;
        h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
         :in-reply-to:user-agent;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
         NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
         feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
         25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
         ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
         vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
	tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
	xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
        Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
        d=google.com; s=arc-20160816;
        b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
         /i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
         50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
         8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
         DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
         pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
        h=user-agent:in-reply-to:message-id:subject:to:from:date
         :dkim-signature;
        bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
        b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
         Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
         uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
         XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
         TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
         rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
        by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
        (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
        Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
       dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
       spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
	Wed,  5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
	s=korg; t=1620184587;
	bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
	h=Date:From:To:Subject:In-Reply-To:From;
	b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
	 D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
	 H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org

From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)

SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it.  Instead, just make it a generic option which can be
selected on applicable platforms.  Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead.  This reduces code duplication and makes
it cleaner.

Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com>	[arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com>	[riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au>		[powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---

 arch/arm/Kconfig                       |    5 +----
 arch/arm64/Kconfig                     |    4 +---
 arch/mips/Kconfig                      |    6 +-----
 arch/parisc/Kconfig                    |    5 +----
 arch/powerpc/Kconfig                   |    3 ---
 arch/powerpc/platforms/Kconfig.cputype |    6 +++---
 arch/riscv/Kconfig                     |    5 +----
 arch/sh/Kconfig                        |    5 +----
 fs/Kconfig                             |    5 ++++-
 9 files changed, 13 insertions(+), 31 deletions(-)

--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
 	select ARCH_USE_QUEUED_SPINLOCKS
 	select ARCH_USE_SYM_ANNOTATIONS
 	select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
 	select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y
-
 config ARCH_HAS_FILTER_PGPROT
 	def_bool y
 
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
 	select ARCH_SUPPORTS_ATOMIC_RMW
+	select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
 	select ARCH_USE_BUILTIN_BSWAP
 	select ARCH_USE_CMPXCHG_LOCKREF
 	select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
 	def_bool y
 	depends on ARM_PMU
 
-config SYS_SUPPORTS_HUGETLBFS
-       def_bool y
-       depends on ARM_LPAE
-
 config HAVE_ARCH_TRANSPARENT_HUGEPAGE
        def_bool y
        depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
 	select ARCH_USE_MEMTEST
 	select ARCH_USE_QUEUED_RWLOCKS
 	select ARCH_USE_QUEUED_SPINLOCKS
+	select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_IPC_PARSE_VERSION
 	select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
 config SYS_SUPPORTS_LITTLE_ENDIAN
 	bool
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-	depends on CPU_SUPPORTS_HUGEPAGES
-	default y
-
 config MIPS_HUGE_TLB_SUPPORT
 	def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
 
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
 	select ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_HAS_UBSAN_SANITIZE_ALL
 	select ARCH_NO_SG_CHAIN
+	select ARCH_SUPPORTS_HUGETLBFS if PA20
 	select ARCH_SUPPORTS_MEMORY_FAILURE
 	select DMA_OPS
 	select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
 	default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
 	default 2
 
-config SYS_SUPPORTS_HUGETLBFS
-	def_bool y if PA20
-
-
 menu "Processor type and features"
 
 choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
 	def_bool y
 	depends on PPC_BOOK3S_64
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config ILLEGAL_POINTER_VALUE
 	hex
 	# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
 
 config PPC_8xx
 	bool "Freescale 8xx"
+	select ARCH_SUPPORTS_HUGETLBFS
 	select FSL_SOC
-	select SYS_SUPPORTS_HUGETLBFS
 	select PPC_HAVE_KUEP
 	select PPC_HAVE_KUAP
 	select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
 	bool "Server processors"
 	select PPC_FPU
 	select PPC_HAVE_PMU_SUPPORT
-	select SYS_SUPPORTS_HUGETLBFS
 	select HAVE_ARCH_TRANSPARENT_HUGEPAGE
 	select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+	select ARCH_SUPPORTS_HUGETLBFS
 	select ARCH_SUPPORTS_NUMA_BALANCING
 	select IRQ_WORK
 	select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
 # this is for common code between PPC32 & PPC64 FSL BOOKE
 config PPC_FSL_BOOK3E
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select FSL_EMB_PERFMON
 	select PPC_SMP_MUXED_IPI
-	select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
 	select PPC_DOORBELL
 	default y if FSL_BOOKE
 
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
 	select ARCH_HAS_STRICT_KERNEL_RWX if MMU
 	select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
 	select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
 	select ARCH_WANT_FRAME_POINTERS
 	select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
 config ARCH_SUPPORTS_UPROBES
 	def_bool y
 
-config SYS_SUPPORTS_HUGETLBFS
-	depends on MMU
-	def_bool y
-
 config STACKTRACE_SUPPORT
 	def_bool y
 
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
 	bool
 	select ARCH_SUSPEND_POSSIBLE
 
-config SYS_SUPPORTS_HUGETLBFS
-	bool
-
 config SYS_SUPPORTS_SMP
 	bool
 
@@ -175,12 +172,12 @@ config CPU_SH3
 
 config CPU_SH4
 	bool
+	select ARCH_SUPPORTS_HUGETLBFS if MMU
 	select CPU_HAS_INTEVT
 	select CPU_HAS_SR_RB
 	select CPU_HAS_FPU if !CPU_SH4AL_DSP
 	select SH_INTC
 	select SYS_SUPPORTS_SH_TMU
-	select SYS_SUPPORTS_HUGETLBFS if MMU
 
 config CPU_SH4A
 	bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
 
 	  If unsure, say N.
 
+config ARCH_SUPPORTS_HUGETLBFS
+	def_bool n
+
 config HUGETLBFS
 	bool "HugeTLB file system support"
 	depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
-		   SYS_SUPPORTS_HUGETLBFS || BROKEN
+		   ARCH_SUPPORTS_HUGETLBFS || BROKEN
 	help
 	  hugetlbfs is a filesystem backing for HugeTLB pages, based on
 	  ramfs. For architectures that support it, say Y here and read
_

Re: incoming

[Linus Torvalds]

On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Let me resend right now with the same in-reply-to.  Hopefully they will
> land in the correct place.

Well, you re-sent it twice, and I have three copies in my own mailbox,
bot they still don't show up on the mm-commits mailing list.

So the list hates them for some odd reason.

I've picked them up locally, but adding Konstantin to the participants
to see if he can see what's up.

Konstantin: patches 103/106/107 are missing on lore out of Andrew's
series of 143. Odd.

             Linus

Re: incoming

[Andrew Morton]

On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 143 patches
> 
> Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
> 
> Maybe just some mail delay? But at least right now
> 
>    https://lore.kernel.org/mm-commits/
> 
> doesn't show them (and thus 'b4' doesn't work).
> 
> I'll check again later.
> 

Well that's strange.  I see all three via cc:me, but not on linux-mm or
mm-commits.

Let me resend right now with the same in-reply-to.  Hopefully they will
land in the correct place.

Re: incoming

[Linus Torvalds]

On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 143 patches

Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.

Maybe just some mail delay? But at least right now

   https://lore.kernel.org/mm-commits/

doesn't show them (and thus 'b4' doesn't work).

I'll check again later.

             Linus

incoming

[Andrew Morton]

The remainder of the main mm/ queue.

143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.

Subsystems affected by this patch series:

  mm/pagecache
  mm/hugetlb
  mm/userfaultfd
  mm/vmscan
  mm/compaction
  mm/migration
  mm/cma
  mm/ksm
  mm/vmstat
  mm/mmap
  mm/kconfig
  mm/util
  mm/memory-hotplug
  mm/zswap
  mm/zsmalloc
  mm/highmem
  mm/cleanups
  mm/kfence

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Remove nrexceptional tracking", v2:
      mm: introduce and use mapping_empty()
      mm: stop accounting shadow entries
      dax: account DAX entries as nrpages
      mm: remove nrexceptional from inode

    Hugh Dickins <hughd@google.com>:
      mm: remove nrexceptional from inode: remove BUG_ON

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4:
      hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
      hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
      mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
      hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm: generalize HUGETLB_PAGE_SIZE_VARIABLE

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Some cleanups for hugetlb":
      mm/hugetlb: use some helper functions to cleanup code
      mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
      mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
      mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
      mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
    Patch series "Cleanup and fixup for khugepaged", v2:
      khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
      khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
      khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
      khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
      mm/huge_memory.c: remove unnecessary local variable ret2
    Patch series "Some cleanups for huge_memory", v3:
      mm/huge_memory.c: rework the function vma_adjust_trans_huge()
      mm/huge_memory.c: make get_huge_zero_page() return bool
      mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
      mm/huge_memory.c: remove redundant PageCompound() check
      mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
      mm/huge_memory.c: use helper function migration_entry_to_page()

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup for khugepaged":
      khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
      khugepaged: remove unnecessary out label in collapse_huge_page()
      khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()

    Zi Yan <ziy@nvidia.com>:
      mm: huge_memory: a new debugfs interface for splitting THP tests
      mm: huge_memory: debugfs for file-backed THP split

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for hugetlb", v2:
      mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
      mm/hugeltb: simplify the return code of __vma_reservation_common()
      mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
      mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
      mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "make hugetlb put_page safe for all calling contexts", v5:
      mm/cma: change cma mutex to irq safe spinlock
      hugetlb: no need to drop hugetlb_lock to call cma_release
      hugetlb: add per-hstate mutex to synchronize user adjustments
      hugetlb: create remove_hugetlb_page() to separate functionality
      hugetlb: call update_and_free_page without hugetlb_lock
      hugetlb: change free_pool_huge_page to remove_pool_huge_page
      hugetlb: make free_huge_page irq safe
      hugetlb: add lockdep_assert_held() calls for hugetlb_lock

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Make alloc_contig_range handle Hugetlb pages", v10:
      mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
      mm,compaction: let isolate_migratepages_{range,block} return error codes
      mm,hugetlb: drop clearing of flag from prep_new_huge_page
      mm,hugetlb: split prep_new_huge_page functionality
      mm: make alloc_contig_range handle free hugetlb pages
      mm: make alloc_contig_range handle in-use hugetlb pages
      mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig

Subsystem: mm/userfaultfd

    Axel Rasmussen <axelrasmussen@google.com>:
    Patch series "userfaultfd: add minor fault handling", v9:
      userfaultfd: add minor fault registration mode
      userfaultfd: disable huge PMD sharing for MINOR registered VMAs
      userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
      userfaultfd: add UFFDIO_CONTINUE ioctl
      userfaultfd: update documentation to describe minor fault handling
      userfaultfd/selftests: add test exercising minor fault handling

Subsystem: mm/vmscan

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: move RECLAIM* bits to uapi header
      mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks

    Yang Shi <shy828301@gmail.com>:
    Patch series "Make shrinker's nr_deferred memcg aware", v10:
      mm: vmscan: use nid from shrink_control for tracepoint
      mm: vmscan: consolidate shrinker_maps handling code
      mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
      mm: vmscan: remove memcg_shrinker_map_size
      mm: vmscan: use kvfree_rcu instead of call_rcu
      mm: memcontrol: rename shrinker_map to shrinker_info
      mm: vmscan: add shrinker_info_protected() helper
      mm: vmscan: use a new flag to indicate shrinker is registered
      mm: vmscan: add per memcg shrinker nr_deferred
      mm: vmscan: use per memcg nr_deferred of shrinker
      mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
      mm: memcontrol: reparent nr_deferred when memcg offline
      mm: vmscan: shrink deferred objects proportional to priority

Subsystem: mm/compaction

    Pintu Kumar <pintu@codeaurora.org>:
      mm/compaction: remove unused variable sysctl_compact_memory

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: compaction: update the COMPACT[STALL|FAIL] events properly

Subsystem: mm/migration

    Minchan Kim <minchan@kernel.org>:
      mm: disable LRU pagevec during the migration temporarily
      mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
      mm: fs: invalidate BH LRU during page migration

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for mm/migrate.c", v3:
      mm/migrate.c: make putback_movable_page() static
      mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
      mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
      mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
      Revert "mm: migrate: skip shared exec THP for NUMA balancing"

Subsystem: mm/cma

    Minchan Kim <minchan@kernel.org>:
      mm: vmstat: add cma statistics

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: cma: use pr_err_ratelimited for CMA warning

    Liam Mark <lmark@codeaurora.org>:
      mm: cma: add trace events for CMA alloc perf testing

    Minchan Kim <minchan@kernel.org>:
      mm: cma: support sysfs
      mm: cma: add the CMA instance name to cma trace events
      mm: use proper type for cma_[alloc|release]

Subsystem: mm/ksm

    Miaohe Lin <linmiaohe@huawei.com>:
    Patch series "Cleanup and fixup for ksm":
      ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
      ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
      ksm: remove dedicated macro KSM_FLAG_MASK
      ksm: fix potential missing rmap_item for stable_node

    Chengyang Fan <cy.fan@huawei.com>:
      mm/ksm: remove unused parameter from remove_trailing_rmap_items()

Subsystem: mm/vmstat

    Hugh Dickins <hughd@google.com>:
      mm: restore node stat checking in /proc/sys/vm/stat_refresh
      mm: no more EINVAL from /proc/sys/vm/stat_refresh
      mm: /proc/sys/vm/stat_refresh skip checking known negative stats
      mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats

    Saravanan D <saravanand@fb.com>:
      x86/mm: track linear mapping split events

Subsystem: mm/mmap

    Liam Howlett <liam.howlett@oracle.com>:
      mm/mmap.c: don't unlock VMAs in remap_file_pages()

Subsystem: mm/kconfig

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm: some config cleanups", v2:
      mm: generalize ARCH_HAS_CACHE_LINE_SIZE
      mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
      mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
      mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
      mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK
      mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE

Subsystem: mm/util

    Joe Perches <joe@perches.com>:
      mm/util.c: reduce mem_dump_obj() object size

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/util.c: fix typo

Subsystem: mm/memory-hotplug

    Pavel Tatashin <pasha.tatashin@soleen.com>:
    Patch series "prohibit pinning pages in ZONE_MOVABLE", v11:
      mm/gup: don't pin migrated cma pages in movable zone
      mm/gup: check every subpage of a compound page during isolation
      mm/gup: return an error on migration failure
      mm/gup: check for isolation errors
      mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
      mm: apply per-task gfp constraints in fast path
      mm: honor PF_MEMALLOC_PIN for all movable pages
      mm/gup: do not migrate zero page
      mm/gup: migrate pinned pages out of movable zone
      memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
      mm/gup: change index type to long as it counts pages
      mm/gup: longterm pin migration cleanup
      selftests/vm: gup_test: fix test flag
      selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages

    Mel Gorman <mgorman@techsingularity.net>:
      mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Allocate memmap from hotadded memory (per device)", v10:
      drivers/base/memory: introduce memory_block_{online,offline}
      mm,memory_hotplug: relax fully spanned sections check

    David Hildenbrand <david@redhat.com>:
      mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()

    Oscar Salvador <osalvador@suse.de>:
      mm,memory_hotplug: allocate memmap from the added memory range
      acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
      mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
      x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
      arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE

Subsystem: mm/zswap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/zswap.c: switch from strlcpy to strscpy

Subsystem: mm/zsmalloc

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
    Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()":
      iov_iter: lift memzero_page() to highmem.h
      btrfs: use memzero_page() instead of open coded kmap pattern

    songqiang <songqiang@uniontech.com>:
      mm/highmem.c: fix coding style issue

Subsystem: mm/cleanups

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/mempool: minor coding style tweaks

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      mm/process_vm_access.c: remove duplicate include

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: zero guard page after out-of-bounds access
    Patch series "kfence: optimize timer scheduling", v2:
      kfence: await for allocation using wait_event
      kfence: maximize allocation wait timeout duration
      kfence: use power-efficient work queue to run delayed work

 Documentation/ABI/testing/sysfs-kernel-mm-cma     |   25 
 Documentation/admin-guide/kernel-parameters.txt   |   17 
 Documentation/admin-guide/mm/memory-hotplug.rst   |    9 
 Documentation/admin-guide/mm/userfaultfd.rst      |  105 +-
 arch/arc/Kconfig                                  |    9 
 arch/arm/Kconfig                                  |   10 
 arch/arm64/Kconfig                                |   34 
 arch/arm64/mm/hugetlbpage.c                       |    7 
 arch/ia64/Kconfig                                 |   14 
 arch/ia64/mm/hugetlbpage.c                        |    3 
 arch/mips/Kconfig                                 |    6 
 arch/mips/mm/hugetlbpage.c                        |    4 
 arch/parisc/Kconfig                               |    5 
 arch/parisc/mm/hugetlbpage.c                      |    2 
 arch/powerpc/Kconfig                              |   17 
 arch/powerpc/mm/hugetlbpage.c                     |    3 
 arch/powerpc/platforms/Kconfig.cputype            |   16 
 arch/riscv/Kconfig                                |    5 
 arch/s390/Kconfig                                 |   12 
 arch/s390/mm/hugetlbpage.c                        |    2 
 arch/sh/Kconfig                                   |    7 
 arch/sh/mm/Kconfig                                |    8 
 arch/sh/mm/hugetlbpage.c                          |    2 
 arch/sparc/mm/hugetlbpage.c                       |    2 
 arch/x86/Kconfig                                  |   33 
 arch/x86/mm/pat/set_memory.c                      |    8 
 drivers/acpi/acpi_memhotplug.c                    |    5 
 drivers/base/memory.c                             |  105 ++
 fs/Kconfig                                        |    5 
 fs/block_dev.c                                    |    2 
 fs/btrfs/compression.c                            |    5 
 fs/btrfs/extent_io.c                              |   22 
 fs/btrfs/inode.c                                  |   33 
 fs/btrfs/reflink.c                                |    6 
 fs/btrfs/zlib.c                                   |    5 
 fs/btrfs/zstd.c                                   |    5 
 fs/buffer.c                                       |   36 
 fs/dax.c                                          |    8 
 fs/gfs2/glock.c                                   |    3 
 fs/hugetlbfs/inode.c                              |    9 
 fs/inode.c                                        |   11 
 fs/proc/task_mmu.c                                |    3 
 fs/userfaultfd.c                                  |  149 +++
 include/linux/buffer_head.h                       |    4 
 include/linux/cma.h                               |    4 
 include/linux/compaction.h                        |    1 
 include/linux/fs.h                                |    2 
 include/linux/gfp.h                               |    2 
 include/linux/highmem.h                           |    7 
 include/linux/huge_mm.h                           |    3 
 include/linux/hugetlb.h                           |   37 
 include/linux/memcontrol.h                        |   27 
 include/linux/memory.h                            |    8 
 include/linux/memory_hotplug.h                    |   15 
 include/linux/memremap.h                          |    2 
 include/linux/migrate.h                           |   11 
 include/linux/mm.h                                |   28 
 include/linux/mmzone.h                            |   20 
 include/linux/pagemap.h                           |    5 
 include/linux/pgtable.h                           |   12 
 include/linux/sched.h                             |    2 
 include/linux/sched/mm.h                          |   27 
 include/linux/shrinker.h                          |    7 
 include/linux/swap.h                              |   21 
 include/linux/userfaultfd_k.h                     |   55 +
 include/linux/vm_event_item.h                     |    8 
 include/trace/events/cma.h                        |   92 +-
 include/trace/events/migrate.h                    |   25 
 include/trace/events/mmflags.h                    |    7 
 include/uapi/linux/mempolicy.h                    |    7 
 include/uapi/linux/userfaultfd.h                  |   36 
 init/Kconfig                                      |    5 
 kernel/sysctl.c                                   |    2 
 lib/Kconfig.kfence                                |    1 
 lib/iov_iter.c                                    |    8 
 mm/Kconfig                                        |   28 
 mm/Makefile                                       |    6 
 mm/cma.c                                          |   70 +
 mm/cma.h                                          |   25 
 mm/cma_debug.c                                    |    8 
 mm/cma_sysfs.c                                    |  112 ++
 mm/compaction.c                                   |  113 ++
 mm/filemap.c                                      |   24 
 mm/frontswap.c                                    |   12 
 mm/gup.c                                          |  264 +++---
 mm/gup_test.c                                     |   29 
 mm/gup_test.h                                     |    3 
 mm/highmem.c                                      |   11 
 mm/huge_memory.c                                  |  326 +++++++-
 mm/hugetlb.c                                      |  843 ++++++++++++++--------
 mm/hugetlb_cgroup.c                               |    9 
 mm/internal.h                                     |   10 
 mm/kfence/core.c                                  |   61 +
 mm/khugepaged.c                                   |   63 -
 mm/ksm.c                                          |   17 
 mm/list_lru.c                                     |    6 
 mm/memcontrol.c                                   |  137 ---
 mm/memory_hotplug.c                               |  220 +++++
 mm/mempolicy.c                                    |   16 
 mm/mempool.c                                      |    2 
 mm/migrate.c                                      |  103 --
 mm/mlock.c                                        |    4 
 mm/mmap.c                                         |   18 
 mm/oom_kill.c                                     |    2 
 mm/page_alloc.c                                   |   83 +-
 mm/process_vm_access.c                            |    1 
 mm/shmem.c                                        |    2 
 mm/sparse.c                                       |    4 
 mm/swap.c                                         |   69 +
 mm/swap_state.c                                   |    4 
 mm/swapfile.c                                     |    4 
 mm/truncate.c                                     |   19 
 mm/userfaultfd.c                                  |   39 -
 mm/util.c                                         |   26 
 mm/vmalloc.c                                      |    2 
 mm/vmscan.c                                       |  543 +++++++++-----
 mm/vmstat.c                                       |   45 -
 mm/workingset.c                                   |    1 
 mm/zsmalloc.c                                     |    6 
 mm/zswap.c                                        |    2 
 tools/testing/selftests/vm/.gitignore             |    1 
 tools/testing/selftests/vm/Makefile               |    1 
 tools/testing/selftests/vm/gup_test.c             |   38 
 tools/testing/selftests/vm/split_huge_page_test.c |  400 ++++++++++
 tools/testing/selftests/vm/userfaultfd.c          |  164 ++++
 125 files changed, 3596 insertions(+), 1668 deletions(-)

incoming

[Andrew Morton]

A few misc subsystems and some of MM.


178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0.

Subsystems affected by this patch series:

  ia64
  kbuild
  scripts
  sh
  ocfs2
  kfifo
  vfs
  kernel/watchdog
  mm/slab-generic
  mm/slub
  mm/kmemleak
  mm/debug
  mm/pagecache
  mm/msync
  mm/gup
  mm/memremap
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/dma
  mm/sparsemem
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/initialization
  mm/pagealloc
  mm/memory-failure

Subsystem: ia64

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      arch/ia64/kernel/head.S: remove duplicate include

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      arch/ia64/kernel/fsys.S: fix typos
      arch/ia64/include/asm/pgtable.h: minor typo fixes

    Valentin Schneider <valentin.schneider@arm.com>:
      ia64: ensure proper NUMA distance and possible map initialization

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: drop unused IA64_FW_EMU ifdef
      ia64: simplify code flow around swiotlb init

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ia64: trivial spelling fixes

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix EFI_DEBUG build
      ia64: mca: always make IA64_MCA_DEBUG an expression
      ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP
      ia64: module: fix symbolizer crash on fdescr

Subsystem: kbuild

    Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
      include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*()

Subsystem: scripts

    Tom Saeger <tom.saeger@oracle.com>:
      scripts/spelling.txt: add entries for recent discoveries

    Wan Jiabing <wanjiabing@vivo.com>:
      scripts: a new script for checking duplicate struct declaration

Subsystem: sh

    Zhang Yunkai <zhang.yunkai@zte.com.cn>:
      arch/sh/include/asm/tlb.h: remove duplicate include

Subsystem: ocfs2

    Yang Li <yang.lee@linux.alibaba.com>:
      ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE

    Joseph Qi <joseph.qi@linux.alibaba.com>:
      ocfs2: map flags directly in flags_to_o2dlm()

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      ocfs2: fix a typo

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      ocfs2/dlm: remove unused function

Subsystem: kfifo

    Dan Carpenter <dan.carpenter@oracle.com>:
      kfifo: fix ternary sign extension bugs

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      vfs: fs_parser: clean up kernel-doc warnings

Subsystem: kernel/watchdog

    Petr Mladek <pmladek@suse.com>:
    Patch series "watchdog/softlockup: Report overall time and some cleanup", v2:
      watchdog: rename __touch_watchdog() to a better descriptive name
      watchdog: explicitly update timestamp when reporting softlockup
      watchdog/softlockup: report the overall time of softlockups
      watchdog/softlockup: remove logic that tried to prevent repeated reports
      watchdog: fix barriers when printing backtraces from all CPUs
      watchdog: cleanup handling of false positives

Subsystem: mm/slab-generic

    Rafael Aquini <aquini@redhat.com>:
      mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: enable slub_debug static key when creating cache with explicit debug flags

    Oliver Glitta <glittao@gmail.com>:
      kunit: add a KUnit test for SLUB debugging functionality
      slub: remove resiliency_test() function

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/slub.c: trivial typo fixes

Subsystem: mm/kmemleak

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      mm/kmemleak.c: fix a typo

Subsystem: mm/debug

    Georgi Djakov <georgi.djakov@linaro.org>:
      mm/page_owner: record the timestamp of all pages during free

    zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
      mm, page_owner: remove unused parameter in __set_page_owner_handle

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_owner: fetch backtrace only for tracked pages
      mm: page_owner: use kstrtobool() to parse bool option
      mm: page_owner: detect page_owner recursion via task_struct
      mm: page_poison: print page info when corruption is caught

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memtest: add ARCH_USE_MEMTEST

Subsystem: mm/pagecache

    Jens Axboe <axboe@kernel.dk>:
    Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3:
      mm: provide filemap_range_needs_writeback() helper
      mm: use filemap_range_needs_writeback() for O_DIRECT reads
      iomap: use filemap_range_needs_writeback() for O_DIRECT reads

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/filemap: use filemap_read_page in filemap_fault
      mm/filemap: drop check for truncated page after I/O

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page-writeback: simplify memcg handling in test_clear_page_writeback()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: move page_mapping_file to pagemap.h

    Rui Sun <sunrui26@huawei.com>:
      mm/filemap: update stale comment

Subsystem: mm/msync

    Nikita Ermakov <sh1r4s3@mail.si-head.nl>:
      mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start

Subsystem: mm/gup

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm/gup: page unpining improvements", v4:
      mm/gup: add compound page list iterator
      mm/gup: decrement head page once for group of subpages
      mm/gup: add a range variant of unpin_user_pages_dirty_lock()
      RDMA/umem: batch page unpin in __ib_umem_release()

    Yang Shi <shy828301@gmail.com>:
      mm: gup: remove FOLL_SPLIT

Subsystem: mm/memremap

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/memremap.c: fix improper SPDX comment style

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix kernel stack account

    Shakeel Butt <shakeelb@google.com>:
      memcg: cleanup root memcg checks
      memcg: enable memcg oom-kill for __GFP_NOFAIL

    Johannes Weiner <hannes@cmpxchg.org>:
    Patch series "mm: memcontrol: switch to rstat", v3:
      mm: memcontrol: fix cpuhotplug statistics flushing
      mm: memcontrol: kill mem_cgroup_nodeinfo()
      mm: memcontrol: privatize memcg_page_state query functions
      cgroup: rstat: support cgroup1
      cgroup: rstat: punt root-level optimization to individual controllers
      mm: memcontrol: switch to rstat
      mm: memcontrol: consolidate lruvec stat flushing
      kselftests: cgroup: update kmem test for new vmstat implementation

    Shakeel Butt <shakeelb@google.com>:
      memcg: charge before adding to swapcache on swapin

    Muchun Song <songmuchun@bytedance.com>:
    Patch series "Use obj_cgroup APIs to charge kmem pages", v5:
      mm: memcontrol: slab: fix obtain a reference to a freeing memcg
      mm: memcontrol: introduce obj_cgroup_{un}charge_pages
      mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c
      mm: memcontrol: change ug->dummy_page only if memcg changed
      mm: memcontrol: use obj_cgroup APIs to charge kmem pages
      mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages()
      mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM

    Wan Jiabing <wanjiabing@vivo.com>:
      linux/memcontrol.h: remove duplicate struct declaration

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: page_counter: mitigate consequences of a page_counter underflow

Subsystem: mm/pagemap

    Wang Qing <wangqing@vivo.com>:
      mm/memory.c: do_numa_page(): delete bool "migrated"

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/interval_tree: add comments to improve code readability

    Oscar Salvador <osalvador@suse.de>:
    Patch series "Cleanup and fixups for vmemmap handling", v6:
      x86/vmemmap: drop handling of 4K unaligned vmemmap range
      x86/vmemmap: drop handling of 1GB vmemmap ranges
      x86/vmemmap: handle unpopulated sub-pmd ranges
      x86/vmemmap: optimize for consecutive sections in partial populated PMDs

    Ovidiu Panait <ovidiu.panait@windriver.com>:
      mm, tracing: improve rss_stat tracepoint message

    Christoph Hellwig <hch@lst.de>:
    Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2:
      mm: add remap_pfn_range_notrack
      mm: add a io_mapping_map_user helper
      i915: use io_mapping_map_user
      i915: fix remap_io_sg to verify the pgprot

    Huang Ying <ying.huang@intel.com>:
      NUMA balancing: reduce TLB flush via delaying mapping on hint page fault

Subsystem: mm/mremap

    Brian Geffon <bgeffon@google.com>:
    Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5:
      mm: extend MREMAP_DONTUNMAP to non-anonymous mappings
      Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio"
      selftests: add a MREMAP_DONTUNMAP selftest for shmem

Subsystem: mm/dma

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/dmapool: switch from strlcpy to strscpy

Subsystem: mm/sparsemem

    Wang Wensheng <wangwensheng4@huawei.com>:
      mm/sparse: add the missing sparse_buffer_fini() in error branch

Subsystem: mm/vmalloc

    Christoph Hellwig <hch@lst.de>:
    Patch series "remap_vmalloc_range cleanups":
      samples/vfio-mdev/mdpy: use remap_vmalloc_range
      mm: unexport remap_vmalloc_range_partial

    Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>:
      mm/vmalloc: use rb_tree instead of list for vread() lookups

    Nicholas Piggin <npiggin@gmail.com>:
    Patch series "huge vmalloc mappings", v13:
      ARM: mm: add missing pud_page define to 2-level page tables
      mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page
      mm: apply_to_pte_range warn and fail if a large pte is encountered
      mm/vmalloc: rename vmap_*_range vmap_pages_*_range
      mm/ioremap: rename ioremap_*_range to vmap_*_range
      mm: HUGE_VMAP arch support cleanup
      powerpc: inline huge vmap supported functions
      arm64: inline huge vmap supported functions
      x86: inline huge vmap supported functions
      mm/vmalloc: provide fallback arch huge vmap support functions
      mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c
      mm/vmalloc: add vmap_range_noflush variant
      mm/vmalloc: hugepage vmalloc mappings
    Patch series "mm/vmalloc: cleanup after hugepage series", v2:
      mm/vmalloc: remove map_kernel_range
      kernel/dma: remove unnecessary unmap_kernel_range
      powerpc/xive: remove unnecessary unmap_kernel_range
      mm/vmalloc: remove unmap_kernel_range
      mm/vmalloc: improve allocation failure error messages

    Vijayanand Jitta <vjitta@codeaurora.org>:
      mm: vmalloc: prevent use after free in _vm_unmap_aliases

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      lib/test_vmalloc.c: remove two kvfree_rcu() tests
      lib/test_vmalloc.c: add a new 'nr_threads' parameter
      vm/test_vmalloc.sh: adapt for updated driver interface
      mm/vmalloc: refactor the preloading loagic
      mm/vmalloc: remove an empty line

Subsystem: mm/documentation

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/doc: fix fault_flag_allow_retry_first kerneldoc
      mm/doc: fix page_maybe_dma_pinned kerneldoc
      mm/doc: turn fault flags into an enum
      mm/doc: add mm.h and mm_types.h to the mm-api document

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
    Patch series "kernel-doc and MAINTAINERS clean-up":
      MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT
      pagewalk: prefix struct kernel-doc descriptions

Subsystem: mm/kasan

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/kasan: switch from strlcpy to strscpy

    Peter Collingbourne <pcc@google.com>:
      kasan: fix kasan_byte_accessible() to be consistent with actual checks

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: initialize shadow to TAG_INVALID for SW_TAGS
      mm, kasan: don't poison boot memory with tag-based modes
    Patch series "kasan: integrate with init_on_alloc/free", v3:
      arm64: kasan: allow to init memory when setting tags
      kasan: init memory in kasan_(un)poison for HW_TAGS
      kasan, mm: integrate page_alloc init with HW_TAGS
      kasan, mm: integrate slab init_on_alloc with HW_TAGS
      kasan, mm: integrate slab init_on_free with HW_TAGS
      kasan: docs: clean up sections
      kasan: docs: update overview section
      kasan: docs: update usage section
      kasan: docs: update error reports section
      kasan: docs: update boot parameters section
      kasan: docs: update GENERIC implementation details section
      kasan: docs: update SW_TAGS implementation details section
      kasan: docs: update HW_TAGS implementation details section
      kasan: docs: update shadow memory section
      kasan: docs: update ignoring accesses section
      kasan: docs: update tests section

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: record task_work_add() call stack

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: detect false-positives in tests

    Zqiang <qiang.zhang@windriver.com>:
      irq_work: record irq_work_queue() call stack

Subsystem: mm/initialization

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm: move mem_init_print_info() into mm_init()

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range()

    Minchan Kim <minchan@kernel.org>:
      mm: remove lru_add_drain_all in alloc_contig_range

    Yu Zhao <yuzhao@google.com>:
      include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH
      include/linux/page-flags-layout.h: cleanups

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Rationalise __alloc_pages wrappers", v3:
      mm/page_alloc: rename alloc_mask to alloc_gfp
      mm/page_alloc: rename gfp_mask to gfp
      mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask
      mm/mempolicy: rename alloc_pages_current to alloc_pages
      mm/mempolicy: rewrite alloc_pages documentation
      mm/mempolicy: rewrite alloc_pages_vma documentation
      mm/mempolicy: fix mpol_misplaced kernel-doc

    Minchan Kim <minchan@kernel.org>:
      mm: page_alloc: dump migrate-failed pages

    Geert Uytterhoeven <geert@linux-m68k.org>:
      mm/Kconfig: remove default DISCONTIGMEM_MANUAL

    Kefeng Wang <wangkefeng.wang@huawei.com>:
      mm, page_alloc: avoid page_to_pfn() in move_freepages()

    zhouchuangao <zhouchuangao@vivo.com>:
      mm/page_alloc: duplicate include linux/vmalloc.h

    Mel Gorman <mgorman@techsingularity.net>:
    Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6:
      mm/page_alloc: rename alloced to allocated
      mm/page_alloc: add a bulk page allocator
      mm/page_alloc: add an array-based interface to the bulk page allocator

    Jesper Dangaard Brouer <brouer@redhat.com>:
      mm/page_alloc: optimize code layout for __alloc_pages_bulk
      mm/page_alloc: inline __rmqueue_pcplist

    Chuck Lever <chuck.lever@oracle.com>:
    Patch series "SUNRPC consumer for the bulk page allocator":
      SUNRPC: set rq_page_end differently
      SUNRPC: refresh rq_pages using a bulk page allocator

    Jesper Dangaard Brouer <brouer@redhat.com>:
      net: page_pool: refactor dma_map into own function page_pool_dma_map
      net: page_pool: use alloc_pages_bulk in refill code path

    Sergei Trofimovich <slyfox@gentoo.org>:
      mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1

    huxiang <huxiang@uniontech.com>:
      mm/page_alloc: redundant definition variables of pfn in for loop

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/mmzone.h: fix existing kernel-doc comments and link them to core-api

Subsystem: mm/memory-failure

    Jane Chu <jane.chu@oracle.com>:
      mm/memory-failure: unnecessary amount of unmapping

 Documentation/admin-guide/kernel-parameters.txt |    7 
 Documentation/admin-guide/mm/transhuge.rst      |    2 
 Documentation/core-api/cachetlb.rst             |    4 
 Documentation/core-api/mm-api.rst               |    6 
 Documentation/dev-tools/kasan.rst               |  355 +++++-----
 Documentation/vm/page_owner.rst                 |    2 
 Documentation/vm/transhuge.rst                  |    5 
 MAINTAINERS                                     |    1 
 arch/Kconfig                                    |   11 
 arch/alpha/mm/init.c                            |    1 
 arch/arc/mm/init.c                              |    1 
 arch/arm/Kconfig                                |    1 
 arch/arm/include/asm/pgtable-3level.h           |    2 
 arch/arm/include/asm/pgtable.h                  |    3 
 arch/arm/mm/copypage-v4mc.c                     |    1 
 arch/arm/mm/copypage-v6.c                       |    1 
 arch/arm/mm/copypage-xscale.c                   |    1 
 arch/arm/mm/init.c                              |    2 
 arch/arm64/Kconfig                              |    1 
 arch/arm64/include/asm/memory.h                 |    4 
 arch/arm64/include/asm/mte-kasan.h              |   39 -
 arch/arm64/include/asm/vmalloc.h                |   38 -
 arch/arm64/mm/init.c                            |    4 
 arch/arm64/mm/mmu.c                             |   36 -
 arch/csky/abiv1/cacheflush.c                    |    1 
 arch/csky/mm/init.c                             |    1 
 arch/h8300/mm/init.c                            |    2 
 arch/hexagon/mm/init.c                          |    1 
 arch/ia64/Kconfig                               |   23 
 arch/ia64/configs/bigsur_defconfig              |    1 
 arch/ia64/include/asm/meminit.h                 |   11 
 arch/ia64/include/asm/module.h                  |    6 
 arch/ia64/include/asm/page.h                    |   25 
 arch/ia64/include/asm/pgtable.h                 |    7 
 arch/ia64/kernel/Makefile                       |    2 
 arch/ia64/kernel/acpi.c                         |    7 
 arch/ia64/kernel/efi.c                          |   11 
 arch/ia64/kernel/fsys.S                         |    4 
 arch/ia64/kernel/head.S                         |    6 
 arch/ia64/kernel/ia64_ksyms.c                   |   12 
 arch/ia64/kernel/machine_kexec.c                |    2 
 arch/ia64/kernel/mca.c                          |    4 
 arch/ia64/kernel/module.c                       |   29 
 arch/ia64/kernel/pal.S                          |    6 
 arch/ia64/mm/Makefile                           |    1 
 arch/ia64/mm/contig.c                           |    4 
 arch/ia64/mm/discontig.c                        |   21 
 arch/ia64/mm/fault.c                            |   15 
 arch/ia64/mm/init.c                             |  221 ------
 arch/m68k/mm/init.c                             |    1 
 arch/microblaze/mm/init.c                       |    1 
 arch/mips/Kconfig                               |    1 
 arch/mips/loongson64/numa.c                     |    1 
 arch/mips/mm/cache.c                            |    1 
 arch/mips/mm/init.c                             |    1 
 arch/mips/sgi-ip27/ip27-memory.c                |    1 
 arch/nds32/mm/init.c                            |    1 
 arch/nios2/mm/cacheflush.c                      |    1 
 arch/nios2/mm/init.c                            |    1 
 arch/openrisc/mm/init.c                         |    2 
 arch/parisc/mm/init.c                           |    2 
 arch/powerpc/Kconfig                            |    1 
 arch/powerpc/include/asm/vmalloc.h              |   34 -
 arch/powerpc/kernel/isa-bridge.c                |    4 
 arch/powerpc/kernel/pci_64.c                    |    2 
 arch/powerpc/mm/book3s64/radix_pgtable.c        |   29 
 arch/powerpc/mm/ioremap.c                       |    2 
 arch/powerpc/mm/mem.c                           |    1 
 arch/powerpc/sysdev/xive/common.c               |    4 
 arch/riscv/mm/init.c                            |    1 
 arch/s390/mm/init.c                             |    2 
 arch/sh/include/asm/tlb.h                       |   10 
 arch/sh/mm/cache-sh4.c                          |    1 
 arch/sh/mm/cache-sh7705.c                       |    1 
 arch/sh/mm/init.c                               |    1 
 arch/sparc/include/asm/pgtable_32.h             |    3 
 arch/sparc/mm/init_32.c                         |    2 
 arch/sparc/mm/init_64.c                         |    1 
 arch/sparc/mm/tlb.c                             |    1 
 arch/um/kernel/mem.c                            |    1 
 arch/x86/Kconfig                                |    1 
 arch/x86/include/asm/vmalloc.h                  |   42 -
 arch/x86/kernel/cpu/resctrl/pseudo_lock.c       |    2 
 arch/x86/mm/init_32.c                           |    2 
 arch/x86/mm/init_64.c                           |  222 ++++--
 arch/x86/mm/ioremap.c                           |   33 
 arch/x86/mm/pgtable.c                           |   13 
 arch/xtensa/Kconfig                             |    1 
 arch/xtensa/mm/init.c                           |    1 
 block/blk-cgroup.c                              |   17 
 drivers/gpu/drm/i915/Kconfig                    |    1 
 drivers/gpu/drm/i915/gem/i915_gem_mman.c        |    9 
 drivers/gpu/drm/i915/i915_drv.h                 |    3 
 drivers/gpu/drm/i915/i915_mm.c                  |  117 ---
 drivers/infiniband/core/umem.c                  |   12 
 drivers/pci/pci.c                               |    2 
 fs/aio.c                                        |    5 
 fs/fs_parser.c                                  |    2 
 fs/iomap/direct-io.c                            |   24 
 fs/ocfs2/blockcheck.c                           |    2 
 fs/ocfs2/dlm/dlmrecovery.c                      |    7 
 fs/ocfs2/stack_o2cb.c                           |   36 -
 fs/ocfs2/stackglue.c                            |    2 
 include/linux/compiler-gcc.h                    |    8 
 include/linux/fs.h                              |    2 
 include/linux/gfp.h                             |   45 -
 include/linux/io-mapping.h                      |    3 
 include/linux/io.h                              |    9 
 include/linux/kasan.h                           |   51 +
 include/linux/memcontrol.h                      |  271 ++++----
 include/linux/mm.h                              |   50 -
 include/linux/mmzone.h                          |   43 -
 include/linux/page-flags-layout.h               |   64 -
 include/linux/pagemap.h                         |   10 
 include/linux/pagewalk.h                        |    4 
 include/linux/sched.h                           |    4 
 include/linux/slab.h                            |    2 
 include/linux/slub_def.h                        |    2 
 include/linux/vmalloc.h                         |   73 +-
 include/linux/vmstat.h                          |   24 
 include/net/page_pool.h                         |    2 
 include/trace/events/kmem.h                     |   24 
 init/main.c                                     |    2 
 kernel/cgroup/cgroup.c                          |   34 -
 kernel/cgroup/rstat.c                           |   61 +
 kernel/dma/remap.c                              |    1 
 kernel/fork.c                                   |   13 
 kernel/irq_work.c                               |    7 
 kernel/task_work.c                              |    3 
 kernel/watchdog.c                               |  102 +--
 lib/Kconfig.debug                               |   14 
 lib/Makefile                                    |    1 
 lib/test_kasan.c                                |   59 -
 lib/test_slub.c                                 |  124 +++
 lib/test_vmalloc.c                              |  128 +--
 mm/Kconfig                                      |    4 
 mm/Makefile                                     |    1 
 mm/debug_vm_pgtable.c                           |    4 
 mm/dmapool.c                                    |    2 
 mm/filemap.c                                    |   61 +
 mm/gup.c                                        |  145 +++-
 mm/hugetlb.c                                    |    2 
 mm/internal.h                                   |   25 
 mm/interval_tree.c                              |    2 
 mm/io-mapping.c                                 |   29 
 mm/ioremap.c                                    |  361 ++--------
 mm/kasan/common.c                               |   53 -
 mm/kasan/generic.c                              |   12 
 mm/kasan/kasan.h                                |   28 
 mm/kasan/report_generic.c                       |    2 
 mm/kasan/shadow.c                               |   10 
 mm/kasan/sw_tags.c                              |   12 
 mm/kmemleak.c                                   |    2 
 mm/memcontrol.c                                 |  798 ++++++++++++------------
 mm/memory-failure.c                             |    2 
 mm/memory.c                                     |  191 +++--
 mm/mempolicy.c                                  |   78 --
 mm/mempool.c                                    |    4 
 mm/memremap.c                                   |    2 
 mm/migrate.c                                    |    2 
 mm/mm_init.c                                    |    4 
 mm/mmap.c                                       |    6 
 mm/mremap.c                                     |    6 
 mm/msync.c                                      |    6 
 mm/page-writeback.c                             |    9 
 mm/page_alloc.c                                 |  430 +++++++++---
 mm/page_counter.c                               |    8 
 mm/page_owner.c                                 |   68 --
 mm/page_poison.c                                |    6 
 mm/percpu-vm.c                                  |    7 
 mm/slab.c                                       |   43 -
 mm/slab.h                                       |   24 
 mm/slab_common.c                                |   10 
 mm/slub.c                                       |  215 ++----
 mm/sparse.c                                     |    1 
 mm/swap_state.c                                 |   13 
 mm/util.c                                       |   10 
 mm/vmalloc.c                                    |  728 ++++++++++++++++-----
 net/core/page_pool.c                            |  127 ++-
 net/sunrpc/svc_xprt.c                           |   38 -
 samples/kfifo/bytestream-example.c              |    8 
 samples/kfifo/inttype-example.c                 |    8 
 samples/kfifo/record-example.c                  |    8 
 samples/vfio-mdev/mdpy.c                        |    4 
 scripts/checkdeclares.pl                        |   53 +
 scripts/spelling.txt                            |   26 
 tools/testing/selftests/cgroup/test_kmem.c      |   22 
 tools/testing/selftests/vm/mremap_dontunmap.c   |   52 +
 tools/testing/selftests/vm/test_vmalloc.sh      |   21 
 189 files changed, 3642 insertions(+), 3013 deletions(-)

incoming

[Andrew Morton]

5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966.

Subsystems affected by this patch series:

  coda
  overlayfs
  mm/pagecache
  mm/memcg

Subsystem: coda

    Christian König <christian.koenig@amd.com>:
      coda: fix reference counting in coda_file_mmap error path

Subsystem: overlayfs

    Christian König <christian.koenig@amd.com>:
      ovl: fix reference counting in ovl_mmap error path

Subsystem: mm/pagecache

    Hugh Dickins <hughd@google.com>:
      mm/filemap: fix find_lock_entries hang on 32-bit THP
      mm/filemap: fix mapping_seek_hole_data on THP & 32-bit

Subsystem: mm/memcg

    Vasily Averin <vvs@virtuozzo.com>:
      tools/cgroup/slabinfo.py: updated to work on current kernel

 fs/coda/file.c                 |    6 +++---
 fs/overlayfs/file.c            |   11 +----------
 mm/filemap.c                   |   31 +++++++++++++++++++------------
 tools/cgroup/memcg_slabinfo.py |    8 ++++----
 4 files changed, 27 insertions(+), 29 deletions(-)

incoming

[Andrew Morton]

12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7.

Subsystems affected by this patch series:

  mm/documentation
  mm/kasan
  csky
  ia64
  mm/pagemap
  gcov
  lib

Subsystem: mm/documentation

    Randy Dunlap <rdunlap@infradead.org>:
      mm: eliminate "expecting prototype" kernel-doc warnings

Subsystem: mm/kasan

    Arnd Bergmann <arnd@arndb.de>:
      kasan: fix hwasan build for gcc

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: csky

    Randy Dunlap <rdunlap@infradead.org>:
      csky: change a Kconfig symbol name to fix e1000 build error

Subsystem: ia64

    Randy Dunlap <rdunlap@infradead.org>:
      ia64: remove duplicate entries in generic_defconfig
      ia64: fix discontig.c section mismatches

    John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>:
      ia64: tools: remove inclusion of ia64-specific version of errno.h header

    John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>:
      ia64: tools: remove duplicate definition of ia64_mf() on ia64

Subsystem: mm/pagemap

    Zack Rusin <zackr@vmware.com>:
      mm/mapping_dirty_helpers: guard hugepage pud's usage

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      mm: ptdump: fix build failure

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      gcov: clang: fix clang-11+ build

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: remove "expecting prototype" kernel-doc warnings

 arch/arm64/kernel/sleep.S             |    2 +-
 arch/csky/Kconfig                     |    2 +-
 arch/csky/include/asm/page.h          |    2 +-
 arch/ia64/configs/generic_defconfig   |    2 --
 arch/ia64/mm/discontig.c              |    6 +++---
 arch/x86/kernel/acpi/wakeup_64.S      |    2 +-
 include/linux/kasan.h                 |    2 +-
 kernel/gcov/clang.c                   |    2 +-
 lib/Kconfig.kasan                     |    9 ++-------
 lib/earlycpio.c                       |    4 ++--
 lib/lru_cache.c                       |    3 ++-
 lib/parman.c                          |    4 ++--
 lib/radix-tree.c                      |   11 ++++++-----
 mm/kasan/common.c                     |    2 +-
 mm/kasan/kasan.h                      |    2 +-
 mm/kasan/report_generic.c             |    2 +-
 mm/mapping_dirty_helpers.c            |    2 ++
 mm/mmu_gather.c                       |   29 +++++++++++++++++++----------
 mm/oom_kill.c                         |    2 +-
 mm/ptdump.c                           |    2 +-
 mm/shuffle.c                          |    4 ++--
 scripts/Makefile.kasan                |   22 ++++++++++++++--------
 security/Kconfig.hardening            |    4 ++--
 tools/arch/ia64/include/asm/barrier.h |    3 ---
 tools/include/uapi/asm/errno.h        |    2 --
 25 files changed, 67 insertions(+), 60 deletions(-)

incoming

[Andrew Morton]

16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9.

Subsystems affected by this patch series:

  MAINTAINERS
  mailmap
  mm/kasan
  mm/gup
  nds32
  gcov
  ocfs2
  ia64
  mm/pagecache
  mm/kasan
  mm/kfence
  lib

Subsystem: MAINTAINERS

    Marek Behún <kabel@kernel.org>:
      MAINTAINERS: update CZ.NIC's Turris information
      treewide: change my e-mail address, fix my name

Subsystem: mailmap

    Jordan Crouse <jordan@cosmicpenguin.net>:
      mailmap: update email address for Jordan Crouse

    Matthew Wilcox <willy@infradead.org>:
      .mailmap: fix old email addresses

Subsystem: mm/kasan

    Arnd Bergmann <arnd@arndb.de>:
      kasan: fix hwasan build for gcc

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: mm/gup

    Aili Yao <yaoaili@kingsoft.com>:
      mm/gup: check page posion status for coredump.

Subsystem: nds32

    Mike Rapoport <rppt@linux.ibm.com>:
      nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: re-fix clang-11+ support

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: fix deadlock between setattr and dio_end_io_write

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix user_stack_pointer() for ptrace()

Subsystem: mm/pagecache

    Jack Qiu <jack.qiu@huawei.com>:
      fs: direct-io: fix missing sdio->boundary

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix conflict with page poisoning

    Andrew Morton <akpm@linux-foundation.org>:
      lib/test_kasan_module.c: suppress unused var warning

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence, x86: fix preemptible warning on KPTI-enabled systems

Subsystem: lib

    Julian Braha <julianbraha@gmail.com>:
      lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS

 .mailmap                                                            |    7 ++
 Documentation/ABI/testing/debugfs-moxtet                            |    4 -
 Documentation/ABI/testing/debugfs-turris-mox-rwtm                   |    2 
 Documentation/ABI/testing/sysfs-bus-moxtet-devices                  |    6 +-
 Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia       |    2 
 Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm            |   10 +--
 Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml |    2 
 MAINTAINERS                                                         |   13 +++-
 arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts              |    2 
 arch/arm64/kernel/sleep.S                                           |    2 
 arch/ia64/include/asm/ptrace.h                                      |    8 --
 arch/nds32/mm/cacheflush.c                                          |    2 
 arch/x86/include/asm/kfence.h                                       |    7 ++
 arch/x86/kernel/acpi/wakeup_64.S                                    |    2 
 drivers/bus/moxtet.c                                                |    4 -
 drivers/firmware/turris-mox-rwtm.c                                  |    4 -
 drivers/gpio/gpio-moxtet.c                                          |    4 -
 drivers/leds/leds-turris-omnia.c                                    |    4 -
 drivers/mailbox/armada-37xx-rwtm-mailbox.c                          |    4 -
 drivers/watchdog/armada_37xx_wdt.c                                  |    4 -
 fs/direct-io.c                                                      |    5 +
 fs/ocfs2/aops.c                                                     |   11 ---
 fs/ocfs2/file.c                                                     |    8 ++
 include/dt-bindings/bus/moxtet.h                                    |    2 
 include/linux/armada-37xx-rwtm-mailbox.h                            |    2 
 include/linux/kasan.h                                               |    2 
 include/linux/moxtet.h                                              |    2 
 kernel/gcov/clang.c                                                 |   29 ++++++----
 lib/Kconfig.debug                                                   |    6 +-
 lib/Kconfig.kasan                                                   |    9 ---
 lib/test_kasan_module.c                                             |    2 
 mm/gup.c                                                            |    4 +
 mm/internal.h                                                       |   20 ++++++
 mm/kasan/common.c                                                   |    2 
 mm/kasan/kasan.h                                                    |    2 
 mm/kasan/report_generic.c                                           |    2 
 mm/page_poison.c                                                    |    4 +
 scripts/Makefile.kasan                                              |   18 ++++--
 security/Kconfig.hardening                                          |    4 -
 39 files changed, 136 insertions(+), 91 deletions(-)

incoming

[Andrew Morton]

14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/kasan
  mm/gup
  mm/selftests
  mm/z3fold
  squashfs
  ia64
  gcov
  mm/kfence
  mm/memblock
  mm/highmem
  mailmap

Subsystem: mm/hugetlb

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix per-page tags for non-page_alloc pages

Subsystem: mm/gup

    Sean Christopherson <seanjc@google.com>:
      mm/mmu_notifiers: ensure range_end() is paired with range_start()

Subsystem: mm/selftests

    Rong Chen <rong.a.chen@intel.com>:
      selftests/vm: fix out-of-tree build

Subsystem: mm/z3fold

    Thomas Hebb <tommyhebb@gmail.com>:
      z3fold: prevent reclaim/free race for headless pages

Subsystem: squashfs

    Sean Nyekjaer <sean@geanix.com>:
      squashfs: fix inode lookup sanity checks

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: fix xattr id and id lookup sanity checks

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: mca: allocate early mca with GFP_ATOMIC
      ia64: fix format strings for err_inject

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: fix clang-11+ support

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: make compatible with kmemleak

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
      mm: memblock: fix section mismatch warning again

Subsystem: mm/highmem

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP

Subsystem: mailmap

    Andrey Konovalov <andreyknvl@google.com>:
      mailmap: update Andrey Konovalov's email address

 .mailmap                            |    1 
 arch/ia64/kernel/err_inject.c       |   22 +++++------
 arch/ia64/kernel/mca.c              |    2 -
 fs/squashfs/export.c                |    8 +++-
 fs/squashfs/id.c                    |    6 ++-
 fs/squashfs/squashfs_fs.h           |    1 
 fs/squashfs/xattr_id.c              |    6 ++-
 include/linux/hugetlb_cgroup.h      |   15 ++++++-
 include/linux/memblock.h            |    4 +-
 include/linux/mm.h                  |   18 +++++++--
 include/linux/mmu_notifier.h        |   10 ++---
 kernel/gcov/clang.c                 |   69 ++++++++++++++++++++++++++++++++++++
 mm/highmem.c                        |    4 +-
 mm/hugetlb.c                        |   41 +++++++++++++++++++--
 mm/hugetlb_cgroup.c                 |   10 ++++-
 mm/kfence/core.c                    |    9 ++++
 mm/kmemleak.c                       |    3 +
 mm/mmu_notifier.c                   |   23 ++++++++++++
 mm/z3fold.c                         |   16 +++++++-
 tools/testing/selftests/vm/Makefile |    4 +-
 20 files changed, 230 insertions(+), 42 deletions(-)

incoming

[Andrew Morton]

29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50.

Subsystems affected by this patch series:

  mm/memblock
  core-kernel
  kconfig
  mm/pagealloc
  fork
  mm/hugetlb
  mm/highmem
  binfmt
  MAINTAINERS
  kbuild
  mm/kfence
  mm/oom-kill
  mm/madvise
  mm/kasan
  mm/userfaultfd
  mm/memory-failure
  ia64
  mm/memcg
  mm/zram

Subsystem: mm/memblock

    Arnd Bergmann <arnd@arndb.de>:
      memblock: fix section mismatch warning

Subsystem: core-kernel

    Arnd Bergmann <arnd@arndb.de>:
      stop_machine: mark helpers __always_inline

Subsystem: kconfig

    Masahiro Yamada <masahiroy@kernel.org>:
      init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
      mm/page_alloc.c: refactor initialization of struct page for holes in memory layout

Subsystem: fork

    Fenghua Yu <fenghua.yu@intel.com>:
      mm/fork: clear PASID for new mm

Subsystem: mm/hugetlb

    Peter Xu <peterx@redhat.com>:
    Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5:
      hugetlb: dedup the code to add a new file_region
      hugetlb: break earlier in add_reservation_in_range() when we can
      mm: introduce page_needs_cow_for_dma() for deciding whether cow
      mm: use is_cow_mapping() across tree where proper
      hugetlb: do early cow when page pinned on src mm

Subsystem: mm/highmem

    OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
      mm/highmem.c: fix zero_user_segments() with start > end

Subsystem: binfmt

    Lior Ribak <liorribak@gmail.com>:
      binfmt_misc: fix possible deadlock in bm_register_write

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: exclude uapi directories in API/ABI section

Subsystem: kbuild

    Arnd Bergmann <arnd@arndb.de>:
      linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP*

Subsystem: mm/kfence

    Marco Elver <elver@google.com>:
      kfence: fix printk format for ptrdiff_t
      kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations
      kfence: fix reports if constant function prefixes exist

Subsystem: mm/oom-kill

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      include/linux/sched/mm.h: use rcu_dereference in in_vfork()

Subsystem: mm/madvise

    Suren Baghdasaryan <surenb@google.com>:
      mm/madvise: replace ptrace attach requirement for process_madvise

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC
      kasan: fix KASAN_STACK dependency for HW_TAGS

Subsystem: mm/userfaultfd

    Nadav Amit <namit@vmware.com>:
      mm/userfaultfd: fix memory corruption due to writeprotect

Subsystem: mm/memory-failure

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm, hwpoison: do not lock page again when me_huge_page() successfully recovers

Subsystem: ia64

    Sergei Trofimovich <slyfox@gentoo.org>:
      ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls
      ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign

Subsystem: mm/memcg

    Zhou Guanghui <zhouguanghui1@huawei.com>:
      mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument
      mm/memcg: set memcg when splitting page

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      zram: fix return value on writeback_store
      zram: fix broken page writeback

 MAINTAINERS                                |    4 
 arch/ia64/include/asm/syscall.h            |    2 
 arch/ia64/kernel/ptrace.c                  |   24 +++-
 drivers/block/zram/zram_drv.c              |   17 +-
 drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c |    4 
 drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c   |    2 
 fs/binfmt_misc.c                           |   29 ++---
 fs/proc/task_mmu.c                         |    2 
 include/linux/compiler-clang.h             |    6 +
 include/linux/memblock.h                   |    4 
 include/linux/memcontrol.h                 |    6 -
 include/linux/mm.h                         |   21 +++
 include/linux/mm_types.h                   |    1 
 include/linux/sched/mm.h                   |    3 
 include/linux/stop_machine.h               |   11 +
 init/Kconfig                               |    3 
 kernel/fork.c                              |    8 +
 lib/Kconfig.kasan                          |    1 
 mm/highmem.c                               |   17 ++
 mm/huge_memory.c                           |   10 -
 mm/hugetlb.c                               |  123 +++++++++++++++------
 mm/internal.h                              |    5 
 mm/kfence/report.c                         |   30 +++--
 mm/madvise.c                               |   13 ++
 mm/memcontrol.c                            |   15 +-
 mm/memory-failure.c                        |    4 
 mm/memory.c                                |   16 +-
 mm/page_alloc.c                            |  167 ++++++++++++++---------------
 mm/slab.c                                  |    2 
 29 files changed, 334 insertions(+), 216 deletions(-)

Re: incoming

[Andrew Morton]

On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - The rest of MM.
> >
> >   Includes kfence - another runtime memory validator.  Not as
> >   thorough as KASAN, but it has unmeasurable overhead and is intended
> >   to be usable in production builds.
> >
> > - Everything else
> 
> Just to clarify: you have nothing else really pending?

Yes, that's it from me for -rc1.

Re: incoming

[Linus Torvalds]

On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - The rest of MM.
>
>   Includes kfence - another runtime memory validator.  Not as
>   thorough as KASAN, but it has unmeasurable overhead and is intended
>   to be usable in production builds.
>
> - Everything else

Just to clarify: you have nothing else really pending?

I'm hoping to just do -rc1 this weekend after all - despite my late
start due to loss of power for several days.

I'll allow late stragglers with good reason through, but the fewer of
those there are, the better, of course.

Thanks,
                   Linus

incoming

[Andrew Morton]

- The rest of MM.

  Includes kfence - another runtime memory validator.  Not as
  thorough as KASAN, but it has unmeasurable overhead and is intended
  to be usable in production builds.

- Everything else


118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab.

Subsystems affected by this patch series:

  mm/thp
  mm/cma
  mm/vmstat
  mm/memory-hotplug
  mm/mlock
  mm/rmap
  mm/zswap
  mm/zsmalloc
  mm/cleanups
  mm/kfence
  mm/kasan2
  alpha
  procfs
  sysctl
  misc
  core-kernel
  MAINTAINERS
  lib
  bitops
  checkpatch
  init
  coredump
  seq_file
  gdb
  ubsan
  initramfs
  mm/pagemap2

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Overhaul multi-page lookups for THP", v4:
      mm: make pagecache tagged lookups return only head pages
      mm/shmem: use pagevec_lookup in shmem_unlock_mapping
      mm/swap: optimise get_shadow_from_swap_cache
      mm: add FGP_ENTRY
      mm/filemap: rename find_get_entry to mapping_get_entry
      mm/filemap: add helper for finding pages
      mm/filemap: add mapping_seek_hole_data
      iomap: use mapping_seek_hole_data
      mm: add and use find_lock_entries
      mm: add an 'end' parameter to find_get_entries
      mm: add an 'end' parameter to pagevec_lookup_entries
      mm: remove nr_entries parameter from pagevec_lookup_entries
      mm: pass pvec directly to find_get_entries
      mm: remove pagevec_lookup_entries

    Rik van Riel <riel@surriel.com>:
    Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6:
      mm,thp,shmem: limit shmem THP alloc gfp_mask
      mm,thp,shm: limit gfp mask to no more than specified
      mm,thp,shmem: make khugepaged obey tmpfs mount flags
      mm,shmem,thp: limit shmem THP allocations to requested zones

Subsystem: mm/cma

    Roman Gushchin <guro@fb.com>:
      mm: cma: allocate cma areas bottom-up

    David Hildenbrand <david@redhat.com>:
      mm/cma: expose all pages to the buddy if activation of an area fails
      mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo

    Patrick Daly <pdaly@codeaurora.org>:
      mm: cma: print region name on failure

Subsystem: mm/vmstat

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: vmstat: fix NOHZ wakeups for node stat changes
      mm: vmstat: add some comments on internal storage of byte items

    Jiang Biao <benbjiang@tencent.com>:
      mm/vmstat.c: erase latency in vmstat_shepherd

Subsystem: mm/memory-hotplug

    Dan Williams <dan.j.williams@intel.com>:
    Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4:
      mm: move pfn_to_online_page() out of line
      mm: teach pfn_to_online_page() to consider subsection validity
      mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions
      mm: fix memory_failure() handling of dax-namespace metadata

    Anshuman Khandual <anshuman.khandual@arm.com>:
      mm/memory_hotplug: rename all existing 'memhp' into 'mhp'

    David Hildenbrand <david@redhat.com>:
      mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn

    David Hildenbrand <david@redhat.com>:
      drivers/base/memory: don't store phys_device in memory blocks
      Documentation: sysfs/memory: clarify some memory block device properties

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5:
      mm/memory_hotplug: prevalidate the address range being added with platform
      arm64/mm: define arch_get_mappable_range()
      s390/mm: define arch_get_mappable_range()

    David Hildenbrand <david@redhat.com>:
      virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug

Subsystem: mm/mlock

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mlock: stop counting mlocked pages when none vma is found

Subsystem: mm/rmap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/rmap: correct some obsolete comments of anon_vma
      mm/rmap: remove unneeded semicolon in page_not_mapped()
      mm/rmap: fix obsolete comment in __page_check_anon_rmap()
      mm/rmap: use page_not_mapped in try_to_unmap()
      mm/rmap: correct obsolete comment of page_get_anon_vma()
      mm/rmap: fix potential pte_unmap on an not mapped pte

Subsystem: mm/zswap

    Randy Dunlap <rdunlap@infradead.org>:
      mm: zswap: clean up confusing comment

    Tian Tao <tiantao6@hisilicon.com>:
    Patch series "Fix the compatibility of zsmalloc and zswap":
      mm/zswap: add the flag can_sleep_mapped
      mm: set the sleep_mapped to true for zbud and z3fold

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage()

    Rokudo Yan <wu-yan@tcl.com>:
      zsmalloc: account the number of compacted pages correctly

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: use page_private() to access page->private

Subsystem: mm/cleanups

    Guo Ren <guoren@linux.alibaba.com>:
      mm: page-flags.h: Typo fix (It -> If)

    Daniel Vetter <daniel.vetter@ffwll.ch>:
      mm/dmapool: use might_alloc()
      mm/backing-dev.c: use might_alloc()

    Stephen Zhang <stephenzhangzsd@gmail.com>:
      mm/early_ioremap.c: use __func__ instead of function name

Subsystem: mm/kfence

    Alexander Potapenko <glider@google.com>:
    Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7:
      mm: add Kernel Electric-Fence infrastructure
      x86, kfence: enable KFENCE for x86

    Marco Elver <elver@google.com>:
      arm64, kfence: enable KFENCE for ARM64
      kfence: use pt_regs to generate stack trace on faults

    Alexander Potapenko <glider@google.com>:
      mm, kfence: insert KFENCE hooks for SLAB
      mm, kfence: insert KFENCE hooks for SLUB
      kfence, kasan: make KFENCE compatible with KASAN

    Marco Elver <elver@google.com>:
      kfence, Documentation: add KFENCE documentation
      kfence: add test suite
      MAINTAINERS: add entry for KFENCE
      kfence: report sensitive information based on no_hash_pointers

    Alexander Potapenko <glider@google.com>:
    Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3:
      tracing: add error_report_end trace point
      kfence: use error_report_end tracepoint
      kasan: use error_report_end tracepoint

Subsystem: mm/kasan2

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: optimizations and fixes for HW_TAGS", v4:
      kasan, mm: don't save alloc stacks twice
      kasan, mm: optimize kmalloc poisoning
      kasan: optimize large kmalloc poisoning
      kasan: clean up setting free info in kasan_slab_free
      kasan: unify large kfree checks
      kasan: rework krealloc tests
      kasan, mm: fail krealloc on freed objects
      kasan, mm: optimize krealloc poisoning
      kasan: ensure poisoning size alignment
      arm64: kasan: simplify and inline MTE functions
      kasan: inline HW_TAGS helper functions
      kasan: clarify that only first bug is reported in HW_TAGS

Subsystem: alpha

    Randy Dunlap <rdunlap@infradead.org>:
      alpha: remove CONFIG_EXPERIMENTAL from defconfigs

Subsystem: procfs

    Helge Deller <deller@gmx.de>:
      proc/wchan: use printk format instead of lookup_symbol_name()

    Josef Bacik <josef@toxicpanda.com>:
      proc: use kvzalloc for our kernel buffer

Subsystem: sysctl

    Lin Feng <linf@wangsu.com>:
      sysctl.c: fix underflow value setting risk in vm_table

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      include/linux: remove repeated words

    Miguel Ojeda <ojeda@kernel.org>:
      treewide: Miguel has moved

Subsystem: core-kernel

    Hubert Jasudowicz <hubert.jasudowicz@gmail.com>:
      groups: use flexible-array member in struct group_info
      groups: simplify struct group_info allocation

    Randy Dunlap <rdunlap@infradead.org>:
      kernel: delete repeated words in comments

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: add uapi directories to API/ABI section

Subsystem: lib

    Huang Shijie <sjhuang@iluvatar.ai>:
      lib/genalloc.c: change return type to unsigned long for bitmap_set_ll

    Francis Laniel <laniel_francis@privacyrequired.com>:
      string.h: move fortified functions definitions in a dedicated header.

    Yogesh Lal <ylal@codeaurora.org>:
      lib: stackdepot: add support to configure STACK_HASH_SIZE

    Vijayanand Jitta <vjitta@codeaurora.org>:
      lib: stackdepot: add support to disable stack depot
      lib: stackdepot: fix ignoring return value warning

    Masahiro Yamada <masahiroy@kernel.org>:
      lib/cmdline: remove an unneeded local variable in next_arg()

Subsystem: bitops

    Geert Uytterhoeven <geert+renesas@glider.be>:
      include/linux/bitops.h: spelling s/synomyn/synonym/

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: improve blank line after declaration test

    Peng Wang <rocking@linux.alibaba.com>:
      checkpatch: ignore warning designated initializers using NR_CPUS

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: trivial style fixes

    Joe Perches <joe@perches.com>:
      checkpatch: prefer ftrace over function entry/exit printks
      checkpatch: improve TYPECAST_INT_CONSTANT test message

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add warning for avoiding .L prefix symbols in assembly files

    Joe Perches <joe@perches.com>:
      checkpatch: add kmalloc_array_node to unnecessary OOM message check

    Chris Down <chris@chrisdown.name>:
      checkpatch: don't warn about colon termination in linker scripts

    Song Liu <songliubraving@fb.com>:
      checkpatch: do not apply "initialise globals to 0" check to BPF progs

Subsystem: init

    Masahiro Yamada <masahiroy@kernel.org>:
      init/version.c: remove Version_<LINUX_VERSION_CODE> symbol
      init: clean up early_param_on_off() macro

    Bhaskar Chowdhury <unixbhaskar@gmail.com>:
      init/Kconfig: fix a typo in CC_VERSION_TEXT help text

Subsystem: coredump

    Ira Weiny <ira.weiny@intel.com>:
      fs/coredump: use kmap_local_page()

Subsystem: seq_file

    NeilBrown <neilb@suse.de>:
    Patch series "Fix some seq_file users that were recently broken":
      seq_file: document how per-entry resources are managed.
      x86: fix seq_file iteration for pat/memtype.c

Subsystem: gdb

    George Prekas <prekageo@amazon.com>:
      scripts/gdb: fix list_for_each

    Sumit Garg <sumit.garg@linaro.org>:
      kgdb: fix to kill breakpoints on initmem after boot

Subsystem: ubsan

    Andrey Ryabinin <ryabinin.a.a@gmail.com>:
      ubsan: remove overflow checks

Subsystem: initramfs

    Florian Fainelli <f.fainelli@gmail.com>:
      initramfs: panic with memory information

Subsystem: mm/pagemap2

    Huang Pei <huangpei@loongson.cn>:
      MIPS: make userspace mapping young by default

 .mailmap                                            |    1 
 CREDITS                                             |    9 
 Documentation/ABI/testing/sysfs-devices-memory      |   58 -
 Documentation/admin-guide/auxdisplay/cfag12864b.rst |    2 
 Documentation/admin-guide/auxdisplay/ks0108.rst     |    2 
 Documentation/admin-guide/kernel-parameters.txt     |    6 
 Documentation/admin-guide/mm/memory-hotplug.rst     |   20 
 Documentation/dev-tools/index.rst                   |    1 
 Documentation/dev-tools/kasan.rst                   |    8 
 Documentation/dev-tools/kfence.rst                  |  318 +++++++
 Documentation/filesystems/seq_file.rst              |    6 
 MAINTAINERS                                         |   26 
 arch/alpha/configs/defconfig                        |    1 
 arch/arm64/Kconfig                                  |    1 
 arch/arm64/include/asm/cache.h                      |    1 
 arch/arm64/include/asm/kasan.h                      |    1 
 arch/arm64/include/asm/kfence.h                     |   26 
 arch/arm64/include/asm/mte-def.h                    |    2 
 arch/arm64/include/asm/mte-kasan.h                  |   65 +
 arch/arm64/include/asm/mte.h                        |    2 
 arch/arm64/kernel/mte.c                             |   46 -
 arch/arm64/lib/mte.S                                |   16 
 arch/arm64/mm/fault.c                               |    8 
 arch/arm64/mm/mmu.c                                 |   23 
 arch/mips/mm/cache.c                                |   30 
 arch/s390/mm/init.c                                 |    1 
 arch/s390/mm/vmem.c                                 |   14 
 arch/x86/Kconfig                                    |    1 
 arch/x86/include/asm/kfence.h                       |   76 +
 arch/x86/mm/fault.c                                 |   10 
 arch/x86/mm/pat/memtype.c                           |    4 
 drivers/auxdisplay/cfag12864b.c                     |    4 
 drivers/auxdisplay/cfag12864bfb.c                   |    4 
 drivers/auxdisplay/ks0108.c                         |    4 
 drivers/base/memory.c                               |   35 
 drivers/block/zram/zram_drv.c                       |    2 
 drivers/hv/hv_balloon.c                             |    2 
 drivers/virtio/virtio_mem.c                         |   43 
 drivers/xen/balloon.c                               |    2 
 fs/coredump.c                                       |    4 
 fs/iomap/seek.c                                     |  125 --
 fs/proc/base.c                                      |   21 
 fs/proc/proc_sysctl.c                               |    4 
 include/linux/bitops.h                              |    2 
 include/linux/cfag12864b.h                          |    2 
 include/linux/cred.h                                |    2 
 include/linux/fortify-string.h                      |  302 ++++++
 include/linux/gfp.h                                 |    2 
 include/linux/init.h                                |    4 
 include/linux/kasan.h                               |   25 
 include/linux/kfence.h                              |  230 +++++
 include/linux/kgdb.h                                |    2 
 include/linux/khugepaged.h                          |    2 
 include/linux/ks0108.h                              |    2 
 include/linux/mdev.h                                |    2 
 include/linux/memory.h                              |    3 
 include/linux/memory_hotplug.h                      |   33 
 include/linux/memremap.h                            |    6 
 include/linux/mmzone.h                              |   49 -
 include/linux/page-flags.h                          |    4 
 include/linux/pagemap.h                             |   10 
 include/linux/pagevec.h                             |   10 
 include/linux/pgtable.h                             |    8 
 include/linux/ptrace.h                              |    2 
 include/linux/rmap.h                                |    3 
 include/linux/slab_def.h                            |    3 
 include/linux/slub_def.h                            |    3 
 include/linux/stackdepot.h                          |    9 
 include/linux/string.h                              |  282 ------
 include/linux/vmstat.h                              |    6 
 include/linux/zpool.h                               |    3 
 include/linux/zsmalloc.h                            |    2 
 include/trace/events/error_report.h                 |   74 +
 include/uapi/linux/firewire-cdev.h                  |    2 
 include/uapi/linux/input.h                          |    2 
 init/Kconfig                                        |    2 
 init/initramfs.c                                    |   19 
 init/main.c                                         |    6 
 init/version.c                                      |    8 
 kernel/debug/debug_core.c                           |   11 
 kernel/events/core.c                                |    8 
 kernel/events/uprobes.c                             |    2 
 kernel/groups.c                                     |    7 
 kernel/locking/rtmutex.c                            |    4 
 kernel/locking/rwsem.c                              |    2 
 kernel/locking/semaphore.c                          |    2 
 kernel/sched/fair.c                                 |    2 
 kernel/sched/membarrier.c                           |    2 
 kernel/sysctl.c                                     |    8 
 kernel/trace/Makefile                               |    1 
 kernel/trace/error_report-traces.c                  |   12 
 lib/Kconfig                                         |    9 
 lib/Kconfig.debug                                   |    1 
 lib/Kconfig.kfence                                  |   84 +
 lib/Kconfig.ubsan                                   |   17 
 lib/cmdline.c                                       |    7 
 lib/genalloc.c                                      |    3 
 lib/stackdepot.c                                    |   41 
 lib/test_kasan.c                                    |  111 ++
 lib/test_ubsan.c                                    |   49 -
 lib/ubsan.c                                         |   68 -
 mm/Makefile                                         |    1 
 mm/backing-dev.c                                    |    3 
 mm/cma.c                                            |   64 -
 mm/dmapool.c                                        |    3 
 mm/early_ioremap.c                                  |   12 
 mm/filemap.c                                        |  361 +++++---
 mm/huge_memory.c                                    |    6 
 mm/internal.h                                       |    6 
 mm/kasan/common.c                                   |  213 +++-
 mm/kasan/generic.c                                  |    3 
 mm/kasan/hw_tags.c                                  |    2 
 mm/kasan/kasan.h                                    |   97 +-
 mm/kasan/report.c                                   |    8 
 mm/kasan/shadow.c                                   |   78 +
 mm/kfence/Makefile                                  |    6 
 mm/kfence/core.c                                    |  875 +++++++++++++++++++-
 mm/kfence/kfence.h                                  |  126 ++
 mm/kfence/kfence_test.c                             |  860 +++++++++++++++++++
 mm/kfence/report.c                                  |  350 ++++++--
 mm/khugepaged.c                                     |   22 
 mm/memory-failure.c                                 |    6 
 mm/memory.c                                         |    4 
 mm/memory_hotplug.c                                 |  178 +++-
 mm/memremap.c                                       |   23 
 mm/mlock.c                                          |    2 
 mm/page_alloc.c                                     |    1 
 mm/rmap.c                                           |   24 
 mm/shmem.c                                          |  160 +--
 mm/slab.c                                           |   38 
 mm/slab_common.c                                    |   29 
 mm/slub.c                                           |   63 +
 mm/swap.c                                           |   54 -
 mm/swap_state.c                                     |    7 
 mm/truncate.c                                       |  141 ---
 mm/vmstat.c                                         |   35 
 mm/z3fold.c                                         |    1 
 mm/zbud.c                                           |    1 
 mm/zpool.c                                          |   13 
 mm/zsmalloc.c                                       |   22 
 mm/zswap.c                                          |   57 +
 samples/auxdisplay/cfag12864b-example.c             |    2 
 scripts/Makefile.ubsan                              |    2 
 scripts/checkpatch.pl                               |  152 ++-
 scripts/gdb/linux/lists.py                          |    5 
 145 files changed, 5046 insertions(+), 1682 deletions(-)

Re: incoming

[Walter Wu]

Hi Andrey,

On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote:
> On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > > <torvalds@linux-foundation.org> wrote:
> > > >
> > > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > > the KASAN patches. With this all applied, I get:
> > > >
> > > >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > and
> > > >
> > > >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > > larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > > cause issues.
> > >
> > > A quick bisect shoes that this was introduced by "[patch 101/173]
> > > kasan: remove redundant config option".
> > >
> > > I didn't check what part of that patch screws up, but it's definitely
> > > doing something bad.
> >
> > I'm not sure why that patch surfaced the bug, but it's worth pointing
> > out that the underlying problem is asan-stack in combination
> > with the structleak plugin. This will happen for every user of kunit.
> >
> 
> The patch didn't update KASAN_STACK dependency in kconfig:
>         config GCC_PLUGIN_STRUCTLEAK_BYREF
> ....
>                depends on !(KASAN && KASAN_STACK=1)
> 
> This 'depends on'  stopped working with the patch

Thanks for pointing out this problem. I will re-send that patch.


Walter

Re: incoming

[Andrey Ryabinin]

On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
>
> On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > the KASAN patches. With this all applied, I get:
> > >
> > >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > and
> > >
> > >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > cause issues.
> >
> > A quick bisect shoes that this was introduced by "[patch 101/173]
> > kasan: remove redundant config option".
> >
> > I didn't check what part of that patch screws up, but it's definitely
> > doing something bad.
>
> I'm not sure why that patch surfaced the bug, but it's worth pointing
> out that the underlying problem is asan-stack in combination
> with the structleak plugin. This will happen for every user of kunit.
>

The patch didn't update KASAN_STACK dependency in kconfig:
        config GCC_PLUGIN_STRUCTLEAK_BYREF
....
               depends on !(KASAN && KASAN_STACK=1)

This 'depends on'  stopped working with the patch

Re: incoming

[Arnd Bergmann]

On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I haven't bisected things yet, but I suspect it's something with
> > the KASAN patches. With this all applied, I get:
> >
> >   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> >   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> >
> > and
> >
> >   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> >   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > larger than 2048 bytes [-Wframe-larger-than=]
> >
> > which is obviously not really acceptable. A 11kB stack frame _will_
> > cause issues.
>
> A quick bisect shoes that this was introduced by "[patch 101/173]
> kasan: remove redundant config option".
>
> I didn't check what part of that patch screws up, but it's definitely
> doing something bad.

I'm not sure why that patch surfaced the bug, but it's worth pointing
out that the underlying problem is asan-stack in combination
with the structleak plugin. This will happen for every user of kunit.

I sent a series[1] out earlier this year to turn off the structleak
plugin as an alternative workaround, but need to follow up on
the remaining patches. Someone suggested adding a more
generic way to turn off the plugin for a file instead of open-coding
the CLFAGS_REMOVE_*.o Makefile bit, which would help.

I am also still hoping that someone can come up with a way
to make kunit work better with the structleak plugin, as there
shouldn't be a fundamental reason why it can't work, just that
it the code pattern triggers a particularly bad case in the compiler.

      Arnd

[1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/

Re: incoming

[Linus Torvalds]

On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Hmm. I haven't bisected things yet, but I suspect it's something with
> the KASAN patches. With this all applied, I get:
>
>   lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
>   lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
>
> and
>
>   lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
>   lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> larger than 2048 bytes [-Wframe-larger-than=]
>
> which is obviously not really acceptable. A 11kB stack frame _will_
> cause issues.

A quick bisect shoes that this was introduced by "[patch 101/173]
kasan: remove redundant config option".

I didn't check what part of that patch screws up, but it's definitely
doing something bad.

I will drop that patch.

               Linus

Re: incoming

[Linus Torvalds]

On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> A few small subsystems and some of MM.

Hmm. I haven't bisected things yet, but I suspect it's something with
the KASAN patches. With this all applied, I get:

  lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
  lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]

and

  lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
  lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
larger than 2048 bytes [-Wframe-larger-than=]

which is obviously not really acceptable. A 11kB stack frame _will_
cause issues.

              Linus

incoming

[Andrew Morton]

A few small subsystems and some of MM.


173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194.

Subsystems affected by this patch series:

  hexagon
  scripts
  ntfs
  ocfs2
  vfs
  mm/slab-generic
  mm/slab
  mm/slub
  mm/debug
  mm/pagecache
  mm/swap
  mm/memcg
  mm/pagemap
  mm/mprotect
  mm/mremap
  mm/page-reporting
  mm/vmalloc
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/compaction
  mm/mempolicy
  mm/oom-kill
  mm/hugetlbfs
  mm/migration

Subsystem: hexagon

    Randy Dunlap <rdunlap@infradead.org>:
      hexagon: remove CONFIG_EXPERIMENTAL from defconfigs

Subsystem: scripts

    tangchunyou <tangchunyou@yulong.com>:
      scripts/spelling.txt: increase error-prone spell checking

    zuoqilin <zuoqilin@yulong.com>:
      scripts/spelling.txt: check for "exeeds"

    dingsenjie <dingsenjie@yulong.com>:
      scripts/spelling.txt: add "allocted" and "exeeds" typo

    Colin Ian King <colin.king@canonical.com>:
      scripts/spelling.txt: add more spellings to spelling.txt

Subsystem: ntfs

    Randy Dunlap <rdunlap@infradead.org>:
      ntfs: layout.h: delete duplicated words

    Rustam Kovhaev <rkovhaev@gmail.com>:
      ntfs: check for valid standard information attribute

Subsystem: ocfs2

    Yi Li <yili@winhong.com>:
      ocfs2: remove redundant conditional before iput

    guozh <guozh88@chinatelecom.cn>:
      ocfs2: clean up some definitions which are not used any more

    Dan Carpenter <dan.carpenter@oracle.com>:
      ocfs2: fix a use after free on error

    Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
      ocfs2: simplify the calculation of variables

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      fs: delete repeated words in comments

    Alexey Dobriyan <adobriyan@gmail.com>:
      ramfs: support O_TMPFILE

Subsystem: mm/slab-generic

    Jacob Wen <jian.w.wen@oracle.com>:
      mm, tracing: record slab name for kmem_cache_free()

    Nikolay Borisov <nborisov@suse.com>:
      mm/sl?b.c: remove ctor argument from kmem_cache_flags

Subsystem: mm/slab

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/slab: minor coding style tweaks

Subsystem: mm/slub

    Johannes Berg <johannes.berg@intel.com>:
      mm/slub: disable user tracing for kmemleak caches by default

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "mm, slab, slub: remove cpu and memory hotplug locks":
      mm, slub: stop freeing kmem_cache_node structures on node offline
      mm, slab, slub: stop taking memory hotplug lock
      mm, slab, slub: stop taking cpu hotplug lock
      mm, slub: splice cpu and page freelists in deactivate_slab()
      mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/slub: minor coding style tweaks

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug: improve memcg debugging

    Anshuman Khandual <anshuman.khandual@arm.com>:
    Patch series "mm/debug_vm_pgtable: Some minor updates", v3:
      mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect
      mm/debug_vm_pgtable/basic: iterate over entire protection_map[]

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_owner: use helper function zone_end_pfn() to get end_pfn

Subsystem: mm/pagecache

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/filemap: remove unused parameter and change to void type for replace_page_cache_page()

    Pavel Begunkov <asml.silence@gmail.com>:
      mm/filemap: don't revert iter on -EIOCBQUEUED

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Refactor generic_file_buffered_read", v5:
      mm/filemap: rename generic_file_buffered_read subfunctions
      mm/filemap: remove dynamically allocated array from filemap_read
      mm/filemap: convert filemap_get_pages to take a pagevec
      mm/filemap: use head pages in generic_file_buffered_read
      mm/filemap: pass a sleep state to put_and_wait_on_page_locked
      mm/filemap: support readpage splitting a page
      mm/filemap: inline __wait_on_page_locked_async into caller
      mm/filemap: don't call ->readpage if IOCB_WAITQ is set
      mm/filemap: change filemap_read_page calling conventions
      mm/filemap: change filemap_create_page calling conventions
      mm/filemap: convert filemap_update_page to return an errno
      mm/filemap: move the iocb checks into filemap_update_page
      mm/filemap: add filemap_range_uptodate
      mm/filemap: split filemap_readahead out of filemap_get_pages
      mm/filemap: restructure filemap_get_pages
      mm/filemap: don't relock the page after calling readpage

    Christoph Hellwig <hch@lst.de>:
      mm/filemap: rename generic_file_buffered_read to filemap_read
      mm/filemap: simplify generic_file_read_iter

    Yang Guo <guoyang2@huawei.com>:
      fs/buffer.c: add checking buffer head stat before clear

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm: backing-dev: Remove duplicated macro definition

Subsystem: mm/swap

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      mm/swap_slots.c: remove redundant NULL check

    Stephen Zhang <stephenzhangzsd@gmail.com>:
      mm/swapfile.c: fix debugging information problem

    Georgi Djakov <georgi.djakov@linaro.org>:
      mm/page_io: use pr_alert_ratelimited for swap read/write errors

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      mm/swap_state: constify static struct attribute_group

    Yu Zhao <yuzhao@google.com>:
      mm/swap: don't SetPageWorkingset unconditionally during swapin

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: optimize per-lruvec stats counter memory usage
    Patch series "Convert all THP vmstat counters to pages", v6:
      mm: memcontrol: fix NR_ANON_THPS accounting in charge moving
      mm: memcontrol: convert NR_ANON_THPS account to pages
      mm: memcontrol: convert NR_FILE_THPS account to pages
      mm: memcontrol: convert NR_SHMEM_THPS account to pages
      mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages
      mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages
      mm: memcontrol: make the slab calculation consistent

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: revise the using condition of lock_page_lruvec function series
      mm/memcg: remove rcu locking for lock_page_lruvec function series

    Shakeel Butt <shakeelb@google.com>:
      mm: memcg: add swapcache stat for memcg v2

    Roman Gushchin <guro@fb.com>:
      mm: kmem: make __memcg_kmem_(un)charge static

    Feng Tang <feng.tang@intel.com>:
      mm: page_counter: re-layout structure to reduce false sharing

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      mm/memcontrol: remove redundant NULL check

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: replace the loop with a list_for_each_entry()

    Shakeel Butt <shakeelb@google.com>:
      mm/list_lru.c: remove kvfree_rcu_local()

    Johannes Weiner <hannes@cmpxchg.org>:
      fs: buffer: use raw page_memcg() on locked page

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix swap undercounting in cgroup2
      mm: memcontrol: fix get_active_memcg return value
      mm: memcontrol: fix slub memory accounting

Subsystem: mm/pagemap

    Adrian Huang <ahuang12@lenovo.com>:
      mm/mmap.c: remove unnecessary local variable

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/memory.c: fix potential pte_unmap_unlock pte error
      mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush()
      mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush()
      mm/memory.c: fix potential pte_unmap_unlock pte error

Subsystem: mm/mprotect

    Tianjia Zhang <tianjia.zhang@linux.alibaba.com>:
      mm/mprotect.c: optimize error detection in do_mprotect_pkey()

Subsystem: mm/mremap

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas()
      mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success

Subsystem: mm/page-reporting

    sh <sh_def@163.com>:
      mm/page_reporting: use list_entry_is_head() in page_reporting_cycle()

Subsystem: mm/vmalloc

    Yang Li <abaci-bugfix@linux.alibaba.com>:
      vmalloc: remove redundant NULL check

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: HW_TAGS tests support and fixes", v4:
      kasan: prefix global functions with kasan_
      kasan: clarify HW_TAGS impact on TBI
      kasan: clean up comments in tests
      kasan: add macros to simplify checking test constraints
      kasan: add match-all tag tests
      kasan, arm64: allow using KUnit tests with HW_TAGS mode
      kasan: rename CONFIG_TEST_KASAN_MODULE
      kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL
      kasan: adapt kmalloc_uaf2 test to HW_TAGS mode
      kasan: fix memory corruption in kasan_bitops_tags test
      kasan: move _RET_IP_ to inline wrappers
      kasan: fix bug detection via ksize for HW_TAGS mode
      kasan: add proper page allocator tests
      kasan: add a test for kmem_cache_alloc/free_bulk
      kasan: don't run tests when KASAN is not enabled

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: remove redundant config option

Subsystem: mm/pagealloc

    Baoquan He <bhe@redhat.com>:
    Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5:
      mm: fix prototype warning from kernel test robot
      mm: rename memmap_init() and memmap_init_zone()
      mm: simplify parater of function memmap_init_zone()
      mm: simplify parameter of setup_usemap()
      mm: remove unneeded local variable in free_area_init_core

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: simplify free_highmem_page() and free_reserved_page()":
      video: fbdev: acornfb: remove free_unused_pages()
      mm: simplify free_highmem_page() and free_reserved_page()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/gfp: add kernel-doc for gfp_t

Subsystem: mm/memory-failure

    Aili Yao <yaoaili@kingsoft.com>:
      mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events

Subsystem: mm/hugetlb

    Bibo Mao <maobibo@loongson.cn>:
      mm/huge_memory.c: update tlb entry if pmd is changed
      MIPS: do not call flush_tlb_all when setting pmd entry

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix potential double free in hugetlb_register_node() error path

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb.c: fix unnecessary address expansion of pmd sharing

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call
      mm/hugetlb: use helper huge_page_order and pages_per_huge_page
      mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled

    Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>:
      mm/hugetlb: simplify the calculation of variables

    Joao Martins <joao.m.martins@oracle.com>:
    Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2:
      mm/hugetlb: grab head page refcount once for group of subpages
      mm/hugetlb: refactor subpage recording

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix some comment typos

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/hugetlb: remove redundant check in preparing and destroying gigantic page

    Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
      mm/hugetlb.c: fix typos in comments

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/huge_memory.c: remove unused return value of set_huge_zero_page()

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup
      mm/hugetlb: use helper function range_in_vma() in page_table_shareable()
      mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage()
      mm/hugetlb: use helper huge_page_size() to get hugepage size

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: fix update_and_free_page contig page struct assumption
      hugetlb: fix copy_huge_page_from_user contig page struct assumption

    Chen Wandun <chenwandun@huawei.com>:
      mm/hugetlb: suppress wrong warning info when alloc gigantic page

Subsystem: mm/vmscan

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmscan: __isolate_lru_page_prepare() cleanup

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes()

    Yu Zhao <yuzhao@google.com>:
    Patch series "mm: lru related cleanups", v2:
      mm/vmscan.c: use add_page_to_lru_list()
      include/linux/mm_inline.h: shuffle lru list addition and deletion functions
      mm: don't pass "enum lru_list" to lru list addition functions
      mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion()
      mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list()
      mm: add __clear_page_lru_flags() to replace page_off_lru()
      mm: VM_BUG_ON lru page flags
      include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller
      include/linux/mm_inline.h: fold __update_lru_size() into its sole caller
      mm/vmscan.c: make lruvec_lru_size() static

    Oscar Salvador <osalvador@suse.de>:
      mm: workingset: clarify eviction order and distance calculation

    Mike Kravetz <mike.kravetz@oracle.com>:
    Patch series "create hugetlb flags to consolidate state", v3:
      hugetlb: use page.private for hugetlb specific page flags
      hugetlb: convert page_huge_active() HPageMigratable flag
      hugetlb: convert PageHugeTemporary() to HPageTemporary flag
      hugetlb: convert PageHugeFreed to HPageFreed flag
      include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags
      hugetlb: fix uninitialized subpool pointer

    Dave Hansen <dave.hansen@linux.intel.com>:
      mm/vmscan: restore zone_reclaim_mode ABI

Subsystem: mm/z3fold

    Miaohe Lin <linmiaohe@huawei.com>:
      z3fold: remove unused attribute for release_z3fold_page
      z3fold: simplify the zhdr initialization code in init_z3fold_page()

Subsystem: mm/compaction

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/compaction: remove rcu_read_lock during page compaction

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked

    Charan Teja Reddy <charante@codeaurora.org>:
      mm/compaction: correct deferral logic for proactive compaction

    Wonhyuk Yang <vvghjk1234@gmail.com>:
      mm/compaction: fix misbehaviors of fast_find_migrateblock()

    Vlastimil Babka <vbabka@suse.cz>:
      mm, compaction: make fast_isolate_freepages() stay within zone

Subsystem: mm/mempolicy

    Huang Ying <ying.huang@intel.com>:
      numa balancing: migrate on fault among multiple bound nodes

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk()

Subsystem: mm/oom-kill

    Tang Yizhou <tangyizhou@huawei.com>:
      mm, oom: fix a comment in dump_task()

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: change hugetlb_reserve_pages() to type bool
      hugetlbfs: remove special hugetlbfs_set_page_dirty()

    Miaohe Lin <linmiaohe@huawei.com>:
      hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr()
      hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs
      hugetlbfs: correct obsolete function name in hugetlbfs_read_iter()
      hugetlbfs: remove meaningless variable avoid_reserve
      hugetlbfs: make hugepage size conversion more readable
      hugetlbfs: correct some obsolete comments about inode i_mutex
      hugetlbfs: fix some comment typos
      hugetlbfs: remove unneeded return value of hugetlb_vmtruncate()

Subsystem: mm/migration

    Chengyang Fan <cy.fan@huawei.com>:
      mm/migrate: remove unneeded semicolons

 Documentation/admin-guide/cgroup-v2.rst         |    4 
 Documentation/admin-guide/kernel-parameters.txt |    8 
 Documentation/admin-guide/sysctl/vm.rst         |   10 
 Documentation/core-api/mm-api.rst               |    7 
 Documentation/dev-tools/kasan.rst               |   24 
 Documentation/vm/arch_pgtable_helpers.rst       |    8 
 arch/arm64/include/asm/memory.h                 |    1 
 arch/arm64/include/asm/mte-kasan.h              |   12 
 arch/arm64/kernel/mte.c                         |   12 
 arch/arm64/kernel/sleep.S                       |    2 
 arch/arm64/mm/fault.c                           |   20 
 arch/hexagon/configs/comet_defconfig            |    1 
 arch/ia64/include/asm/pgtable.h                 |    6 
 arch/ia64/mm/init.c                             |   18 
 arch/mips/mm/pgtable-32.c                       |    1 
 arch/mips/mm/pgtable-64.c                       |    1 
 arch/x86/kernel/acpi/wakeup_64.S                |    2 
 drivers/base/node.c                             |   33 
 drivers/video/fbdev/acornfb.c                   |   34 
 fs/block_dev.c                                  |    2 
 fs/btrfs/file.c                                 |    2 
 fs/buffer.c                                     |    7 
 fs/dcache.c                                     |    4 
 fs/direct-io.c                                  |    4 
 fs/exec.c                                       |    4 
 fs/fhandle.c                                    |    2 
 fs/fuse/dev.c                                   |    6 
 fs/hugetlbfs/inode.c                            |   72 --
 fs/ntfs/inode.c                                 |    6 
 fs/ntfs/layout.h                                |    4 
 fs/ocfs2/cluster/heartbeat.c                    |    8 
 fs/ocfs2/dlm/dlmast.c                           |   10 
 fs/ocfs2/dlm/dlmcommon.h                        |    4 
 fs/ocfs2/refcounttree.c                         |    2 
 fs/ocfs2/super.c                                |    2 
 fs/pipe.c                                       |    2 
 fs/proc/meminfo.c                               |   10 
 fs/proc/vmcore.c                                |    7 
 fs/ramfs/inode.c                                |   13 
 include/linux/fs.h                              |    4 
 include/linux/gfp.h                             |   14 
 include/linux/highmem-internal.h                |    5 
 include/linux/huge_mm.h                         |   15 
 include/linux/hugetlb.h                         |   98 ++
 include/linux/kasan-checks.h                    |    6 
 include/linux/kasan.h                           |   39 -
 include/linux/memcontrol.h                      |   43 -
 include/linux/migrate.h                         |    2 
 include/linux/mm.h                              |   28 
 include/linux/mm_inline.h                       |  123 +--
 include/linux/mmzone.h                          |   30 
 include/linux/page-flags.h                      |    6 
 include/linux/page_counter.h                    |    9 
 include/linux/pagemap.h                         |    5 
 include/linux/swap.h                            |    8 
 include/trace/events/kmem.h                     |   24 
 include/trace/events/pagemap.h                  |   11 
 include/uapi/linux/mempolicy.h                  |    4 
 init/Kconfig                                    |   14 
 lib/Kconfig.kasan                               |   14 
 lib/Makefile                                    |    2 
 lib/test_kasan.c                                |  446 ++++++++----
 lib/test_kasan_module.c                         |    5 
 mm/backing-dev.c                                |    6 
 mm/compaction.c                                 |   73 +-
 mm/debug.c                                      |   10 
 mm/debug_vm_pgtable.c                           |   86 ++
 mm/filemap.c                                    |  859 +++++++++++-------------
 mm/gup.c                                        |    5 
 mm/huge_memory.c                                |   28 
 mm/hugetlb.c                                    |  376 ++++------
 mm/hugetlb_cgroup.c                             |    6 
 mm/kasan/common.c                               |   60 -
 mm/kasan/generic.c                              |   40 -
 mm/kasan/hw_tags.c                              |   16 
 mm/kasan/kasan.h                                |   87 +-
 mm/kasan/quarantine.c                           |   22 
 mm/kasan/report.c                               |   15 
 mm/kasan/report_generic.c                       |   10 
 mm/kasan/report_hw_tags.c                       |    8 
 mm/kasan/report_sw_tags.c                       |    8 
 mm/kasan/shadow.c                               |   27 
 mm/kasan/sw_tags.c                              |   22 
 mm/khugepaged.c                                 |    6 
 mm/list_lru.c                                   |   12 
 mm/memcontrol.c                                 |  309 ++++----
 mm/memory-failure.c                             |   34 
 mm/memory.c                                     |   24 
 mm/memory_hotplug.c                             |   11 
 mm/mempolicy.c                                  |   18 
 mm/mempool.c                                    |    2 
 mm/migrate.c                                    |   10 
 mm/mlock.c                                      |    3 
 mm/mmap.c                                       |    4 
 mm/mprotect.c                                   |    7 
 mm/mremap.c                                     |    8 
 mm/oom_kill.c                                   |    5 
 mm/page_alloc.c                                 |   70 -
 mm/page_io.c                                    |   12 
 mm/page_owner.c                                 |    4 
 mm/page_reporting.c                             |    2 
 mm/pgtable-generic.c                            |    9 
 mm/rmap.c                                       |   35 
 mm/shmem.c                                      |    2 
 mm/slab.c                                       |   21 
 mm/slab.h                                       |   20 
 mm/slab_common.c                                |   40 -
 mm/slob.c                                       |    2 
 mm/slub.c                                       |  169 ++--
 mm/swap.c                                       |   54 -
 mm/swap_slots.c                                 |    3 
 mm/swap_state.c                                 |   31 
 mm/swapfile.c                                   |    8 
 mm/vmscan.c                                     |  100 +-
 mm/vmstat.c                                     |   14 
 mm/workingset.c                                 |    7 
 mm/z3fold.c                                     |   11 
 scripts/Makefile.kasan                          |   10 
 scripts/spelling.txt                            |   30 
 tools/objtool/check.c                           |    2 
 120 files changed, 2249 insertions(+), 1954 deletions(-)

incoming

[Andrew Morton]

6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749.

Subsystems affected by this patch series:

  mm/pagemap
  scripts
  MAINTAINERS
  h8300

Subsystem: mm/pagemap

    Mike Rapoport <rppt@linux.ibm.com>:
      m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU

Subsystem: scripts

    Rong Chen <rong.a.chen@intel.com>:
      scripts/recordmcount.pl: support big endian for ARCH sh

Subsystem: MAINTAINERS

    Andrey Konovalov <andreyknvl@google.com>:
      MAINTAINERS: update KASAN file list
      MAINTAINERS: update Andrey Konovalov's email address
      MAINTAINERS: add Andrey Konovalov to KASAN reviewers

Subsystem: h8300

    Randy Dunlap <rdunlap@infradead.org>:
      h8300: fix PREEMPTION build, TI_PRE_COUNT undefined

 MAINTAINERS                     |    8 +++++---
 arch/h8300/kernel/asm-offsets.c |    3 +++
 arch/m68k/include/asm/page.h    |    2 +-
 scripts/recordmcount.pl         |    6 +++++-
 4 files changed, 14 insertions(+), 5 deletions(-)

Re: incoming

[Linus Torvalds]

Hah. This series shows a small deficiency in your scripting wrt the diffstat:

On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
>  .mailmap                          |    1
...
>  mm/slub.c                         |   18 +++++++++-
>  17 files changed, 172 insertions(+), 49 deletions(-)

It actually has 18 files changed, but one of them is a pure rename (no
change to the content), and apparently your diffstat tool can't handle
that case.

It *should* have ended with

 ...
 mm/slub.c                                          | 18 +++++-
 .../selftests/vm/{run_vmtests => run_vmtests.sh}   |  0
 18 files changed, 172 insertions(+), 49 deletions(-)
 rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%)

if you'd done a proper "git diff -M --stat --summary" of the series.

[ Ok, by default git would actually have said

    18 files changed, 171 insertions(+), 48 deletions(-)

  but it looks like you use the patience diff option, which gives that
extra insertion/deletion line because it generates the diff a bit
differently ]

Not a big deal,, but it made me briefly wonder "why doesn't my
diffstat match yours".

           Linus

incoming

[Andrew Morton]

14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6.

Subsystems affected by this patch series:

  squashfs
  mm/kasan
  firmware
  mm/mremap
  mm/tmpfs
  mm/selftests
  MAINTAINERS
  mm/memcg
  mm/slub
  nilfs2

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
    Patch series "Squashfs: fix BIO migration regression and add sanity checks":
      squashfs: avoid out of bounds writes in decompressors
      squashfs: add more sanity checks in id lookup
      squashfs: add more sanity checks in inode lookup
      squashfs: add more sanity checks in xattr id lookup

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix stack traces dependency for HW_TAGS

Subsystem: firmware

    Fangrui Song <maskray@google.com>:
      firmware_loader: align .builtin_fw to 8

Subsystem: mm/mremap

    Arnd Bergmann <arnd@arndb.de>:
      mm/mremap: fix BUILD_BUG_ON() error in get_extent

Subsystem: mm/tmpfs

    Seth Forshee <seth.forshee@canonical.com>:
      tmpfs: disallow CONFIG_TMPFS_INODE64 on s390
      tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha

Subsystem: mm/selftests

    Rong Chen <rong.a.chen@intel.com>:
      selftests/vm: rename file run_vmtests to run_vmtests.sh

Subsystem: MAINTAINERS

    Andrey Ryabinin <ryabinin.a.a@gmail.com>:
      MAINTAINERS: update Andrey Ryabinin's email address

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      Revert "mm: memcontrol: avoid workload stalls when lowering memory.high"

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: better heuristic for number of cpus when calculating slab order

Subsystem: nilfs2

    Joachim Henke <joachim.henke@t-systems.com>:
      nilfs2: make splice write available again

 .mailmap                          |    1 
 Documentation/dev-tools/kasan.rst |    3 -
 MAINTAINERS                       |    2 -
 fs/Kconfig                        |    4 +-
 fs/nilfs2/file.c                  |    1 
 fs/squashfs/block.c               |    8 ++++
 fs/squashfs/export.c              |   41 +++++++++++++++++++----
 fs/squashfs/id.c                  |   40 ++++++++++++++++++-----
 fs/squashfs/squashfs_fs_sb.h      |    1 
 fs/squashfs/super.c               |    6 +--
 fs/squashfs/xattr.h               |   10 +++++
 fs/squashfs/xattr_id.c            |   66 ++++++++++++++++++++++++++++++++------
 include/asm-generic/vmlinux.lds.h |    2 -
 mm/kasan/hw_tags.c                |    8 +---
 mm/memcontrol.c                   |    5 +-
 mm/mremap.c                       |    5 +-
 mm/slub.c                         |   18 +++++++++-
 17 files changed, 172 insertions(+), 49 deletions(-)

incoming

[Andrew Morton]

18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97.

Subsystems affected by this patch series:

  mm/hugetlb
  mm/compaction
  mm/vmalloc
  gcov
  mm/shmem
  mm/memblock
  mailmap
  mm/pagecache
  mm/kasan
  ubsan
  mm/hugetlb
  MAINTAINERS

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page
      mm: hugetlb: fix a race between freeing and dissolving the page
      mm: hugetlb: fix a race between isolating and freeing page
      mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active
      mm: migrate: do not migrate HugeTLB page whose refcount is one

Subsystem: mm/compaction

    Rokudo Yan <wu-yan@tcl.com>:
      mm, compaction: move high_pfn to the for loop scope

Subsystem: mm/vmalloc

    Rick Edgecombe <rick.p.edgecombe@intel.com>:
      mm/vmalloc: separate put pages and flush VM flags

Subsystem: gcov

    Johannes Berg <johannes.berg@intel.com>:
      init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov

Subsystem: mm/shmem

    Hugh Dickins <hughd@google.com>:
      mm: thp: fix MADV_REMOVE deadlock on shmem THP

Subsystem: mm/memblock

    Roman Gushchin <guro@fb.com>:
      memblock: do not start bottom-up allocations with kernel_end

Subsystem: mailmap

    Viresh Kumar <viresh.kumar@linaro.org>:
      mailmap: fix name/email for Viresh Kumar

    Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>:
      mailmap: add entries for Manivannan Sadhasivam

Subsystem: mm/pagecache

    Waiman Long <longman@redhat.com>:
      mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked()

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
    Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5:
      kasan: add explicit preconditions to kasan_report()
      kasan: make addr_has_metadata() return true for valid addresses

Subsystem: ubsan

    Nathan Chancellor <nathan@kernel.org>:
      ubsan: implement __ubsan_handle_alignment_assumption

Subsystem: mm/hugetlb

    Muchun Song <songmuchun@bytedance.com>:
      mm: hugetlb: fix missing put_page in gather_surplus_pages()

Subsystem: MAINTAINERS

    Nathan Chancellor <nathan@kernel.org>:
      MAINTAINERS/.mailmap: use my @kernel.org address

 .mailmap                |    5 ++++
 MAINTAINERS             |    2 -
 fs/hugetlbfs/inode.c    |    3 +-
 include/linux/hugetlb.h |    2 +
 include/linux/kasan.h   |    7 ++++++
 include/linux/vmalloc.h |    9 +-------
 init/Kconfig            |    1 
 init/main.c             |    8 ++++++-
 kernel/gcov/Kconfig     |    2 -
 lib/ubsan.c             |   31 ++++++++++++++++++++++++++++
 lib/ubsan.h             |    6 +++++
 mm/compaction.c         |    3 +-
 mm/filemap.c            |    4 +++
 mm/huge_memory.c        |   37 ++++++++++++++++++++-------------
 mm/hugetlb.c            |   53 ++++++++++++++++++++++++++++++++++++++++++------
 mm/kasan/kasan.h        |    2 -
 mm/memblock.c           |   49 +++++---------------------------------------
 mm/migrate.c            |    6 +++++
 18 files changed, 153 insertions(+), 77 deletions(-)

incoming

[Andrew Morton]

19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1.

Subsystems affected by this patch series:

  mm/pagealloc
  mm/memcg
  mm/kasan
  ubsan
  mm/memory-failure
  mm/highmem
  proc
  MAINTAINERS

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "mm: fix initialization of struct page for holes in memory layout", v3:
      x86/setup: don't remove E820_TYPE_RAM for pfn 0
      mm: fix initialization of struct page for holes in memory layout

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: optimize objcg stock draining

    Shakeel Butt <shakeelb@google.com>:
      mm: memcg: fix memcg file_dirty numa stat
      mm: fix numa stats for thp migration

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: prevent starvation when writing memory.high

Subsystem: mm/kasan

    Lecopzer Chen <lecopzer@gmail.com>:
      kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow
      kasan: fix incorrect arguments passing in kasan_add_zero_shadow

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: fix HW_TAGS boot parameters
      kasan, mm: fix conflicts with init_on_alloc/free
      kasan, mm: fix resetting page_alloc tags for HW_TAGS

Subsystem: ubsan

    Arnd Bergmann <arnd@arndb.de>:
      ubsan: disable unsigned-overflow check for i386

Subsystem: mm/memory-failure

    Dan Williams <dan.j.williams@intel.com>:
      mm: fix page reference leak in soft_offline_page()

Subsystem: mm/highmem

    Thomas Gleixner <tglx@linutronix.de>:
    Patch series "mm/highmem: Fix fallout from generic kmap_local conversions":
      sparc/mm/highmem: flush cache and TLB
      mm/highmem: prepare for overriding set_pte_at()
      mips/mm/highmem: use set_pte() for kmap_local()
      powerpc/mm/highmem: use __set_pte_at() for kmap_local()

Subsystem: proc

    Xiaoming Ni <nixiaoming@huawei.com>:
      proc_sysctl: fix oops caused by incorrect command parameters

Subsystem: MAINTAINERS

    Nathan Chancellor <natechancellor@gmail.com>:
      MAINTAINERS: add a couple more files to the Clang/LLVM section

 Documentation/dev-tools/kasan.rst  |   27 ++---------
 MAINTAINERS                        |    2 
 arch/mips/include/asm/highmem.h    |    1 
 arch/powerpc/include/asm/highmem.h |    2 
 arch/sparc/include/asm/highmem.h   |    9 ++-
 arch/x86/kernel/setup.c            |   20 +++-----
 fs/proc/proc_sysctl.c              |    7 ++-
 lib/Kconfig.ubsan                  |    1 
 mm/highmem.c                       |    7 ++-
 mm/kasan/hw_tags.c                 |   77 +++++++++++++--------------------
 mm/kasan/init.c                    |   23 +++++----
 mm/memcontrol.c                    |   11 +---
 mm/memory-failure.c                |   20 ++++++--
 mm/migrate.c                       |   27 ++++++-----
 mm/page_alloc.c                    |   86 ++++++++++++++++++++++---------------
 mm/slub.c                          |    7 +--
 16 files changed, 173 insertions(+), 154 deletions(-)

Re: incoming

[Linus Torvalds]

On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.

Whee. I had completely dropped the ball on this - I had built my usual
"akpm" branch with the patches, but then had completely forgotten
about it after doing my basic build tests.

I tend to leave it for a while to see if people send belated ACK/NAK's
for the patches, but that "for a while" is typically "overnight", not
several days.

So if you ever notice that I haven't merged your patch submission, and
you haven't seen me comment on them, feel free to ping me to remind
me.

Because it might just have gotten lost in the shuffle for some random
reason. Admittedly it's rare - I think this is the first time I just
randomly noticed three days later that I'd never done the actual merge
of the patch-series).

               Linus

incoming

[Andrew Morton]

10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.

Subsystems affected by this patch series:

  mm/slub
  mm/pagealloc
  mm/memcg
  mm/kasan
  mm/vmalloc
  mm/migration
  mm/hugetlb
  MAINTAINERS
  mm/memory-failure
  mm/process_vm_access

Subsystem: mm/slub

    Jann Horn <jannh@google.com>:
      mm, slub: consider rest of partial list if acquire_slab() fails

Subsystem: mm/pagealloc

    Hailong liu <liu.hailong6@zte.com.cn>:
      mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint

Subsystem: mm/memcg

    Hugh Dickins <hughd@google.com>:
      mm/memcontrol: fix warning in mem_cgroup_page_lruvec()

Subsystem: mm/kasan

    Hailong Liu <liu.hailong6@zte.com.cn>:
      arm/kasan: fix the array size of kasan_early_shadow_pte[]

Subsystem: mm/vmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmalloc.c: fix potential memory leak

Subsystem: mm/migration

    Jan Stancek <jstancek@redhat.com>:
      mm: migrate: initialize err in do_migrate_pages

Subsystem: mm/hugetlb

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/hugetlb: fix potential missing huge page size info

Subsystem: MAINTAINERS

    Vlastimil Babka <vbabka@suse.cz>:
      MAINTAINERS: add Vlastimil as slab allocators maintainer

Subsystem: mm/memory-failure

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: fix printing of page flags

Subsystem: mm/process_vm_access

    Andrew Morton <akpm@linux-foundation.org>:
      mm/process_vm_access.c: include compat.h

 MAINTAINERS                |    1 +
 include/linux/kasan.h      |    6 +++++-
 include/linux/memcontrol.h |    2 +-
 mm/hugetlb.c               |    2 +-
 mm/kasan/init.c            |    3 ++-
 mm/memory-failure.c        |    2 +-
 mm/mempolicy.c             |    2 +-
 mm/page_alloc.c            |   31 ++++++++++++++++---------------
 mm/process_vm_access.c     |    1 +
 mm/slub.c                  |    2 +-
 mm/vmalloc.c               |    4 +++-
 11 files changed, 33 insertions(+), 23 deletions(-)

incoming

[Andrew Morton]

16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3.

Subsystems affected by this patch series:

  mm/selftests
  mm/hugetlb
  kbuild
  checkpatch
  mm/pagecache
  mm/mremap
  mm/kasan
  misc
  lib
  mm/slub

Subsystem: mm/selftests

    Harish <harish@linux.ibm.com>:
      selftests/vm: fix building protection keys test

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      mm/hugetlb: fix deadlock in hugetlb_cow error path

Subsystem: kbuild

    Masahiro Yamada <masahiroy@kernel.org>:
      Revert "kbuild: avoid static_assert for genksyms"

Subsystem: checkpatch

    Joe Perches <joe@perches.com>:
      checkpatch: prefer strscpy to strlcpy

Subsystem: mm/pagecache

    Souptick Joarder <jrdr.linux@gmail.com>:
      mm: add prototype for __add_to_page_cache_locked()

    Baoquan He <bhe@redhat.com>:
      mm: memmap defer init doesn't work as expected

Subsystem: mm/mremap

    Kalesh Singh <kaleshsingh@google.com>:
      mm/mremap.c: fix extent calculation

    Nicholas Piggin <npiggin@gmail.com>:
      mm: generalise COW SMC TLB flushing race comment

Subsystem: mm/kasan

    Walter Wu <walter-zh.wu@mediatek.com>:
      kasan: fix null pointer dereference in kasan_record_aux_stack

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      local64.h: make <asm/local64.h> mandatory

    Huang Shijie <sjhuang@iluvatar.ai>:
      sizes.h: add SZ_8G/SZ_16G/SZ_32G macros

    Josh Poimboeuf <jpoimboe@redhat.com>:
      kdev_t: always inline major/minor helper functions

Subsystem: lib

    Huang Shijie <sjhuang@iluvatar.ai>:
      lib/genalloc: fix the overflow when size is too big

    Ilya Leoshkevich <iii@linux.ibm.com>:
      lib/zlib: fix inflating zlib streams on s390

    Randy Dunlap <rdunlap@infradead.org>:
      zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c

Subsystem: mm/slub

    Roman Gushchin <guro@fb.com>:
      mm: slub: call account_slab_page() after slab page initialization

 arch/alpha/include/asm/local64.h    |    1 -
 arch/arc/include/asm/Kbuild         |    1 -
 arch/arm/include/asm/Kbuild         |    1 -
 arch/arm64/include/asm/Kbuild       |    1 -
 arch/csky/include/asm/Kbuild        |    1 -
 arch/h8300/include/asm/Kbuild       |    1 -
 arch/hexagon/include/asm/Kbuild     |    1 -
 arch/ia64/include/asm/local64.h     |    1 -
 arch/ia64/mm/init.c                 |    4 ++--
 arch/m68k/include/asm/Kbuild        |    1 -
 arch/microblaze/include/asm/Kbuild  |    1 -
 arch/mips/include/asm/Kbuild        |    1 -
 arch/nds32/include/asm/Kbuild       |    1 -
 arch/openrisc/include/asm/Kbuild    |    1 -
 arch/parisc/include/asm/Kbuild      |    1 -
 arch/powerpc/include/asm/Kbuild     |    1 -
 arch/riscv/include/asm/Kbuild       |    1 -
 arch/s390/include/asm/Kbuild        |    1 -
 arch/sh/include/asm/Kbuild          |    1 -
 arch/sparc/include/asm/Kbuild       |    1 -
 arch/x86/include/asm/local64.h      |    1 -
 arch/xtensa/include/asm/Kbuild      |    1 -
 include/asm-generic/Kbuild          |    1 +
 include/linux/build_bug.h           |    5 -----
 include/linux/kdev_t.h              |   22 +++++++++++-----------
 include/linux/mm.h                  |   12 ++++++++++--
 include/linux/sizes.h               |    3 +++
 lib/genalloc.c                      |   25 +++++++++++++------------
 lib/zlib_dfltcc/Makefile            |    2 +-
 lib/zlib_dfltcc/dfltcc.c            |    6 +++++-
 lib/zlib_dfltcc/dfltcc_deflate.c    |    3 +++
 lib/zlib_dfltcc/dfltcc_inflate.c    |    4 ++--
 lib/zlib_dfltcc/dfltcc_syms.c       |   17 -----------------
 mm/hugetlb.c                        |   22 +++++++++++++++++++++-
 mm/kasan/generic.c                  |    2 ++
 mm/memory.c                         |    8 +++++---
 mm/memory_hotplug.c                 |    2 +-
 mm/mremap.c                         |    4 +++-
 mm/page_alloc.c                     |    8 +++++---
 mm/slub.c                           |    5 ++---
 scripts/checkpatch.pl               |    6 ++++++
 tools/testing/selftests/vm/Makefile |   10 +++++-----
 42 files changed, 101 insertions(+), 91 deletions(-)

Re: incoming

[Linus Torvalds]

On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.

I see that you enabled renaming in the patches. Lovely.

Can you also enable it in the diffstat?

>  74 files changed, 2869 insertions(+), 1553 deletions(-)

With -M in the diffstat, you should have seen

 72 files changed, 2775 insertions(+), 1460 deletions(-)

and if you add "--summary", you'll also see the rename part ofthe file
create/delete summary:

 rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%)

which is often nice to see in addition to the line stats..

           Linus

incoming

[Andrew Morton]

60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.

Subsystems affected by this patch series:

  mm/kasan

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: add hardware tag-based mode for arm64", v11:
      kasan: drop unnecessary GPL text from comment headers
      kasan: KASAN_VMALLOC depends on KASAN_GENERIC
      kasan: group vmalloc code
      kasan: shadow declarations only for software modes
      kasan: rename (un)poison_shadow to (un)poison_range
      kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
      kasan: only build init.c for software modes
      kasan: split out shadow.c from common.c
      kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
      kasan: rename report and tags files
      kasan: don't duplicate config dependencies
      kasan: hide invalid free check implementation
      kasan: decode stack frame only with KASAN_STACK_ENABLE
      kasan, arm64: only init shadow for software modes
      kasan, arm64: only use kasan_depth for software modes
      kasan, arm64: move initialization message
      kasan, arm64: rename kasan_init_tags and mark as __init
      kasan: rename addr_has_shadow to addr_has_metadata
      kasan: rename print_shadow_for_address to print_memory_metadata
      kasan: rename SHADOW layout macros to META
      kasan: separate metadata_fetch_row for each mode
      kasan: introduce CONFIG_KASAN_HW_TAGS

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      arm64: enable armv8.5-a asm-arch option
      arm64: mte: add in-kernel MTE helpers
      arm64: mte: reset the page tag in page->flags
      arm64: mte: add in-kernel tag fault handler
      arm64: kasan: allow enabling in-kernel MTE
      arm64: mte: convert gcr_user into an exclude mask
      arm64: mte: switch GCR_EL1 in kernel entry and exit
      kasan, mm: untag page address in free_reserved_area

    Andrey Konovalov <andreyknvl@google.com>:
      arm64: kasan: align allocations for HW_TAGS
      arm64: kasan: add arch layer for memory tagging helpers
      kasan: define KASAN_GRANULE_SIZE for HW_TAGS
      kasan, x86, s390: update undef CONFIG_KASAN
      kasan, arm64: expand CONFIG_KASAN checks
      kasan, arm64: implement HW_TAGS runtime
      kasan, arm64: print report from tag fault handler
      kasan, mm: reset tags when accessing metadata
      kasan, arm64: enable CONFIG_KASAN_HW_TAGS
      kasan: add documentation for hardware tag-based mode

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kselftest/arm64: check GCR_EL1 after context switch

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: boot parameters for hardware tag-based mode", v4:
      kasan: simplify quarantine_put call site
      kasan: rename get_alloc/free_info
      kasan: introduce set_alloc_info
      kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
      kasan: allow VMAP_STACK for HW_TAGS mode
      kasan: remove __kasan_unpoison_stack
      kasan: inline kasan_reset_tag for tag-based modes
      kasan: inline random_tag for HW_TAGS
      kasan: open-code kasan_unpoison_slab
      kasan: inline (un)poison_range and check_invalid_free
      kasan: add and integrate kasan boot parameters
      kasan, mm: check kasan_enabled in annotations
      kasan, mm: rename kasan_poison_kfree
      kasan: don't round_up too much
      kasan: simplify assign_tag and set_tag calls
      kasan: clarify comment in __kasan_kfree_large
      kasan: sanitize objects when metadata doesn't fit
      kasan, mm: allow cache merging with no metadata
      kasan: update documentation

 Documentation/dev-tools/kasan.rst                         |  274 ++-
 arch/Kconfig                                              |    8 
 arch/arm64/Kconfig                                        |    9 
 arch/arm64/Makefile                                       |    7 
 arch/arm64/include/asm/assembler.h                        |    2 
 arch/arm64/include/asm/cache.h                            |    3 
 arch/arm64/include/asm/esr.h                              |    1 
 arch/arm64/include/asm/kasan.h                            |   17 
 arch/arm64/include/asm/memory.h                           |   15 
 arch/arm64/include/asm/mte-def.h                          |   16 
 arch/arm64/include/asm/mte-kasan.h                        |   67 
 arch/arm64/include/asm/mte.h                              |   22 
 arch/arm64/include/asm/processor.h                        |    2 
 arch/arm64/include/asm/string.h                           |    5 
 arch/arm64/include/asm/uaccess.h                          |   23 
 arch/arm64/kernel/asm-offsets.c                           |    3 
 arch/arm64/kernel/cpufeature.c                            |    3 
 arch/arm64/kernel/entry.S                                 |   41 
 arch/arm64/kernel/head.S                                  |    2 
 arch/arm64/kernel/hibernate.c                             |    5 
 arch/arm64/kernel/image-vars.h                            |    2 
 arch/arm64/kernel/kaslr.c                                 |    3 
 arch/arm64/kernel/module.c                                |    6 
 arch/arm64/kernel/mte.c                                   |  124 +
 arch/arm64/kernel/setup.c                                 |    2 
 arch/arm64/kernel/sleep.S                                 |    2 
 arch/arm64/kernel/smp.c                                   |    2 
 arch/arm64/lib/mte.S                                      |   16 
 arch/arm64/mm/copypage.c                                  |    9 
 arch/arm64/mm/fault.c                                     |   59 
 arch/arm64/mm/kasan_init.c                                |   41 
 arch/arm64/mm/mteswap.c                                   |    9 
 arch/arm64/mm/proc.S                                      |   23 
 arch/arm64/mm/ptdump.c                                    |    6 
 arch/s390/boot/string.c                                   |    1 
 arch/x86/boot/compressed/misc.h                           |    1 
 arch/x86/kernel/acpi/wakeup_64.S                          |    2 
 include/linux/kasan-checks.h                              |    2 
 include/linux/kasan.h                                     |  423 ++++-
 include/linux/mm.h                                        |   24 
 include/linux/moduleloader.h                              |    3 
 include/linux/page-flags-layout.h                         |    2 
 include/linux/sched.h                                     |    2 
 include/linux/string.h                                    |    2 
 init/init_task.c                                          |    2 
 kernel/fork.c                                             |    4 
 lib/Kconfig.kasan                                         |   71 
 lib/test_kasan.c                                          |    2 
 lib/test_kasan_module.c                                   |    2 
 mm/kasan/Makefile                                         |   33 
 mm/kasan/common.c                                         | 1006 +++-----------
 mm/kasan/generic.c                                        |   72 -
 mm/kasan/generic_report.c                                 |   13 
 mm/kasan/hw_tags.c                                        |  276 +++
 mm/kasan/init.c                                           |   25 
 mm/kasan/kasan.h                                          |  195 ++
 mm/kasan/quarantine.c                                     |   35 
 mm/kasan/report.c                                         |  363 +----
 mm/kasan/report_generic.c                                 |  169 ++
 mm/kasan/report_hw_tags.c                                 |   44 
 mm/kasan/report_sw_tags.c                                 |   22 
 mm/kasan/shadow.c                                         |  528 +++++++
 mm/kasan/sw_tags.c                                        |   34 
 mm/kasan/tags.c                                           |    7 
 mm/kasan/tags_report.c                                    |    7 
 mm/mempool.c                                              |    4 
 mm/page_alloc.c                                           |    9 
 mm/page_poison.c                                          |    2 
 mm/ptdump.c                                               |   13 
 mm/slab_common.c                                          |    5 
 mm/slub.c                                                 |   29 
 scripts/Makefile.lib                                      |    2 
 tools/testing/selftests/arm64/mte/Makefile                |    2 
 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c |  155 ++
 74 files changed, 2869 insertions(+), 1553 deletions(-)

incoming

[Andrew Morton]

78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87.

Subsystems affected by this patch series:

  mm/memcg
  epoll
  mm/kasan
  mm/cleanups
  epoll

Subsystem: mm/memcg

    Alex Shi <alex.shi@linux.alibaba.com>:
    Patch series "bail out early for memcg disable":
      mm/memcg: bail early from swap accounting if memcg disabled
      mm/memcg: warning on !memcg after readahead page charged

    Wei Yang <richard.weiyang@gmail.com>:
      mm/memcg: remove unused definitions

    Shakeel Butt <shakeelb@google.com>:
      mm, kvm: account kvm_vcpu_mmap to kmemcg

    Hui Su <sh_def@163.com>:
      mm/memcontrol:rewrite mem_cgroup_page_lruvec()

Subsystem: epoll

    Soheil Hassas Yeganeh <soheil@google.com>:
    Patch series "simplify ep_poll":
      epoll: check for events when removing a timed out thread from the wait queue
      epoll: simplify signal handling
      epoll: pull fatal signal checks into ep_send_events()
      epoll: move eavail next to the list_empty_careful check
      epoll: simplify and optimize busy loop logic
      epoll: pull all code between fetch_events and send_event into the loop
      epoll: replace gotos with a proper loop
      epoll: eliminate unnecessary lock for zero timeout

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: add hardware tag-based mode for arm64", v11:
      kasan: drop unnecessary GPL text from comment headers
      kasan: KASAN_VMALLOC depends on KASAN_GENERIC
      kasan: group vmalloc code
      kasan: shadow declarations only for software modes
      kasan: rename (un)poison_shadow to (un)poison_range
      kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
      kasan: only build init.c for software modes
      kasan: split out shadow.c from common.c
      kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
      kasan: rename report and tags files
      kasan: don't duplicate config dependencies
      kasan: hide invalid free check implementation
      kasan: decode stack frame only with KASAN_STACK_ENABLE
      kasan, arm64: only init shadow for software modes
      kasan, arm64: only use kasan_depth for software modes
      kasan, arm64: move initialization message
      kasan, arm64: rename kasan_init_tags and mark as __init
      kasan: rename addr_has_shadow to addr_has_metadata
      kasan: rename print_shadow_for_address to print_memory_metadata
      kasan: rename SHADOW layout macros to META
      kasan: separate metadata_fetch_row for each mode
      kasan: introduce CONFIG_KASAN_HW_TAGS

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      arm64: enable armv8.5-a asm-arch option
      arm64: mte: add in-kernel MTE helpers
      arm64: mte: reset the page tag in page->flags
      arm64: mte: add in-kernel tag fault handler
      arm64: kasan: allow enabling in-kernel MTE
      arm64: mte: convert gcr_user into an exclude mask
      arm64: mte: switch GCR_EL1 in kernel entry and exit
      kasan, mm: untag page address in free_reserved_area

    Andrey Konovalov <andreyknvl@google.com>:
      arm64: kasan: align allocations for HW_TAGS
      arm64: kasan: add arch layer for memory tagging helpers
      kasan: define KASAN_GRANULE_SIZE for HW_TAGS
      kasan, x86, s390: update undef CONFIG_KASAN
      kasan, arm64: expand CONFIG_KASAN checks
      kasan, arm64: implement HW_TAGS runtime
      kasan, arm64: print report from tag fault handler
      kasan, mm: reset tags when accessing metadata
      kasan, arm64: enable CONFIG_KASAN_HW_TAGS
      kasan: add documentation for hardware tag-based mode

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      kselftest/arm64: check GCR_EL1 after context switch

    Andrey Konovalov <andreyknvl@google.com>:
    Patch series "kasan: boot parameters for hardware tag-based mode", v4:
      kasan: simplify quarantine_put call site
      kasan: rename get_alloc/free_info
      kasan: introduce set_alloc_info
      kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
      kasan: allow VMAP_STACK for HW_TAGS mode
      kasan: remove __kasan_unpoison_stack
      kasan: inline kasan_reset_tag for tag-based modes
      kasan: inline random_tag for HW_TAGS
      kasan: open-code kasan_unpoison_slab
      kasan: inline (un)poison_range and check_invalid_free
      kasan: add and integrate kasan boot parameters
      kasan, mm: check kasan_enabled in annotations
      kasan, mm: rename kasan_poison_kfree
      kasan: don't round_up too much
      kasan: simplify assign_tag and set_tag calls
      kasan: clarify comment in __kasan_kfree_large
      kasan: sanitize objects when metadata doesn't fit
      kasan, mm: allow cache merging with no metadata
      kasan: update documentation

Subsystem: mm/cleanups

    Colin Ian King <colin.king@canonical.com>:
      mm/Kconfig: fix spelling mistake "whats" -> "what's"

Subsystem: epoll

    Willem de Bruijn <willemb@google.com>:
    Patch series "add epoll_pwait2 syscall", v4:
      epoll: convert internal api to timespec64
      epoll: add syscall epoll_pwait2
      epoll: wire up syscall epoll_pwait2
      selftests/filesystems: expand epoll with epoll_pwait2

 Documentation/dev-tools/kasan.rst                             |  274 +-
 arch/Kconfig                                                  |    8 
 arch/alpha/kernel/syscalls/syscall.tbl                        |    1 
 arch/arm/tools/syscall.tbl                                    |    1 
 arch/arm64/Kconfig                                            |    9 
 arch/arm64/Makefile                                           |    7 
 arch/arm64/include/asm/assembler.h                            |    2 
 arch/arm64/include/asm/cache.h                                |    3 
 arch/arm64/include/asm/esr.h                                  |    1 
 arch/arm64/include/asm/kasan.h                                |   17 
 arch/arm64/include/asm/memory.h                               |   15 
 arch/arm64/include/asm/mte-def.h                              |   16 
 arch/arm64/include/asm/mte-kasan.h                            |   67 
 arch/arm64/include/asm/mte.h                                  |   22 
 arch/arm64/include/asm/processor.h                            |    2 
 arch/arm64/include/asm/string.h                               |    5 
 arch/arm64/include/asm/uaccess.h                              |   23 
 arch/arm64/include/asm/unistd.h                               |    2 
 arch/arm64/include/asm/unistd32.h                             |    2 
 arch/arm64/kernel/asm-offsets.c                               |    3 
 arch/arm64/kernel/cpufeature.c                                |    3 
 arch/arm64/kernel/entry.S                                     |   41 
 arch/arm64/kernel/head.S                                      |    2 
 arch/arm64/kernel/hibernate.c                                 |    5 
 arch/arm64/kernel/image-vars.h                                |    2 
 arch/arm64/kernel/kaslr.c                                     |    3 
 arch/arm64/kernel/module.c                                    |    6 
 arch/arm64/kernel/mte.c                                       |  124 +
 arch/arm64/kernel/setup.c                                     |    2 
 arch/arm64/kernel/sleep.S                                     |    2 
 arch/arm64/kernel/smp.c                                       |    2 
 arch/arm64/lib/mte.S                                          |   16 
 arch/arm64/mm/copypage.c                                      |    9 
 arch/arm64/mm/fault.c                                         |   59 
 arch/arm64/mm/kasan_init.c                                    |   41 
 arch/arm64/mm/mteswap.c                                       |    9 
 arch/arm64/mm/proc.S                                          |   23 
 arch/arm64/mm/ptdump.c                                        |    6 
 arch/ia64/kernel/syscalls/syscall.tbl                         |    1 
 arch/m68k/kernel/syscalls/syscall.tbl                         |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl                   |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl                     |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl                     |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl                     |    1 
 arch/parisc/kernel/syscalls/syscall.tbl                       |    1 
 arch/powerpc/kernel/syscalls/syscall.tbl                      |    1 
 arch/s390/boot/string.c                                       |    1 
 arch/s390/kernel/syscalls/syscall.tbl                         |    1 
 arch/sh/kernel/syscalls/syscall.tbl                           |    1 
 arch/sparc/kernel/syscalls/syscall.tbl                        |    1 
 arch/x86/boot/compressed/misc.h                               |    1 
 arch/x86/entry/syscalls/syscall_32.tbl                        |    1 
 arch/x86/entry/syscalls/syscall_64.tbl                        |    1 
 arch/x86/kernel/acpi/wakeup_64.S                              |    2 
 arch/x86/kvm/x86.c                                            |    2 
 arch/xtensa/kernel/syscalls/syscall.tbl                       |    1 
 fs/eventpoll.c                                                |  359 ++-
 include/linux/compat.h                                        |    6 
 include/linux/kasan-checks.h                                  |    2 
 include/linux/kasan.h                                         |  423 ++--
 include/linux/memcontrol.h                                    |  137 -
 include/linux/mm.h                                            |   24 
 include/linux/mmdebug.h                                       |   13 
 include/linux/moduleloader.h                                  |    3 
 include/linux/page-flags-layout.h                             |    2 
 include/linux/sched.h                                         |    2 
 include/linux/string.h                                        |    2 
 include/linux/syscalls.h                                      |    5 
 include/uapi/asm-generic/unistd.h                             |    4 
 init/init_task.c                                              |    2 
 kernel/fork.c                                                 |    4 
 kernel/sys_ni.c                                               |    2 
 lib/Kconfig.kasan                                             |   71 
 lib/test_kasan.c                                              |    2 
 lib/test_kasan_module.c                                       |    2 
 mm/Kconfig                                                    |    2 
 mm/kasan/Makefile                                             |   33 
 mm/kasan/common.c                                             | 1006 ++--------
 mm/kasan/generic.c                                            |   72 
 mm/kasan/generic_report.c                                     |   13 
 mm/kasan/hw_tags.c                                            |  294 ++
 mm/kasan/init.c                                               |   25 
 mm/kasan/kasan.h                                              |  204 +-
 mm/kasan/quarantine.c                                         |   35 
 mm/kasan/report.c                                             |  363 +--
 mm/kasan/report_generic.c                                     |  169 +
 mm/kasan/report_hw_tags.c                                     |   44 
 mm/kasan/report_sw_tags.c                                     |   22 
 mm/kasan/shadow.c                                             |  541 +++++
 mm/kasan/sw_tags.c                                            |   34 
 mm/kasan/tags.c                                               |    7 
 mm/kasan/tags_report.c                                        |    7 
 mm/memcontrol.c                                               |   53 
 mm/mempool.c                                                  |    4 
 mm/page_alloc.c                                               |    9 
 mm/page_poison.c                                              |    2 
 mm/ptdump.c                                                   |   13 
 mm/slab_common.c                                              |    5 
 mm/slub.c                                                     |   29 
 scripts/Makefile.lib                                          |    2 
 tools/testing/selftests/arm64/mte/Makefile                    |    2 
 tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c     |  155 +
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   72 
 virt/kvm/coalesced_mmio.c                                     |    2 
 virt/kvm/kvm_main.c                                           |    2 
 105 files changed, 3268 insertions(+), 1873 deletions(-)

incoming

[Andrew Morton]

- lots of little subsystems

- a few post-linux-next MM material.  Most of this awaits more merging
  of other trees.


95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4.

Subsystems affected by this patch series:

  mm/swap
  mm/memory-hotplug
  alpha
  procfs
  misc
  core-kernel
  bitmap
  lib
  lz4
  bitops
  checkpatch
  nilfs
  kdump
  rapidio
  gcov
  bfs
  relay
  resource
  ubsan
  reboot
  fault-injection
  lzo
  apparmor
  mm/pagemap
  mm/cleanups
  mm/gup

Subsystem: mm/swap

    Zhaoyang Huang <huangzhaoyang@gmail.com>:
      mm: fix a race on nr_swap_pages

Subsystem: mm/memory-hotplug

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm/memory_hotplug: quieting offline operation

Subsystem: alpha

    Thomas Gleixner <tglx@linutronix.de>:
      alpha: replace bogus in_interrupt()

Subsystem: procfs

    Randy Dunlap <rdunlap@infradead.org>:
      procfs: delete duplicated words + other fixes

    Anand K Mistry <amistry@google.com>:
      proc: provide details on indirect branch speculation

    Alexey Dobriyan <adobriyan@gmail.com>:
      proc: fix lookup in /proc/net subdirectories after setns(2)

    Hui Su <sh_def@163.com>:
      fs/proc: make pde_get() return nothing

Subsystem: misc

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      asm-generic: force inlining of get_order() to work around gcc10 poor decision

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out mathematical helpers

Subsystem: core-kernel

    Hui Su <sh_def@163.com>:
      kernel/acct.c: use #elif instead of #end and #elif

Subsystem: bitmap

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean

    "Ma, Jianpeng" <jianpeng.ma@intel.com>:
      bitmap: remove unused function declaration

Subsystem: lib

    Geert Uytterhoeven <geert@linux-m68k.org>:
      lib/test_free_pages.c: add basic progress indicators

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
    Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member":
      lib/stackdepot.c: replace one-element array with flexible-array member
      lib/stackdepot.c: use flex_array_size() helper in memcpy()
      lib/stackdepot.c: use array_size() helper in jhash2()

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      lib/list_kunit: follow new file name convention for KUnit tests
      lib/linear_ranges_kunit: follow new file name convention for KUnit tests
      lib/bits_kunit: follow new file name convention for KUnit tests
      lib/cmdline: fix get_option() for strings starting with hyphen
      lib/cmdline: allow NULL to be an output for get_option()
      lib/cmdline_kunit: add a new test suite for cmdline API

    Jakub Jelinek <jakub@redhat.com>:
      ilog2: improve ilog2 for constant arguments

    Nick Desaulniers <ndesaulniers@google.com>:
      lib/string: remove unnecessary #undefs

    Daniel Axtens <dja@axtens.net>:
    Patch series "Fortify strscpy()", v7:
      lib: string.h: detect intra-object overflow in fortified string functions
      lkdtm: tests for FORTIFY_SOURCE

    Francis Laniel <laniel_francis@privacyrequired.com>:
      string.h: add FORTIFY coverage for strscpy()
      drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy
      drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment

    Alexey Dobriyan <adobriyan@gmail.com>:
      lib: cleanup kstrto*() usage

Subsystem: lz4

    Gao Xiang <hsiangkao@redhat.com>:
      lib/lz4: explicitly support in-place decompression

Subsystem: bitops

    Syed Nayyar Waris <syednwaris@gmail.com>:
    Patch series "Introduce the for_each_set_clump macro", v12:
      bitops: introduce the for_each_set_clump macro
      lib/test_bitmap.c: add for_each_set_clump test cases
      gpio: thunderx: utilize for_each_set_clump macro
      gpio: xilinx: utilize generic bitmap_get_value and _set_value

Subsystem: checkpatch

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add new exception to repeated word check

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: fix false positives in REPEATED_WORD warning

    Łukasz Stelmach <l.stelmach@samsung.com>:
      checkpatch: ignore generated CamelCase defines and enum values

    Joe Perches <joe@perches.com>:
      checkpatch: prefer static const declarations
      checkpatch: allow --fix removal of unnecessary break statements

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: extend attributes check to handle more patterns

    Tom Rix <trix@redhat.com>:
      checkpatch: add a fixer for missing newline at eof

    Joe Perches <joe@perches.com>:
      checkpatch: update __attribute__((section("name"))) quote removal

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add fix option for GERRIT_CHANGE_ID

    Joe Perches <joe@perches.com>:
      checkpatch: add __alias and __weak to suggested __attribute__ conversions

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: improve email parsing
      checkpatch: fix spelling errors and remove repeated word

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: fix unescaped left brace

    Aditya Srivastava <yashsri421@gmail.com>:
      checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS
      checkpatch: add fix option for LOGICAL_CONTINUATIONS
      checkpatch: add fix and improve warning msg for non-standard signature

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi]
      checkpatch: add warning for lines starting with a '#' in commit log
      checkpatch: fix TYPO_SPELLING check for words with apostrophe

    Joe Perches <joe@perches.com>:
      checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning

Subsystem: nilfs

    Alex Shi <alex.shi@linux.alibaba.com>:
      fs/nilfs2: remove some unused macros to tame gcc

Subsystem: kdump

    Alexander Egorenkov <egorenar@linux.ibm.com>:
      kdump: append uts_namespace.name offset to VMCOREINFO

Subsystem: rapidio

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      rapidio: remove unused rio_get_asm() and rio_get_device()

Subsystem: gcov

    Nick Desaulniers <ndesaulniers@google.com>:
      gcov: remove support for GCC < 4.9

    Alex Shi <alex.shi@linux.alibaba.com>:
      gcov: fix kernel-doc markup issue

Subsystem: bfs

    Randy Dunlap <rdunlap@infradead.org>:
      bfs: don't use WARNING: string when it's just info.

Subsystem: relay

    Jani Nikula <jani.nikula@intel.com>:
    Patch series "relay: cleanup and const callbacks", v2:
      relay: remove unused buf_mapped and buf_unmapped callbacks
      relay: require non-NULL callbacks in relay_open()
      relay: make create_buf_file and remove_buf_file callbacks mandatory
      relay: allow the use of const callback structs
      drm/i915: make relay callbacks const
      ath10k: make relay callbacks const
      ath11k: make relay callbacks const
      ath9k: make relay callbacks const
      blktrace: make relay callbacks const

Subsystem: resource

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      kernel/resource.c: fix kernel-doc markups

Subsystem: ubsan

    Kees Cook <keescook@chromium.org>:
    Patch series "Clean up UBSAN Makefile", v2:
      ubsan: remove redundant -Wno-maybe-uninitialized
      ubsan: move cc-option tests into Kconfig
      ubsan: disable object-size sanitizer under GCC
      ubsan: disable UBSAN_TRAP for all*config
      ubsan: enable for all*config builds
      ubsan: remove UBSAN_MISC in favor of individual options
      ubsan: expand tests and reporting

    Dmitry Vyukov <dvyukov@google.com>:
      kcov: don't instrument with UBSAN

    Zou Wei <zou_wei@huawei.com>:
      lib/ubsan.c: mark type_check_kinds with static keyword

Subsystem: reboot

    Matteo Croce <mcroce@microsoft.com>:
      reboot: refactor and comment the cpu selection code
      reboot: allow to specify reboot mode via sysfs
      reboot: remove cf9_safe from allowed types and rename cf9_force
    Patch series "reboot: sysfs improvements":
      reboot: allow to override reboot type if quirks are found
      reboot: hide from sysfs not applicable settings

Subsystem: fault-injection

    Barnabás Pőcze <pobrn@protonmail.com>:
      fault-injection: handle EI_ETYPE_TRUE

Subsystem: lzo

    Jason Yan <yanaijie@huawei.com>:
      lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static

Subsystem: apparmor

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      apparmor: remove duplicate macro list_entry_is_head()

Subsystem: mm/pagemap

    Christoph Hellwig <hch@lst.de>:
    Patch series "simplify follow_pte a bit":
      mm: unexport follow_pte_pmd
      mm: simplify follow_pte{,pmd}

Subsystem: mm/cleanups

    Haitao Shi <shihaitao1@huawei.com>:
      mm: fix some spelling mistakes in comments

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mmap locking API: don't check locking if the mm isn't live yet
      mm/gup: assert that the mmap lock is held in __get_user_pages()

 Documentation/ABI/testing/sysfs-kernel-reboot    |   32 
 Documentation/admin-guide/kdump/vmcoreinfo.rst   |    6 
 Documentation/dev-tools/ubsan.rst                |    1 
 Documentation/filesystems/proc.rst               |    2 
 MAINTAINERS                                      |    5 
 arch/alpha/kernel/process.c                      |    2 
 arch/powerpc/kernel/vmlinux.lds.S                |    4 
 arch/s390/pci/pci_mmio.c                         |    4 
 drivers/gpio/gpio-thunderx.c                     |   11 
 drivers/gpio/gpio-xilinx.c                       |   61 -
 drivers/gpu/drm/i915/gt/uc/intel_guc_log.c       |    2 
 drivers/misc/lkdtm/Makefile                      |    1 
 drivers/misc/lkdtm/bugs.c                        |   50 +
 drivers/misc/lkdtm/core.c                        |    3 
 drivers/misc/lkdtm/fortify.c                     |   82 ++
 drivers/misc/lkdtm/lkdtm.h                       |   19 
 drivers/net/wireless/ath/ath10k/spectral.c       |    2 
 drivers/net/wireless/ath/ath11k/spectral.c       |    2 
 drivers/net/wireless/ath/ath9k/common-spectral.c |    2 
 drivers/rapidio/rio.c                            |   81 --
 fs/bfs/inode.c                                   |    2 
 fs/dax.c                                         |    9 
 fs/exec.c                                        |    8 
 fs/nfs/callback_proc.c                           |    5 
 fs/nilfs2/segment.c                              |    5 
 fs/proc/array.c                                  |   28 
 fs/proc/base.c                                   |    2 
 fs/proc/generic.c                                |   24 
 fs/proc/internal.h                               |   10 
 fs/proc/proc_net.c                               |   20 
 include/asm-generic/bitops/find.h                |   19 
 include/asm-generic/getorder.h                   |    2 
 include/linux/bitmap.h                           |   67 +-
 include/linux/bitops.h                           |   24 
 include/linux/dcache.h                           |    1 
 include/linux/iommu-helper.h                     |    4 
 include/linux/kernel.h                           |  173 -----
 include/linux/log2.h                             |    3 
 include/linux/math.h                             |  177 +++++
 include/linux/mm.h                               |    6 
 include/linux/mm_types.h                         |   10 
 include/linux/mmap_lock.h                        |   16 
 include/linux/proc_fs.h                          |    8 
 include/linux/rcu_node_tree.h                    |    2 
 include/linux/relay.h                            |   29 
 include/linux/rio_drv.h                          |    3 
 include/linux/string.h                           |   75 +-
 include/linux/units.h                            |    2 
 kernel/Makefile                                  |    3 
 kernel/acct.c                                    |    7 
 kernel/crash_core.c                              |    1 
 kernel/fail_function.c                           |    6 
 kernel/gcov/gcc_4_7.c                            |   10 
 kernel/reboot.c                                  |  308 ++++++++-
 kernel/relay.c                                   |  111 ---
 kernel/resource.c                                |   24 
 kernel/trace/blktrace.c                          |    2 
 lib/Kconfig.debug                                |   11 
 lib/Kconfig.ubsan                                |  154 +++-
 lib/Makefile                                     |    7 
 lib/bits_kunit.c                                 |   75 ++
 lib/cmdline.c                                    |   20 
 lib/cmdline_kunit.c                              |  100 +++
 lib/errname.c                                    |    1 
 lib/error-inject.c                               |    2 
 lib/errseq.c                                     |    1 
 lib/find_bit.c                                   |   17 
 lib/linear_ranges_kunit.c                        |  228 +++++++
 lib/list-test.c                                  |  748 -----------------------
 lib/list_kunit.c                                 |  748 +++++++++++++++++++++++
 lib/lz4/lz4_decompress.c                         |    6 
 lib/lz4/lz4defs.h                                |    1 
 lib/lzo/lzo1x_compress.c                         |    2 
 lib/math/div64.c                                 |    4 
 lib/math/int_pow.c                               |    2 
 lib/math/int_sqrt.c                              |    3 
 lib/math/reciprocal_div.c                        |    9 
 lib/stackdepot.c                                 |   11 
 lib/string.c                                     |    4 
 lib/test_bitmap.c                                |  143 ++++
 lib/test_bits.c                                  |   75 --
 lib/test_firmware.c                              |    9 
 lib/test_free_pages.c                            |    5 
 lib/test_kmod.c                                  |   26 
 lib/test_linear_ranges.c                         |  228 -------
 lib/test_lockup.c                                |   16 
 lib/test_ubsan.c                                 |   74 ++
 lib/ubsan.c                                      |    2 
 mm/filemap.c                                     |    2 
 mm/gup.c                                         |    2 
 mm/huge_memory.c                                 |    2 
 mm/khugepaged.c                                  |    2 
 mm/memblock.c                                    |    2 
 mm/memory.c                                      |   36 -
 mm/memory_hotplug.c                              |    2 
 mm/migrate.c                                     |    2 
 mm/page_ext.c                                    |    2 
 mm/swapfile.c                                    |   11 
 scripts/Makefile.ubsan                           |   49 -
 scripts/checkpatch.pl                            |  495 +++++++++++----
 security/apparmor/apparmorfs.c                   |    3 
 tools/testing/selftests/lkdtm/tests.txt          |    1 
 102 files changed, 3022 insertions(+), 1899 deletions(-)

Re: incoming

[Andrew Morton]

On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:

> On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > I will try to apply it on top of my merge of your previous series instead.
> 
> Yes, then it applies cleanly. So apparently we just have different
> concepts of what really constitutes a "base" for applying your series.
> 

oop, sorry, yes, the "based on" thing was wrong because I had two
series in flight simultaneously.  I've never tried that before..

Re: incoming

[Linus Torvalds]

On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> I will try to apply it on top of my merge of your previous series instead.

Yes, then it applies cleanly. So apparently we just have different
concepts of what really constitutes a "base" for applying your series.

              Linus

Re: incoming

[Linus Torvalds]

On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

With your re-send, I get all patches, but they don't actually apply cleanly.

Is that base correct?

I get

  error: patch failed: mm/huge_memory.c:2750
  error: mm/huge_memory.c: patch does not apply
  Patch failed at 0004 mm/thp: narrow lru locking

for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's
definitely true: the patch fragment has

@@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page
                                __dec_lruvec_page_state(head, NR_FILE_THPS);
                }

-               __split_huge_page(page, list, end, flags);
+               __split_huge_page(page, list, end);
                ret = 0;
        } else {
                if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) {

but that __dec_lruvec_page_state() conversion was done by your
previous commit series.

So I have the feeling that what you actually mean by "base" isn't
actually really the base for that series at all..

I will try to apply it on top of my merge of your previous series instead.

              Linus

Re: incoming

[Linus Torvalds]

On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

I'm not seeing patch 10/19 at all.

And patch 19/19 is corrupted and has an attachment with a '^P'
character in it. I could fix it up, but with the missing patch in the
middle I'm not going to even try. 'b4' is also very unhappy about that
patch 19/19.

I don't know what went wrong, but I'll ignore this send - please
re-send the series at your leisure, ok?

            Linus

incoming

[Andrew Morton]

- more MM work: a memcg scalability improvememt

19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.

Subsystems affected by this patch series:


    Alex Shi <alex.shi@linux.alibaba.com>:
    Patch series "per memcg lru lock", v21:
      mm/thp: move lru_add_page_tail() to huge_memory.c
      mm/thp: use head for head page in lru_add_page_tail()
      mm/thp: simplify lru_add_page_tail()
      mm/thp: narrow lru locking
      mm/vmscan: remove unnecessary lruvec adding
      mm/rmap: stop store reordering issue on page->mapping

    Hugh Dickins <hughd@google.com>:
      mm: page_idle_get_page() does not need lru_lock

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: add debug checking in lock_page_memcg
      mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn
      mm/lru: move lock into lru_note_cost
      mm/vmscan: remove lruvec reget in move_pages_to_lru
      mm/mlock: remove lru_lock on TestClearPageMlocked
      mm/mlock: remove __munlock_isolate_lru_page()
      mm/lru: introduce TestClearPageLRU()
      mm/compaction: do page isolation first in compaction
      mm/swap.c: serialize memcg changes in pagevec_lru_move_fn
      mm/lru: replace pgdat lru_lock with lruvec lock

    Alexander Duyck <alexander.h.duyck@linux.intel.com>:
      mm/lru: introduce relock_page_lruvec()

    Hugh Dickins <hughd@google.com>:
      mm/lru: revise the comments of lru_lock

 Documentation/admin-guide/cgroup-v1/memcg_test.rst |   15 -
 Documentation/admin-guide/cgroup-v1/memory.rst     |   23 -
 Documentation/trace/events-kmem.rst                |    2 
 Documentation/vm/unevictable-lru.rst               |   22 -
 include/linux/memcontrol.h                         |  110 +++++++
 include/linux/mm_types.h                           |    2 
 include/linux/mmzone.h                             |    6 
 include/linux/page-flags.h                         |    1 
 include/linux/swap.h                               |    4 
 mm/compaction.c                                    |   98 ++++---
 mm/filemap.c                                       |    4 
 mm/huge_memory.c                                   |  109 ++++---
 mm/memcontrol.c                                    |   84 +++++-
 mm/mlock.c                                         |   93 ++----
 mm/mmzone.c                                        |    1 
 mm/page_alloc.c                                    |    1 
 mm/page_idle.c                                     |    4 
 mm/rmap.c                                          |   12 
 mm/swap.c                                          |  292 ++++++++-------------
 mm/vmscan.c                                        |  239 ++++++++---------
 mm/workingset.c                                    |    2 
 21 files changed, 644 insertions(+), 480 deletions(-)

Re: incoming

[Konstantin Ryabitsev]

On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote:
> > All the patches except for _one_ get a nice little green check-mark
> > next to them when I use 'git am' on this series.
> >
> > The one that did not was [patch 192/200].
> >
> > I have no idea why
> 
> Hmm. It looks like that patch is the only one in the series with the
> ">From" marker in the commit message, from the silly "clarify that
> this isn't the first line in a new message in mbox format".
> 
> And "b4 am" has turned the single ">" into two, making the stupid
> marker worse, and actually corrupting the end result.

It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted 
.mbox files, while Python's mailbox.mbox consumes mboxo only. The main 
distinction between the two is precisely that mboxrd will convert 
">From " into ">>From " in an attempt to avoid corruption during
escape/unescape (it didn't end up fixing the problem 100% and mostly 
introduced incompatibilities like this one).

I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the 
end of the week.

Thanks for the report.

-K

Re: incoming

[Linus Torvalds]

On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> All the patches except for _one_ get a nice little green check-mark
> next to them when I use 'git am' on this series.
>
> The one that did not was [patch 192/200].
>
> I have no idea why

Hmm. It looks like that patch is the only one in the series with the
">From" marker in the commit message, from the silly "clarify that
this isn't the first line in a new message in mbox format".

And "b4 am" has turned the single ">" into two, making the stupid
marker worse, and actually corrupting the end result.

Coincidence? Or cause?

            Linus

Re: incoming

[Linus Torvalds]

On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.

I haven't actually processed the patches yet, but I have a question
for Konstantin wrt b4.

All the patches except for _one_ get a nice little green check-mark
next to them when I use 'git am' on this series.

The one that did not was [patch 192/200].

I have no idea why - and it doesn't matter a lot to me, it just stood
out as being different. I'm assuming Andrew has started doing patch
attestation, and that patch failed. But if so, maybe Konstantin wants
to know what went wrong.

Konstantin?

            Linus

incoming

[Andrew Morton]

- a few random little subsystems

- almost all of the MM patches which are staged ahead of linux-next
  material.  I'll trickle to post-linux-next work in as the dependents
  get merged up.


200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.

Subsystems affected by this patch series:

  kthread
  kbuild
  ide
  ntfs
  ocfs2
  arch
  mm/slab-generic
  mm/slab
  mm/slub
  mm/dax
  mm/debug
  mm/pagecache
  mm/gup
  mm/swap
  mm/shmem
  mm/memcg
  mm/pagemap
  mm/mremap
  mm/hmm
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/pagealloc
  mm/memory-failure
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/compaction
  mm/oom-kill
  mm/migration
  mm/cma
  mm/page-poison
  mm/userfaultfd
  mm/zswap
  mm/zsmalloc
  mm/uaccess
  mm/zram
  mm/cleanups

Subsystem: kthread

    Rob Clark <robdclark@chromium.org>:
      kthread: add kthread_work tracepoints

    Petr Mladek <pmladek@suse.com>:
      kthread_worker: document CPU hotplug handling

Subsystem: kbuild

    Petr Vorel <petr.vorel@gmail.com>:
      uapi: move constants from <linux/kernel.h> to <linux/const.h>

Subsystem: ide

    Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
      ide/falcon: remove in_interrupt() usage
      ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()

Subsystem: ntfs

    Alex Shi <alex.shi@linux.alibaba.com>:
      fs/ntfs: remove unused varibles
      fs/ntfs: remove unused variable attr_len

Subsystem: ocfs2

    Tom Rix <trix@redhat.com>:
      fs/ocfs2/cluster/tcp.c: remove unneeded break

    Mauricio Faria de Oliveira <mfo@canonical.com>:
      ocfs2: ratelimit the 'max lookup times reached' notice

Subsystem: arch

    Colin Ian King <colin.king@canonical.com>:
      arch/Kconfig: fix spelling mistakes

Subsystem: mm/slab-generic

    Hui Su <sh_def@163.com>:
      mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
    Patch series "slab: provide and use krealloc_array()", v3:
      mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
      mm: slab: provide krealloc_array()
      ALSA: pcm: use krealloc_array()
      vhost: vringh: use krealloc_array()
      pinctrl: use krealloc_array()
      edac: ghes: use krealloc_array()
      drm: atomic: use krealloc_array()
      hwtracing: intel: use krealloc_array()
      dma-buf: use krealloc_array()

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slab, slub: clear the slab_cache field when freeing page

Subsystem: mm/slab

    Alexander Popov <alex.popov@linux.com>:
      mm/slab: rerform init_on_free earlier

Subsystem: mm/slub

    Vlastimil Babka <vbabka@suse.cz>:
      mm, slub: use kmem_cache_debug_flags() in deactivate_slab()

    Bharata B Rao <bharata@linux.ibm.com>:
      mm/slub: let number of online CPUs determine the slub page order

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
      device-dax/kmem: use struct_size()

Subsystem: mm/debug

    Zhenhua Huang <zhenhuah@codeaurora.org>:
      mm: fix page_owner initializing issue for arm32

    Liam Mark <lmark@codeaurora.org>:
      mm/page_owner: record timestamp and pid

Subsystem: mm/pagecache

    Kent Overstreet <kent.overstreet@gmail.com>:
    Patch series "generic_file_buffered_read() improvements", v2:
      mm/filemap/c: break generic_file_buffered_read up into multiple functions
      mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/truncate: add parameter explanation for invalidate_mapping_pagevec

    Hailong Liu <carver4lio@163.com>:
      mm/filemap.c: remove else after a return

Subsystem: mm/gup

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3:
      mm/gup_benchmark: rename to mm/gup_test
      selftests/vm: use a common gup_test.h
      selftests/vm: rename run_vmtests --> run_vmtests.sh
      selftests/vm: minor cleanup: Makefile and gup_test.c
      selftests/vm: only some gup_test items are really benchmarks
      selftests/vm: gup_test: introduce the dump_pages() sub-test
      selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
      selftests/vm: hmm-tests: remove the libhugetlbfs dependency
      selftests/vm: 2x speedup for run_vmtests.sh

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/gup_test.c: mark gup_test_init as __init function
      mm/gup_test: GUP_TEST depends on DEBUG_FS

    Jason Gunthorpe <jgg@nvidia.com>:
    Patch series "Add a seqcount between gup_fast and copy_page_range()", v4:
      mm/gup: reorganize internal_get_user_pages_fast()
      mm/gup: prevent gup_fast from racing with COW during fork
      mm/gup: remove the vma allocation from gup_longterm_locked()
      mm/gup: combine put_compound_head() and unpin_user_page()

Subsystem: mm/swap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: handle zone device pages in release_pages()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
      mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
      mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
      mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE

    Jeff Layton <jlayton@kernel.org>:
      mm: remove pagevec_lookup_range_nr_tag()

Subsystem: mm/shmem

    Hui Su <sh_def@163.com>:
      mm/shmem.c: make shmem_mapping() inline

    Randy Dunlap <rdunlap@infradead.org>:
      tmpfs: fix Documentation nits

Subsystem: mm/memcg

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: memcontrol: add file_thp, shmem_thp to memory.stat

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: remove unused mod_memcg_obj_state()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix return of child memcg objcg for root memcg
      mm: memcg/slab: fix use after free in obj_cgroup_charge

    Shakeel Butt <shakeelb@google.com>:
      mm/rmap: always do TTU_IGNORE_ACCESS

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: update page struct member in comments

    Roman Gushchin <guro@fb.com>:
      mm: memcg: fix obsolete code comments
    Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1:
      mm: memcg: deprecate the non-hierarchical mode
      docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
      cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy

    Hui Su <sh_def@163.com>:
      mm/page_counter: use page_counter_read in page_counter_set_max

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      mm: memcg: remove obsolete memcg_has_children()

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state

    Kaixu Xia <kaixuxia@tencent.com>:
      mm: memcontrol: sssign boolean values to a bool variable

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memcg: remove incorrect comment

    Shakeel Butt <shakeelb@google.com>:
    Patch series "memcg: add pagetable comsumption to memory.stat", v2:
      mm: move lruvec stats update functions to vmstat.h
      mm: memcontrol: account pagetables per node

Subsystem: mm/pagemap

    Dan Williams <dan.j.williams@intel.com>:
      xen/unpopulated-alloc: consolidate pgmap manipulation

    Kalesh Singh <kaleshsingh@google.com>:
    Patch series "Speed up mremap on large regions", v4:
      kselftests: vm: add mremap tests
      mm: speedup mremap on 1GB or larger regions
      arm64: mremap speedup - enable HAVE_MOVE_PUD
      x86: mremap speedup - Enable HAVE_MOVE_PUD

    John Hubbard <jhubbard@nvidia.com>:
      mm: cleanup: remove unused tsk arg from __access_remote_vm

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/mapping_dirty_helpers: enhance the kernel-doc markups
      mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte

    Axel Rasmussen <axelrasmussen@google.com>:
      mm: mmap_lock: add tracepoints around lock acquisition

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      sparc: fix handling of page table constructor failure
      mm: move free_unref_page to mm/internal.h

Subsystem: mm/mremap

    Dmitry Safonov <dima@arista.com>:
    Patch series "mremap: move_vma() fixes":
      mm/mremap: account memory on do_munmap() failure
      mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
      mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
      vm_ops: rename .split() callback to .may_split()
      mremap: check if it's possible to split original vma
      mm: forbid splitting special mappings

Subsystem: mm/hmm

    Daniel Vetter <daniel.vetter@ffwll.ch>:
      mm: track mmu notifiers in fs_reclaim_acquire/release
      mm: extract might_alloc() debug check
      locking/selftests: add testcases for fs_reclaim

Subsystem: mm/vmalloc

    Andrew Morton <akpm@linux-foundation.org>:
      mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow

    "Uladzislau Rezki (Sony)" <urezki@gmail.com>:
      mm/vmalloc: use free_vm_area() if an allocation fails
      mm/vmalloc: rework the drain logic

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse

    Baolin Wang <baolin.wang@linux.alibaba.com>:
      mm/vmalloc.c: remove unnecessary return statement

    Waiman Long <longman@redhat.com>:
      mm/vmalloc: Fix unlock order in s_stop()

Subsystem: mm/documentation

    Alex Shi <alex.shi@linux.alibaba.com>:
      docs/vm: remove unused 3 items explanation for /proc/vmstat

Subsystem: mm/kasan

    Vincenzo Frascino <vincenzo.frascino@arm.com>:
      mm/vmalloc.c: fix kasan shadow poisoning size

    Walter Wu <walter-zh.wu@mediatek.com>:
    Patch series "kasan: add workqueue stack for generic KASAN", v5:
      workqueue: kasan: record workqueue stack
      kasan: print workqueue stack
      lib/test_kasan.c: add workqueue test case
      kasan: update documentation for generic kasan

    Marco Elver <elver@google.com>:
      lkdtm: disable KASAN for rodata.o

Subsystem: mm/pagealloc

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "arch, mm: deprecate DISCONTIGMEM", v2:
      alpha: switch from DISCONTIGMEM to SPARSEMEM
      ia64: remove custom __early_pfn_to_nid()
      ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
      ia64: discontig: paging_init(): remove local max_pfn calculation
      ia64: split virtual map initialization out of paging_init()
      ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
      ia64: make SPARSEMEM default and disable DISCONTIGMEM
      arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
      arm, arm64: move free_unused_memmap() to generic mm
      arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
      m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
      m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
      m68k: deprecate DISCONTIGMEM
    Patch series "arch, mm: improve robustness of direct map manipulation", v7:
      mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
      PM: hibernate: make direct map manipulations more explicit
      arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
      arch, mm: make kernel_page_present() always available

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "disable pcplists during memory offline", v3:
      mm, page_alloc: clean up pageset high and batch update
      mm, page_alloc: calculate pageset high and batch once per zone
      mm, page_alloc: remove setup_pageset()
      mm, page_alloc: simplify pageset_update()
      mm, page_alloc: cache pageset high and batch in struct zone
      mm, page_alloc: move draining pcplists to page isolation users
      mm, page_alloc: disable pcplists during memory offline

    Miaohe Lin <linmiaohe@huawei.com>:
      include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/page-flags: fix comment
      mm/page_alloc: add __free_pages() documentation

    Zou Wei <zou_wei@huawei.com>:
      mm/page_alloc: mark some symbols with static keyword

    David Hildenbrand <david@redhat.com>:
      mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1

    Lin Feng <linf@wangsu.com>:
      init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set

    Lorenzo Stoakes <lstoakes@gmail.com>:
      mm: page_alloc: refactor setup_per_zone_lowmem_reserve()

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_alloc: speed up the iteration of max_order

Subsystem: mm/memory-failure

    Oscar Salvador <osalvador@suse.de>:
    Patch series "HWpoison: further fixes and cleanups", v5:
      mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
      mm,hwpoison: take free pages off the buddy freelists
      mm,hwpoison: drop unneeded pcplist draining
    Patch series "HWPoison: Refactor get page interface", v2:
      mm,hwpoison: refactor get_any_page
      mm,hwpoison: disable pcplists before grabbing a refcount
      mm,hwpoison: remove drain_all_pages from shake_page
      mm,memory_failure: always pin the page in madvise_inject_error
      mm,hwpoison: return -EBUSY when migration fails

Subsystem: mm/hugetlb

    Hui Su <sh_def@163.com>:
      mm/hugetlb.c: just use put_page_testzero() instead of page_count()

    Ralph Campbell <rcampbell@nvidia.com>:
      include/linux/huge_mm.h: remove extern keyword

    Alex Shi <alex.shi@linux.alibaba.com>:
      khugepaged: add parameter explanations for kernel-doc markup

    Liu Xiang <liu.xiang@zlingsmart.com>:
      mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()

    Oscar Salvador <osalvador@suse.de>:
      mm,hugetlb: remove unneeded initialization

    Dan Carpenter <dan.carpenter@oracle.com>:
      hugetlb: fix an error code in hugetlb_reserve_pages()

Subsystem: mm/vmscan

    Johannes Weiner <hannes@cmpxchg.org>:
      mm: don't wake kswapd prematurely when watermark boosting is disabled

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      mm/vmscan: drop unneeded assignment in kswapd()

    "logic.yu" <hymmsx.yu@gmail.com>:
      mm/vmscan.c: remove the filename in the top of file comment

    Muchun Song <songmuchun@bytedance.com>:
      mm/page_isolation: do not isolate the max order page

Subsystem: mm/z3fold

    Vitaly Wool <vitaly.wool@konsulko.com>:
    Patch series "z3fold: stability / rt fixes":
      z3fold: simplify freeing slots
      z3fold: stricter locking and more careful reclaim
      z3fold: remove preempt disabled sections for RT

Subsystem: mm/compaction

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()

    Hui Su <sh_def@163.com>:
      mm/compaction: move compaction_suitable's comment to right place
      mm/compaction: make defer_compaction and compaction_deferred static

Subsystem: mm/oom-kill

    Hui Su <sh_def@163.com>:
      mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()

Subsystem: mm/migration

    Long Li <lonuxli.64@gmail.com>:
      mm/migrate.c: fix comment spelling

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate.c: optimize migrate_vma_pages() mmu notifier

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: support THPs in zero_user_segments

    Yang Shi <shy828301@gmail.com>:
    Patch series "mm: misc migrate cleanup and improvement", v3:
      mm: truncate_complete_page() does not exist any more
      mm: migrate: simplify the logic for handling permanent failure
      mm: migrate: skip shared exec THP for NUMA balancing
      mm: migrate: clean up migrate_prep{_local}
      mm: migrate: return -ENOSYS if THP migration is unsupported

    Stephen Zhang <starzhangzsd@gmail.com>:
      mm: migrate: remove unused parameter in migrate_vma_insert_page()

Subsystem: mm/cma

    Lecopzer Chen <lecopzer.chen@mediatek.com>:
      mm/cma.c: remove redundant cma_mutex lock

    Charan Teja Reddy <charante@codeaurora.org>:
      mm: cma: improve pr_debug log in cma_release()

Subsystem: mm/page-poison

    Vlastimil Babka <vbabka@suse.cz>:
    Patch series "cleanup page poisoning", v3:
      mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
      mm, page_poison: use static key more efficiently
      kernel/power: allow hibernation with page_poison sanity checking
      mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
      mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO

Subsystem: mm/userfaultfd

    Lokesh Gidra <lokeshgidra@google.com>:
    Patch series "Control over userfaultfd kernel-fault handling", v6:
      userfaultfd: add UFFD_USER_MODE_ONLY
      userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: selftests: make __{s,u}64 format specifiers portable

    Peter Xu <peterx@redhat.com>:
    Patch series "userfaultfd: selftests: Small fixes":
      userfaultfd/selftests: always dump something in modes
      userfaultfd/selftests: fix retval check for userfaultfd_open()
      userfaultfd/selftests: hint the test runner on required privilege

Subsystem: mm/zswap

    Joe Perches <joe@perches.com>:
      mm/zswap: make struct kernel_param_ops definitions const

    YueHaibing <yuehaibing@huawei.com>:
      mm/zswap: fix passing zero to 'PTR_ERR' warning

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/zswap: move to use crypto_acomp API for hardware acceleration

Subsystem: mm/zsmalloc

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/zsmalloc.c: rework the list_add code in insert_zspage()

Subsystem: mm/uaccess

    Colin Ian King <colin.king@canonical.com>:
      mm/process_vm_access: remove redundant initialization of iov_r

Subsystem: mm/zram

    Minchan Kim <minchan@kernel.org>:
      zram: support page writeback
      zram: add stat to gather incompressible pages since zram set up

    Rui Salvaterra <rsalvaterra@gmail.com>:
      zram: break the strict dependency from lzo

Subsystem: mm/cleanups

    Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
      mm: fix kernel-doc markups

    Joe Perches <joe@perches.com>:
    Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2:
      mm: use sysfs_emit for struct kobject * uses
      mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
      mm:backing-dev: use sysfs_emit in macro defining functions
      mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
      mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      mm: fix fall-through warnings for Clang

    Alexey Dobriyan <adobriyan@gmail.com>:
      mm: cleanup kstrto*() usage

 /mmap_lock.h                                         |  107 ++
 a/Documentation/admin-guide/blockdev/zram.rst        |    6 
 a/Documentation/admin-guide/cgroup-v1/memcg_test.rst |    8 
 a/Documentation/admin-guide/cgroup-v1/memory.rst     |   42 
 a/Documentation/admin-guide/cgroup-v2.rst            |   11 
 a/Documentation/admin-guide/mm/transhuge.rst         |   15 
 a/Documentation/admin-guide/sysctl/vm.rst            |   15 
 a/Documentation/core-api/memory-allocation.rst       |    4 
 a/Documentation/core-api/pin_user_pages.rst          |    8 
 a/Documentation/dev-tools/kasan.rst                  |    5 
 a/Documentation/filesystems/tmpfs.rst                |    8 
 a/Documentation/vm/memory-model.rst                  |    3 
 a/Documentation/vm/page_owner.rst                    |   12 
 a/arch/Kconfig                                       |   21 
 a/arch/alpha/Kconfig                                 |    8 
 a/arch/alpha/include/asm/mmzone.h                    |   14 
 a/arch/alpha/include/asm/page.h                      |    7 
 a/arch/alpha/include/asm/pgtable.h                   |   12 
 a/arch/alpha/include/asm/sparsemem.h                 |   18 
 a/arch/alpha/kernel/setup.c                          |    1 
 a/arch/arc/Kconfig                                   |    3 
 a/arch/arc/include/asm/page.h                        |   20 
 a/arch/arc/mm/init.c                                 |   29 
 a/arch/arm/Kconfig                                   |   12 
 a/arch/arm/kernel/vdso.c                             |    9 
 a/arch/arm/mach-bcm/Kconfig                          |    1 
 a/arch/arm/mach-davinci/Kconfig                      |    1 
 a/arch/arm/mach-exynos/Kconfig                       |    1 
 a/arch/arm/mach-highbank/Kconfig                     |    1 
 a/arch/arm/mach-omap2/Kconfig                        |    1 
 a/arch/arm/mach-s5pv210/Kconfig                      |    1 
 a/arch/arm/mach-tango/Kconfig                        |    1 
 a/arch/arm/mm/init.c                                 |   78 -
 a/arch/arm64/Kconfig                                 |    9 
 a/arch/arm64/include/asm/cacheflush.h                |    1 
 a/arch/arm64/include/asm/pgtable.h                   |    1 
 a/arch/arm64/kernel/vdso.c                           |   41 
 a/arch/arm64/mm/init.c                               |   68 -
 a/arch/arm64/mm/pageattr.c                           |   12 
 a/arch/ia64/Kconfig                                  |   11 
 a/arch/ia64/include/asm/meminit.h                    |    2 
 a/arch/ia64/mm/contig.c                              |   88 --
 a/arch/ia64/mm/discontig.c                           |   44 -
 a/arch/ia64/mm/init.c                                |   14 
 a/arch/ia64/mm/numa.c                                |   30 
 a/arch/m68k/Kconfig.cpu                              |   31 
 a/arch/m68k/include/asm/page.h                       |    2 
 a/arch/m68k/include/asm/page_mm.h                    |    7 
 a/arch/m68k/include/asm/virtconvert.h                |    7 
 a/arch/m68k/mm/init.c                                |   10 
 a/arch/mips/vdso/genvdso.c                           |    4 
 a/arch/nds32/mm/mm-nds32.c                           |    6 
 a/arch/powerpc/Kconfig                               |    5 
 a/arch/riscv/Kconfig                                 |    4 
 a/arch/riscv/include/asm/pgtable.h                   |    2 
 a/arch/riscv/include/asm/set_memory.h                |    1 
 a/arch/riscv/mm/pageattr.c                           |   31 
 a/arch/s390/Kconfig                                  |    4 
 a/arch/s390/configs/debug_defconfig                  |    2 
 a/arch/s390/configs/defconfig                        |    2 
 a/arch/s390/kernel/vdso.c                            |   11 
 a/arch/sparc/Kconfig                                 |    4 
 a/arch/sparc/mm/init_64.c                            |    2 
 a/arch/x86/Kconfig                                   |    5 
 a/arch/x86/entry/vdso/vma.c                          |   17 
 a/arch/x86/include/asm/set_memory.h                  |    1 
 a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c          |    2 
 a/arch/x86/kernel/tboot.c                            |    1 
 a/arch/x86/mm/pat/set_memory.c                       |    6 
 a/drivers/base/node.c                                |    2 
 a/drivers/block/zram/Kconfig                         |   42 
 a/drivers/block/zram/zcomp.c                         |    2 
 a/drivers/block/zram/zram_drv.c                      |   29 
 a/drivers/block/zram/zram_drv.h                      |    1 
 a/drivers/dax/device.c                               |    4 
 a/drivers/dax/kmem.c                                 |    2 
 a/drivers/dma-buf/sync_file.c                        |    3 
 a/drivers/edac/ghes_edac.c                           |    4 
 a/drivers/firmware/efi/efi.c                         |    1 
 a/drivers/gpu/drm/drm_atomic.c                       |    3 
 a/drivers/hwtracing/intel_th/msu.c                   |    2 
 a/drivers/ide/falconide.c                            |    2 
 a/drivers/ide/ide-probe.c                            |    3 
 a/drivers/misc/lkdtm/Makefile                        |    1 
 a/drivers/pinctrl/pinctrl-utils.c                    |    2 
 a/drivers/vhost/vringh.c                             |    3 
 a/drivers/virtio/virtio_balloon.c                    |    6 
 a/drivers/xen/unpopulated-alloc.c                    |   14 
 a/fs/aio.c                                           |    5 
 a/fs/ntfs/file.c                                     |    5 
 a/fs/ntfs/inode.c                                    |    2 
 a/fs/ntfs/logfile.c                                  |    3 
 a/fs/ocfs2/cluster/tcp.c                             |    1 
 a/fs/ocfs2/namei.c                                   |    4 
 a/fs/proc/kcore.c                                    |    2 
 a/fs/proc/meminfo.c                                  |    2 
 a/fs/userfaultfd.c                                   |   20 
 a/include/linux/cgroup-defs.h                        |   15 
 a/include/linux/compaction.h                         |   12 
 a/include/linux/fs.h                                 |    2 
 a/include/linux/gfp.h                                |    2 
 a/include/linux/highmem.h                            |   19 
 a/include/linux/huge_mm.h                            |   93 --
 a/include/linux/memcontrol.h                         |  148 ---
 a/include/linux/migrate.h                            |    4 
 a/include/linux/mm.h                                 |  118 +-
 a/include/linux/mm_types.h                           |    8 
 a/include/linux/mmap_lock.h                          |   94 ++
 a/include/linux/mmzone.h                             |   50 -
 a/include/linux/page-flags.h                         |    6 
 a/include/linux/page_ext.h                           |    8 
 a/include/linux/pagevec.h                            |    3 
 a/include/linux/poison.h                             |    4 
 a/include/linux/rmap.h                               |    1 
 a/include/linux/sched/mm.h                           |   16 
 a/include/linux/set_memory.h                         |    5 
 a/include/linux/shmem_fs.h                           |    6 
 a/include/linux/slab.h                               |   18 
 a/include/linux/vmalloc.h                            |    8 
 a/include/linux/vmstat.h                             |  104 ++
 a/include/trace/events/sched.h                       |   84 +
 a/include/uapi/linux/const.h                         |    5 
 a/include/uapi/linux/ethtool.h                       |    2 
 a/include/uapi/linux/kernel.h                        |    9 
 a/include/uapi/linux/lightnvm.h                      |    2 
 a/include/uapi/linux/mroute6.h                       |    2 
 a/include/uapi/linux/netfilter/x_tables.h            |    2 
 a/include/uapi/linux/netlink.h                       |    2 
 a/include/uapi/linux/sysctl.h                        |    2 
 a/include/uapi/linux/userfaultfd.h                   |    9 
 a/init/main.c                                        |    6 
 a/ipc/shm.c                                          |    8 
 a/kernel/cgroup/cgroup.c                             |   12 
 a/kernel/fork.c                                      |    3 
 a/kernel/kthread.c                                   |   29 
 a/kernel/power/hibernate.c                           |    2 
 a/kernel/power/power.h                               |    2 
 a/kernel/power/snapshot.c                            |   52 +
 a/kernel/ptrace.c                                    |    2 
 a/kernel/workqueue.c                                 |    3 
 a/lib/locking-selftest.c                             |   47 +
 a/lib/test_kasan_module.c                            |   29 
 a/mm/Kconfig                                         |   25 
 a/mm/Kconfig.debug                                   |   28 
 a/mm/Makefile                                        |    4 
 a/mm/backing-dev.c                                   |    8 
 a/mm/cma.c                                           |    6 
 a/mm/compaction.c                                    |   29 
 a/mm/filemap.c                                       |  823 ++++++++++---------
 a/mm/gup.c                                           |  329 ++-----
 a/mm/gup_benchmark.c                                 |  210 ----
 a/mm/gup_test.c                                      |  299 ++++++
 a/mm/gup_test.h                                      |   40 
 a/mm/highmem.c                                       |   52 +
 a/mm/huge_memory.c                                   |   86 +
 a/mm/hugetlb.c                                       |   28 
 a/mm/init-mm.c                                       |    1 
 a/mm/internal.h                                      |    5 
 a/mm/kasan/generic.c                                 |    3 
 a/mm/kasan/report.c                                  |    4 
 a/mm/khugepaged.c                                    |   58 -
 a/mm/ksm.c                                           |   50 -
 a/mm/madvise.c                                       |   14 
 a/mm/mapping_dirty_helpers.c                         |    6 
 a/mm/memblock.c                                      |   80 +
 a/mm/memcontrol.c                                    |  170 +--
 a/mm/memory-failure.c                                |  322 +++----
 a/mm/memory.c                                        |   24 
 a/mm/memory_hotplug.c                                |   44 -
 a/mm/mempolicy.c                                     |    8 
 a/mm/migrate.c                                       |  183 ++--
 a/mm/mm_init.c                                       |    1 
 a/mm/mmap.c                                          |   22 
 a/mm/mmap_lock.c                                     |  230 +++++
 a/mm/mmu_notifier.c                                  |    7 
 a/mm/mmzone.c                                        |   14 
 a/mm/mremap.c                                        |  282 ++++--
 a/mm/nommu.c                                         |    8 
 a/mm/oom_kill.c                                      |   14 
 a/mm/page_alloc.c                                    |  517 ++++++-----
 a/mm/page_counter.c                                  |    4 
 a/mm/page_ext.c                                      |   10 
 a/mm/page_isolation.c                                |   18 
 a/mm/page_owner.c                                    |   17 
 a/mm/page_poison.c                                   |   56 -
 a/mm/page_vma_mapped.c                               |    9 
 a/mm/process_vm_access.c                             |    2 
 a/mm/rmap.c                                          |    9 
 a/mm/shmem.c                                         |   39 
 a/mm/slab.c                                          |   10 
 a/mm/slab.h                                          |    9 
 a/mm/slab_common.c                                   |   10 
 a/mm/slob.c                                          |    6 
 a/mm/slub.c                                          |  156 +--
 a/mm/swap.c                                          |   12 
 a/mm/swap_state.c                                    |    7 
 a/mm/swapfile.c                                      |   14 
 a/mm/truncate.c                                      |   18 
 a/mm/vmalloc.c                                       |  105 +-
 a/mm/vmscan.c                                        |   21 
 a/mm/vmstat.c                                        |    6 
 a/mm/workingset.c                                    |    8 
 a/mm/z3fold.c                                        |  215 ++--
 a/mm/zsmalloc.c                                      |   11 
 a/mm/zswap.c                                         |  193 +++-
 a/sound/core/pcm_lib.c                               |    4 
 a/tools/include/linux/poison.h                       |    6 
 a/tools/testing/selftests/vm/.gitignore              |    4 
 a/tools/testing/selftests/vm/Makefile                |   41 
 a/tools/testing/selftests/vm/check_config.sh         |   31 
 a/tools/testing/selftests/vm/config                  |    2 
 a/tools/testing/selftests/vm/gup_benchmark.c         |  143 ---
 a/tools/testing/selftests/vm/gup_test.c              |  258 +++++
 a/tools/testing/selftests/vm/hmm-tests.c             |   10 
 a/tools/testing/selftests/vm/mremap_test.c           |  344 +++++++
 a/tools/testing/selftests/vm/run_vmtests             |   51 -
 a/tools/testing/selftests/vm/userfaultfd.c           |   94 --
 217 files changed, 4817 insertions(+), 3369 deletions(-)

incoming

[Andrew Morton]

8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c.

Subsystems affected by this patch series:

  mm/pagecache
  proc
  selftests
  kbuild
  mm/kasan
  mm/hugetlb

Subsystem: mm/pagecache

    Andrew Morton <akpm@linux-foundation.org>:
      revert "mm/filemap: add static for function __add_to_page_cache_locked"

Subsystem: proc

    Miles Chen <miles.chen@mediatek.com>:
      proc: use untagged_addr() for pagemap_read addresses

Subsystem: selftests

    Arnd Bergmann <arnd@arndb.de>:
      selftest/fpu: avoid clang warning

Subsystem: kbuild

    Arnd Bergmann <arnd@arndb.de>:
      kbuild: avoid static_assert for genksyms
      initramfs: fix clang build failure
      elfcore: fix building with clang

Subsystem: mm/kasan

    Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
      kasan: fix object remaining in offline per-cpu quarantine

Subsystem: mm/hugetlb

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/hugetlb: clear compound_nr before freeing gigantic pages

 fs/proc/task_mmu.c        |    8 ++++++--
 include/linux/build_bug.h |    5 +++++
 include/linux/elfcore.h   |   22 ++++++++++++++++++++++
 init/initramfs.c          |    2 +-
 kernel/Makefile           |    1 -
 kernel/elfcore.c          |   26 --------------------------
 lib/Makefile              |    3 ++-
 mm/filemap.c              |    2 +-
 mm/hugetlb.c              |    1 +
 mm/kasan/quarantine.c     |   39 +++++++++++++++++++++++++++++++++++++++
 10 files changed, 77 insertions(+), 32 deletions(-)

incoming

[Andrew Morton]

12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59.

Subsystems affected by this patch series:

  lib
  coredump
  mm/memcg
  mm/zsmalloc
  mm/swap
  mailmap
  mm/selftests
  mm/pagecache
  mm/hugetlb
  mm/pagemap

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      zlib: export S390 symbols for zlib modules

Subsystem: coredump

    Menglong Dong <dong.menglong@zte.com.cn>:
      coredump: fix core_pattern parse error

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: fix obj_cgroup_charge() return value handling

    Yang Shi <shy828301@gmail.com>:
      mm: list_lru: set shrinker map bit when child nr_items is not zero

Subsystem: mm/zsmalloc

    Minchan Kim <minchan@kernel.org>:
      mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING

Subsystem: mm/swap

    Qian Cai <qcai@redhat.com>:
      mm/swapfile: do not sleep with a spin lock held

Subsystem: mailmap

    Uwe Kleine-König <u.kleine-koenig@pengutronix.de>:
      mailmap: add two more addresses of Uwe Kleine-König

Subsystem: mm/selftests

    Xingxing Su <suxingxing@loongson.cn>:
      tools/testing/selftests/vm: fix build error

    Axel Rasmussen <axelrasmussen@google.com>:
      userfaultfd: selftests: fix SIGSEGV if huge mmap fails

Subsystem: mm/pagecache

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/filemap: add static for function __add_to_page_cache_locked

Subsystem: mm/hugetlb

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb_cgroup: fix offline of hugetlb cgroup with reservations

Subsystem: mm/pagemap

    Liu Zixian <liuzixian4@huawei.com>:
      mm/mmap.c: fix mmap return value when vma is merged after call_mmap()

 .mailmap                                 |    2 +
 arch/arm/configs/omap2plus_defconfig     |    1 
 fs/coredump.c                            |    3 +
 include/linux/zsmalloc.h                 |    1 
 lib/zlib_dfltcc/dfltcc_inflate.c         |    3 +
 mm/Kconfig                               |   13 -------
 mm/filemap.c                             |    2 -
 mm/hugetlb_cgroup.c                      |    8 +---
 mm/list_lru.c                            |   10 ++---
 mm/mmap.c                                |   26 ++++++--------
 mm/slab.h                                |   40 +++++++++++++---------
 mm/swapfile.c                            |    4 +-
 mm/zsmalloc.c                            |   54 -------------------------------
 tools/testing/selftests/vm/Makefile      |    4 ++
 tools/testing/selftests/vm/userfaultfd.c |   25 +++++++++-----
 15 files changed, 75 insertions(+), 121 deletions(-)

incoming

[Andrew Morton]

8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95.

Subsystems affected by this patch series:

  mm/madvise
  kbuild
  mm/pagemap
  mm/readahead
  mm/memcg
  mm/userfaultfd
  vfs-akpm
  mm/madvise

Subsystem: mm/madvise

    Eric Dumazet <edumazet@google.com>:
      mm/madvise: fix memory leak from process_madvise

Subsystem: kbuild

    Nick Desaulniers <ndesaulniers@google.com>:
      compiler-clang: remove version check for BPF Tracing

Subsystem: mm/pagemap

    Dan Williams <dan.j.williams@intel.com>:
      mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports

Subsystem: mm/readahead

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix readahead_page_batch for retry entries

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcg/slab: fix root memcg vmstats

Subsystem: mm/userfaultfd

    Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
      mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault()

Subsystem: vfs-akpm

    Yicong Yang <yangyicong@hisilicon.com>:
      libfs: fix error cast of negative value in simple_attr_write()

Subsystem: mm/madvise

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: fix madvise WILLNEED performance problem

 arch/ia64/include/asm/sparsemem.h    |    6 ++++++
 arch/powerpc/include/asm/mmzone.h    |    5 +++++
 arch/powerpc/include/asm/sparsemem.h |    5 ++---
 arch/powerpc/mm/mem.c                |    1 +
 arch/x86/include/asm/sparsemem.h     |   10 ++++++++++
 arch/x86/mm/numa.c                   |    2 ++
 drivers/dax/Kconfig                  |    1 -
 fs/libfs.c                           |    6 ++++--
 include/linux/compiler-clang.h       |    2 ++
 include/linux/memory_hotplug.h       |   14 --------------
 include/linux/numa.h                 |   30 +++++++++++++++++++++++++++++-
 include/linux/pagemap.h              |    2 ++
 mm/huge_memory.c                     |    9 ++++-----
 mm/madvise.c                         |    4 +---
 mm/memcontrol.c                      |    9 +++++++--
 mm/memory_hotplug.c                  |   18 ------------------
 16 files changed, 75 insertions(+), 49 deletions(-)

incoming

[Andrew Morton]

14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81.

Subsystems affected by this patch series:

  mm/migration
  mm/vmscan
  mailmap
  mm/slub
  mm/gup
  kbuild
  reboot
  kernel/watchdog
  mm/memcg
  mm/hugetlbfs
  panic
  ocfs2

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm/compaction: count pages and stop correctly during page isolation
      mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate

Subsystem: mm/vmscan

    Nicholas Piggin <npiggin@gmail.com>:
      mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit

Subsystem: mailmap

    Dmitry Baryshkov <dbaryshkov@gmail.com>:
      mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov

Subsystem: mm/slub

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm/slub: fix panic in slab_alloc_node()

Subsystem: mm/gup

    Jason Gunthorpe <jgg@nvidia.com>:
      mm/gup: use unpin_user_pages() in __gup_longterm_locked()

Subsystem: kbuild

    Arvind Sankar <nivedita@alum.mit.edu>:
      compiler.h: fix barrier_data() on clang

Subsystem: reboot

    Matteo Croce <mcroce@microsoft.com>:
    Patch series "fix parsing of reboot= cmdline", v3:
      Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint"
      reboot: fix overflow parsing reboot cpu number

Subsystem: kernel/watchdog

    Santosh Sivaraj <santosh@fossix.org>:
      kernel/watchdog: fix watchdog_allowed_mask not used warning

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix missing wakeup polling thread

Subsystem: mm/hugetlbfs

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlbfs: fix anon huge page migration race

Subsystem: panic

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      panic: don't dump stack twice on warn

Subsystem: ocfs2

    Wengang Wang <wen.gang.wang@oracle.com>:
      ocfs2: initialize ip_next_orphan

 .mailmap                       |    5 +-
 fs/ocfs2/super.c               |    1 
 include/asm-generic/barrier.h  |    1 
 include/linux/compiler-clang.h |    6 --
 include/linux/compiler-gcc.h   |   19 --------
 include/linux/compiler.h       |   18 +++++++-
 include/linux/memcontrol.h     |   11 ++++-
 kernel/panic.c                 |    3 -
 kernel/reboot.c                |   28 ++++++------
 kernel/watchdog.c              |    4 -
 mm/compaction.c                |   12 +++--
 mm/gup.c                       |   14 ++++--
 mm/hugetlb.c                   |   90 ++---------------------------------------
 mm/memory-failure.c            |   36 +++++++---------
 mm/migrate.c                   |   46 +++++++++++---------
 mm/rmap.c                      |    5 --
 mm/slub.c                      |    2 
 mm/vmscan.c                    |    5 +-
 18 files changed, 119 insertions(+), 187 deletions(-)

incoming

[Andrew Morton]

15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891.

Subsystems affected by this patch series:

  mm/memremap
  mm/memcg
  mm/slab-generic
  mm/kasan
  mm/mempolicy
  signals
  lib
  mm/pagecache
  kthread
  mm/oom-kill
  mm/pagemap
  epoll
  core-kernel

Subsystem: mm/memremap

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/mremap_pages: fix static key devmap_managed_key updates

Subsystem: mm/memcg

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb_cgroup: fix reservation accounting

    zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
      mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg

    Roman Gushchin <guro@fb.com>:
      mm: memcg: link page counters to root if use_hierarchy is false

Subsystem: mm/slab-generic

Subsystem: mm/kasan

    Andrey Konovalov <andreyknvl@google.com>:
      kasan: adopt KUNIT tests to SW_TAGS mode

Subsystem: mm/mempolicy

    Shijie Luo <luoshijie1@huawei.com>:
      mm: mempolicy: fix potential pte_unmap_unlock pte error

Subsystem: signals

    Oleg Nesterov <oleg@redhat.com>:
      ptrace: fix task_join_group_stop() for the case when current is traced

Subsystem: lib

    Vasily Gorbik <gor@linux.ibm.com>:
      lib/crc32test: remove extra local_irq_disable/enable

Subsystem: mm/pagecache

    Jason Yan <yanaijie@huawei.com>:
      mm/truncate.c: make __invalidate_mapping_pages() static

Subsystem: kthread

    Zqiang <qiang.zhang@windriver.com>:
      kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled

Subsystem: mm/oom-kill

    Charles Haithcock <chaithco@redhat.com>:
      mm, oom: keep oom_adj under or at upper limit when printing

Subsystem: mm/pagemap

    Jason Gunthorpe <jgg@nvidia.com>:
      mm: always have io_remap_pfn_range() set pgprot_decrypted()

Subsystem: epoll

    Soheil Hassas Yeganeh <soheil@google.com>:
      epoll: check ep_events_available() upon timeout
      epoll: add a selftest for epoll timeout race

Subsystem: core-kernel

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      kernel/hung_task.c: make type annotations consistent

 fs/eventpoll.c                                                |   16 +
 fs/proc/base.c                                                |    2 
 include/linux/mm.h                                            |    9 
 include/linux/pgtable.h                                       |    4 
 kernel/hung_task.c                                            |    3 
 kernel/kthread.c                                              |    3 
 kernel/signal.c                                               |   19 -
 lib/crc32test.c                                               |    4 
 lib/test_kasan.c                                              |  149 +++++++---
 mm/hugetlb.c                                                  |   20 -
 mm/memcontrol.c                                               |   25 +
 mm/mempolicy.c                                                |    6 
 mm/memremap.c                                                 |   39 +-
 mm/truncate.c                                                 |    2 
 tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c |   95 ++++++
 15 files changed, 290 insertions(+), 106 deletions(-)

incoming

[Andrew Morton]

40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53.

Subsystems affected by this patch series:

  ia64
  mm/memcg
  mm/migration
  mm/pagemap
  mm/gup
  mm/madvise
  mm/vmalloc
  misc

Subsystem: ia64

    Krzysztof Kozlowski <krzk@kernel.org>:
      ia64: fix build error with !COREDUMP

Subsystem: mm/memcg

    Roman Gushchin <guro@fb.com>:
      mm, memcg: rework remote charging API to support nesting
    Patch series "mm: kmem: kernel memory accounting in an interrupt context":
      mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current()
      mm: kmem: remove redundant checks from get_obj_cgroup_from_current()
      mm: kmem: prepare remote memcg charging infra for interrupt contexts
      mm: kmem: enable kernel memcg accounting from interrupt contexts

Subsystem: mm/migration

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/memory-failure: remove a wrapper for alloc_migration_target()
      mm/memory_hotplug: remove a wrapper for alloc_migration_target()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/migrate: avoid possible unnecessary process right check in kernel_move_pages()

Subsystem: mm/pagemap

    "Liam R. Howlett" <Liam.Howlett@Oracle.com>:
      mm/mmap: add inline vma_next() for readability of mmap code
      mm/mmap: add inline munmap_vma_range() for code readability

Subsystem: mm/gup

    Jann Horn <jannh@google.com>:
      mm/gup_benchmark: take the mmap lock around GUP
      binfmt_elf: take the mmap lock around find_extend_vma()
      mm/gup: assert that the mmap lock is held in __get_user_pages()

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2:
      mm/gup_benchmark: rename to mm/gup_test
      selftests/vm: use a common gup_test.h
      selftests/vm: rename run_vmtests --> run_vmtests.sh
      selftests/vm: minor cleanup: Makefile and gup_test.c
      selftests/vm: only some gup_test items are really benchmarks
      selftests/vm: gup_test: introduce the dump_pages() sub-test
      selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
      selftests/vm: hmm-tests: remove the libhugetlbfs dependency
      selftests/vm: 10x speedup for hmm-tests

Subsystem: mm/madvise

    Minchan Kim <minchan@kernel.org>:
    Patch series "introduce memory hinting API for external process", v9:
      mm/madvise: pass mm to do_madvise
      pid: move pidfd_get_pid() to pid.c
      mm/madvise: introduce process_madvise() syscall: an external memory hinting API

Subsystem: mm/vmalloc

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "remove alloc_vm_area", v4:
      mm: update the documentation for vfree

    Christoph Hellwig <hch@lst.de>:
      mm: add a VM_MAP_PUT_PAGES flag for vmap
      mm: add a vmap_pfn function
      mm: allow a NULL fn callback in apply_to_page_range
      zsmalloc: switch from alloc_vm_area to get_vm_area
      drm/i915: use vmap in shmem_pin_map
      drm/i915: stop using kmap in i915_gem_object_map
      drm/i915: use vmap in i915_gem_object_map
      xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv
      x86/xen: open code alloc_vm_area in arch_gnttab_valloc
      mm: remove alloc_vm_area
    Patch series "two small vmalloc cleanups":
      mm: cleanup the gfp_mask handling in __vmalloc_area_node
      mm: remove the filename in the top of file comment in vmalloc.c

Subsystem: misc

    Tian Tao <tiantao6@hisilicon.com>:
      mm: remove duplicate include statement in mmu.c

 Documentation/core-api/pin_user_pages.rst   |    8 
 arch/alpha/kernel/syscalls/syscall.tbl      |    1 
 arch/arm/mm/mmu.c                           |    1 
 arch/arm/tools/syscall.tbl                  |    1 
 arch/arm64/include/asm/unistd.h             |    2 
 arch/arm64/include/asm/unistd32.h           |    2 
 arch/ia64/kernel/Makefile                   |    2 
 arch/ia64/kernel/syscalls/syscall.tbl       |    1 
 arch/m68k/kernel/syscalls/syscall.tbl       |    1 
 arch/microblaze/kernel/syscalls/syscall.tbl |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl   |    1 
 arch/mips/kernel/syscalls/syscall_n64.tbl   |    1 
 arch/mips/kernel/syscalls/syscall_o32.tbl   |    1 
 arch/parisc/kernel/syscalls/syscall.tbl     |    1 
 arch/powerpc/kernel/syscalls/syscall.tbl    |    1 
 arch/s390/configs/debug_defconfig           |    2 
 arch/s390/configs/defconfig                 |    2 
 arch/s390/kernel/syscalls/syscall.tbl       |    1 
 arch/sh/kernel/syscalls/syscall.tbl         |    1 
 arch/sparc/kernel/syscalls/syscall.tbl      |    1 
 arch/x86/entry/syscalls/syscall_32.tbl      |    1 
 arch/x86/entry/syscalls/syscall_64.tbl      |    1 
 arch/x86/xen/grant-table.c                  |   27 +-
 arch/xtensa/kernel/syscalls/syscall.tbl     |    1 
 drivers/gpu/drm/i915/Kconfig                |    1 
 drivers/gpu/drm/i915/gem/i915_gem_pages.c   |  136 ++++------
 drivers/gpu/drm/i915/gt/shmem_utils.c       |   78 +-----
 drivers/xen/xenbus/xenbus_client.c          |   30 +-
 fs/binfmt_elf.c                             |    3 
 fs/buffer.c                                 |    6 
 fs/io_uring.c                               |    2 
 fs/notify/fanotify/fanotify.c               |    5 
 fs/notify/inotify/inotify_fsnotify.c        |    5 
 include/linux/memcontrol.h                  |   12 
 include/linux/mm.h                          |    2 
 include/linux/pid.h                         |    1 
 include/linux/sched/mm.h                    |   43 +--
 include/linux/syscalls.h                    |    2 
 include/linux/vmalloc.h                     |    7 
 include/uapi/asm-generic/unistd.h           |    4 
 kernel/exit.c                               |   19 -
 kernel/pid.c                                |   19 +
 kernel/sys_ni.c                             |    1 
 mm/Kconfig                                  |   24 +
 mm/Makefile                                 |    2 
 mm/gup.c                                    |    2 
 mm/gup_benchmark.c                          |  225 ------------------
 mm/gup_test.c                               |  295 +++++++++++++++++++++--
 mm/gup_test.h                               |   40 ++-
 mm/madvise.c                                |  125 ++++++++--
 mm/memcontrol.c                             |   83 ++++--
 mm/memory-failure.c                         |   18 -
 mm/memory.c                                 |   16 -
 mm/memory_hotplug.c                         |   46 +--
 mm/migrate.c                                |   71 +++--
 mm/mmap.c                                   |   74 ++++-
 mm/nommu.c                                  |    7 
 mm/percpu.c                                 |    3 
 mm/slab.h                                   |    3 
 mm/vmalloc.c                                |  147 +++++------
 mm/zsmalloc.c                               |   10 
 tools/testing/selftests/vm/.gitignore       |    3 
 tools/testing/selftests/vm/Makefile         |   40 ++-
 tools/testing/selftests/vm/check_config.sh  |   31 ++
 tools/testing/selftests/vm/config           |    2 
 tools/testing/selftests/vm/gup_benchmark.c  |  143 -----------
 tools/testing/selftests/vm/gup_test.c       |  260 ++++++++++++++++++--
 tools/testing/selftests/vm/hmm-tests.c      |   12 
 tools/testing/selftests/vm/run_vmtests      |  334 --------------------------
 tools/testing/selftests/vm/run_vmtests.sh   |  350 +++++++++++++++++++++++++++-
 70 files changed, 1580 insertions(+), 1224 deletions(-)

Re: incoming

[Andrew Morton]

And... I forgot to set in-reply-to :(

Shall resend, omitting linux-mm.

incoming

[Andrew Morton]

- most of the rest of mm/

- various other subsystems

156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d.

Subsystems affected by this patch series:

  mm/dax
  mm/debug
  mm/thp
  mm/readahead
  mm/page-poison
  mm/util
  mm/memory-hotplug
  mm/zram
  mm/cleanups
  misc
  core-kernel
  get_maintainer
  MAINTAINERS
  lib
  bitops
  checkpatch
  binfmt
  ramfs
  autofs
  nilfs
  rapidio
  panic
  relay
  kgdb
  ubsan
  romfs
  fault-injection

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
      device-dax/kmem: fix resource release

Subsystem: mm/debug

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
    Patch series "mm/debug_vm_pgtable fixes", v4:
      powerpc/mm: add DEBUG_VM WARN for pmd_clear
      powerpc/mm: move setting pte specific flags to pfn_pte
      mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value
      mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support.
      mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING
      mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at
      mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry
      mm/debug_vm_pgtable/locks: move non page table modifying test together
      mm/debug_vm_pgtable/locks: take correct page table lock
      mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP
      mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries
      mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64
      mm/debug_vm_pgtable: avoid none pte in pte_clear_test
      mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped.

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Fix read-only THP for non-tmpfs filesystems":
      XArray: add xa_get_order
      XArray: add xas_split
      mm/filemap: fix storing to a THP shadow entry
    Patch series "Remove assumptions of THP size":
      mm/filemap: fix page cache removal for arbitrary sized THPs
      mm/memory: remove page fault assumption of compound page size
      mm/page_owner: change split_page_owner to take a count

    "Kirill A. Shutemov" <kirill@shutemov.name>:
      mm/huge_memory: fix total_mapcount assumption of page size
      mm/huge_memory: fix split assumption of page size

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size
      mm/huge_memory: fix can_split_huge_page assumption of THP size
      mm/rmap: fix assumptions of THP size
      mm/truncate: fix truncation for pages of arbitrary size
      mm/page-writeback: support tail pages in wait_for_stable_page
      mm/vmscan: allow arbitrary sized pages to be paged out
      fs: add a filesystem flag for THPs
      fs: do not update nr_thps for mappings which support THPs

    Huang Ying <ying.huang@intel.com>:
      mm: fix a race during THP splitting

Subsystem: mm/readahead

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Readahead patches for 5.9/5.10":
      mm/readahead: add DEFINE_READAHEAD
      mm/readahead: make page_cache_ra_unbounded take a readahead_control
      mm/readahead: make do_page_cache_ra take a readahead_control

    David Howells <dhowells@redhat.com>:
      mm/readahead: make ondemand_readahead take a readahead_control
      mm/readahead: pass readahead_control to force_page_cache_ra

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/readahead: add page_cache_sync_ra and page_cache_async_ra

    David Howells <dhowells@redhat.com>:
      mm/filemap: fold ra_submit into do_sync_mmap_readahead
      mm/readahead: pass a file_ra_state into force_page_cache_ra

Subsystem: mm/page-poison

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
    Patch series "HWPOISON: soft offline rework", v7:
      mm,hwpoison: cleanup unused PageHuge() check
      mm, hwpoison: remove recalculating hpage
      mm,hwpoison-inject: don't pin for hwpoison_filter

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: unexport get_hwpoison_page and make it static
      mm,hwpoison: refactor madvise_inject_error
      mm,hwpoison: kill put_hwpoison_page
      mm,hwpoison: unify THP handling for hard and soft offline
      mm,hwpoison: rework soft offline for free pages
      mm,hwpoison: rework soft offline for in-use pages
      mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page
      mm,hwpoison: return 0 if the page is already poisoned in soft-offline

    Naoya Horiguchi <naoya.horiguchi@nec.com>:
      mm,hwpoison: introduce MF_MSG_UNSPLIT_THP
      mm,hwpoison: double-check page count in __get_any_page()

    Oscar Salvador <osalvador@suse.de>:
      mm,hwpoison: try to narrow window race for free pages

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/page_poison.c: replace bool variable with static key

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/vmstat.c: use helper macro abs()

Subsystem: mm/util

    Bartosz Golaszewski <bgolaszewski@baylibre.com>:
      mm/util.c: update the kerneldoc for kstrdup_const()

    Jann Horn <jannh@google.com>:
      mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert

Subsystem: mm/memory-hotplug

    David Hildenbrand <david@redhat.com>:
    Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2:
      mm/memory_hotplug: inline __offline_pages() into offline_pages()
      mm/memory_hotplug: enforce section granularity when onlining/offlining
      mm/memory_hotplug: simplify page offlining
      mm/page_alloc: simplify __offline_isolated_pages()
      mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages()
      mm/page_isolation: simplify return value of start_isolate_page_range()
      mm/memory_hotplug: simplify page onlining
      mm/page_alloc: drop stale pageblock comment in memmap_init_zone*()
      mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone()
      mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory
    Patch series "selective merging of system ram resources", v4:
      kernel/resource: make release_mem_region_adjustable() never fail
      kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED
      mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG
      mm/memory_hotplug: prepare passing flags to add_memory() and friends
      mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources
      virtio-mem: try to merge system ram resources
      xen/balloon: try to merge system ram resources
      hv_balloon: try to merge system ram resources
      kernel/resource: make iomem_resource implicit in release_mem_region_adjustable()

    Laurent Dufour <ldufour@linux.ibm.com>:
      mm: don't panic when links can't be created in sysfs

    David Hildenbrand <david@redhat.com>:
    Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2:
      mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag
      mm/page_alloc: place pages to tail in __putback_isolated_page()
      mm/page_alloc: move pages to tail in move_to_free_list()
      mm/page_alloc: place pages to tail in __free_pages_core()
      mm/memory_hotplug: update comment regarding zone shuffling

Subsystem: mm/zram

    Douglas Anderson <dianders@chromium.org>:
      zram: failing to decompress is WARN_ON worthy

Subsystem: mm/cleanups

    YueHaibing <yuehaibing@huawei.com>:
      mm/slab.h: remove duplicate include

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/page_reporting.c: drop stale list head check in page_reporting_cycle

    Ira Weiny <ira.weiny@intel.com>:
      mm/highmem.c: clean up endif comments

    Yu Zhao <yuzhao@google.com>:
      mm: use self-explanatory macros rather than "2"

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: fix some broken comments

    Chen Tao <chentao3@hotmail.com>:
      mm: fix some comments formatting

    Xiaofei Tan <tanxiaofei@huawei.com>:
      mm/workingset.c: fix some doc warnings

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: use helper function put_write_access()

    Mike Rapoport <rppt@linux.ibm.com>:
      include/linux/mmzone.h: remove unused early_pfn_valid()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm: rename page_order() to buddy_order()

Subsystem: misc

    Randy Dunlap <rdunlap@infradead.org>:
      fs: configfs: delete repeated words in comments

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      kernel.h: split out min()/max() et al. helpers

Subsystem: core-kernel

    Liao Pingfang <liao.pingfang@zte.com.cn>:
      kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map()

    Randy Dunlap <rdunlap@infradead.org>:
      kernel/: fix repeated words in comments
      kernel: acct.c: fix some kernel-doc nits

Subsystem: get_maintainer

    Joe Perches <joe@perches.com>:
      get_maintainer: add test for file in VCS

Subsystem: MAINTAINERS

    Joe Perches <joe@perches.com>:
      get_maintainer: exclude MAINTAINERS file(s) from --git-fallback

    Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>:
      MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org

Subsystem: lib

    Randy Dunlap <rdunlap@infradead.org>:
      lib: bitmap: delete duplicated words
      lib: libcrc32c: delete duplicated words
      lib: decompress_bunzip2: delete duplicated words
      lib: dynamic_queue_limits: delete duplicated words + fix typo
      lib: earlycpio: delete duplicated words
      lib: radix-tree: delete duplicated words
      lib: syscall: delete duplicated words
      lib: test_sysctl: delete duplicated words
      lib/mpi/mpi-bit.c: fix spello of "functions"

    Stephen Boyd <swboyd@chromium.org>:
      lib/idr.c: document calling context for IDA APIs mustn't use locks
      lib/idr.c: document that ida_simple_{get,remove}() are deprecated

    Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
      lib/scatterlist.c: avoid a double memset

    Miaohe Lin <linmiaohe@huawei.com>:
      lib/percpu_counter.c: use helper macro abs()

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      include/linux/list.h: add a macro to test if entry is pointing to the head

    Dan Carpenter <dan.carpenter@oracle.com>:
      lib/test_hmm.c: fix an error code in dmirror_allocate_chunk()

    Tobias Jordan <kernel@cdqe.de>:
      lib/crc32.c: fix trivial typo in preprocessor condition

Subsystem: bitops

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      bitops: simplify get_count_order_long()
      bitops: use the same mechanism for get_count_order[_long]

Subsystem: checkpatch

    Jerome Forissier <jerome@forissier.org>:
      checkpatch: add --kconfig-prefix

    Joe Perches <joe@perches.com>:
      checkpatch: move repeated word test
      checkpatch: add test for comma use that should be semicolon

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add phy_ops

    Nicolas Boichat <drinkcat@chromium.org>:
      checkpatch: warn if trace_printk and friends are called

    Rikard Falkeborn <rikard.falkeborn@gmail.com>:
      const_structs.checkpatch: add pinctrl_ops and pinmux_ops

    Joe Perches <joe@perches.com>:
      checkpatch: warn on self-assignments
      checkpatch: allow not using -f with files that are in git

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: extend author Signed-off-by check for split From: header

    Joe Perches <joe@perches.com>:
      checkpatch: emit a warning on embedded filenames

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: fix multi-statement macro checks for while blocks.

    Łukasz Stelmach <l.stelmach@samsung.com>:
      checkpatch: fix false positive on empty block comment lines

    Dwaipayan Ray <dwaipayanray1@gmail.com>:
      checkpatch: add new warnings to author signoff checks.

Subsystem: binfmt

    Chris Kennelly <ckennelly@google.com>:
    Patch series "Selecting Load Addresses According to p_align", v3:
      fs/binfmt_elf: use PT_LOAD p_align values for suitable start address
      tools/testing/selftests: add self-test for verifying load alignment

    Jann Horn <jannh@google.com>:
    Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5:
      binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU
      coredump: let dump_emit() bail out on short writes
      coredump: refactor page range dumping into common helper
      coredump: rework elf/elf_fdpic vma_dump_size() into common helper
      binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot
      mm/gup: take mmap_lock in get_dump_page()
      mm: remove the now-unnecessary mmget_still_valid() hack

Subsystem: ramfs

    Matthew Wilcox (Oracle) <willy@infradead.org>:
      ramfs: fix nommu mmap with gaps in the page cache

Subsystem: autofs

    Matthew Wilcox <willy@infradead.org>:
      autofs: harden ioctl table

Subsystem: nilfs

    Wang Hai <wanghai38@huawei.com>:
      nilfs2: fix some kernel-doc warnings for nilfs2

Subsystem: rapidio

    Souptick Joarder <jrdr.linux@gmail.com>:
      rapidio: fix error handling path

    Jing Xiangfeng <jingxiangfeng@huawei.com>:
      rapidio: fix the missed put_device() for rio_mport_add_riodev

Subsystem: panic

    Alexey Kardashevskiy <aik@ozlabs.ru>:
      panic: dump registers on panic_on_warn

Subsystem: relay

    Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
      kernel/relay.c: drop unneeded initialization

Subsystem: kgdb

    Ritesh Harjani <riteshh@linux.ibm.com>:
      scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command
      scripts/gdb/tasks: add headers and improve spacing format

Subsystem: ubsan

    Elena Petrova <lenaptr@google.com>:
      sched.h: drop in_ubsan field when UBSAN is in trap mode

    George Popescu <georgepope@android.com>:
      ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang

Subsystem: romfs

    Libing Zhou <libing.zhou@nokia-sbell.com>:
      ROMFS: support inode blocks calculation

Subsystem: fault-injection

    Albert van der Linde <alinde@google.com>:
    Patch series "add fault injection to user memory access", v3:
      lib, include/linux: add usercopy failure capability
      lib, uaccess: add failure injection to usercopy functions

 .mailmap                                          |    1 
 Documentation/admin-guide/kernel-parameters.txt   |    1 
 Documentation/core-api/xarray.rst                 |   14 
 Documentation/fault-injection/fault-injection.rst |    7 
 MAINTAINERS                                       |    6 
 arch/ia64/mm/init.c                               |    4 
 arch/powerpc/include/asm/book3s/64/pgtable.h      |   29 +
 arch/powerpc/include/asm/nohash/pgtable.h         |    5 
 arch/powerpc/mm/pgtable.c                         |    5 
 arch/powerpc/platforms/powernv/memtrace.c         |    2 
 arch/powerpc/platforms/pseries/hotplug-memory.c   |    2 
 drivers/acpi/acpi_memhotplug.c                    |    3 
 drivers/base/memory.c                             |    3 
 drivers/base/node.c                               |   33 +-
 drivers/block/zram/zram_drv.c                     |    2 
 drivers/dax/kmem.c                                |   50 ++-
 drivers/hv/hv_balloon.c                           |    4 
 drivers/infiniband/core/uverbs_main.c             |    3 
 drivers/rapidio/devices/rio_mport_cdev.c          |   18 -
 drivers/s390/char/sclp_cmd.c                      |    2 
 drivers/vfio/pci/vfio_pci.c                       |   38 +-
 drivers/virtio/virtio_mem.c                       |    5 
 drivers/xen/balloon.c                             |    4 
 fs/autofs/dev-ioctl.c                             |    8 
 fs/binfmt_elf.c                                   |  267 +++-------------
 fs/binfmt_elf_fdpic.c                             |  176 ++--------
 fs/configfs/dir.c                                 |    2 
 fs/configfs/file.c                                |    2 
 fs/coredump.c                                     |  238 +++++++++++++-
 fs/ext4/verity.c                                  |    4 
 fs/f2fs/verity.c                                  |    4 
 fs/inode.c                                        |    2 
 fs/nilfs2/bmap.c                                  |    2 
 fs/nilfs2/cpfile.c                                |    6 
 fs/nilfs2/page.c                                  |    1 
 fs/nilfs2/sufile.c                                |    4 
 fs/proc/task_mmu.c                                |   18 -
 fs/ramfs/file-nommu.c                             |    2 
 fs/romfs/super.c                                  |    1 
 fs/userfaultfd.c                                  |   28 -
 include/linux/bitops.h                            |   13 
 include/linux/blkdev.h                            |    1 
 include/linux/bvec.h                              |    6 
 include/linux/coredump.h                          |   13 
 include/linux/fault-inject-usercopy.h             |   22 +
 include/linux/fs.h                                |   28 -
 include/linux/idr.h                               |   13 
 include/linux/ioport.h                            |   15 
 include/linux/jiffies.h                           |    3 
 include/linux/kernel.h                            |  150 ---------
 include/linux/list.h                              |   29 +
 include/linux/memory_hotplug.h                    |   42 +-
 include/linux/minmax.h                            |  153 +++++++++
 include/linux/mm.h                                |    5 
 include/linux/mmzone.h                            |   17 -
 include/linux/node.h                              |   16 
 include/linux/nodemask.h                          |    2 
 include/linux/page-flags.h                        |    6 
 include/linux/page_owner.h                        |    6 
 include/linux/pagemap.h                           |  111 ++++++
 include/linux/sched.h                             |    2 
 include/linux/sched/mm.h                          |   25 -
 include/linux/uaccess.h                           |   12 
 include/linux/vmstat.h                            |    2 
 include/linux/xarray.h                            |   22 +
 include/ras/ras_event.h                           |    3 
 kernel/acct.c                                     |   10 
 kernel/cgroup/cpuset.c                            |    2 
 kernel/dma/direct.c                               |    2 
 kernel/fork.c                                     |    4 
 kernel/futex.c                                    |    2 
 kernel/irq/timings.c                              |    2 
 kernel/jump_label.c                               |    2 
 kernel/kcsan/encoding.h                           |    2 
 kernel/kexec_core.c                               |    2 
 kernel/kexec_file.c                               |    2 
 kernel/kthread.c                                  |    2 
 kernel/livepatch/state.c                          |    2 
 kernel/panic.c                                    |   12 
 kernel/pid_namespace.c                            |    2 
 kernel/power/snapshot.c                           |    2 
 kernel/range.c                                    |    3 
 kernel/relay.c                                    |    2 
 kernel/resource.c                                 |  114 +++++--
 kernel/smp.c                                      |    2 
 kernel/sys.c                                      |    2 
 kernel/user_namespace.c                           |    2 
 lib/Kconfig.debug                                 |    7 
 lib/Kconfig.ubsan                                 |   14 
 lib/Makefile                                      |    1 
 lib/bitmap.c                                      |    2 
 lib/crc32.c                                       |    2 
 lib/decompress_bunzip2.c                          |    2 
 lib/dynamic_queue_limits.c                        |    4 
 lib/earlycpio.c                                   |    2 
 lib/fault-inject-usercopy.c                       |   39 ++
 lib/find_bit.c                                    |    1 
 lib/hexdump.c                                     |    1 
 lib/idr.c                                         |    9 
 lib/iov_iter.c                                    |    5 
 lib/libcrc32c.c                                   |    2 
 lib/math/rational.c                               |    2 
 lib/math/reciprocal_div.c                         |    1 
 lib/mpi/mpi-bit.c                                 |    2 
 lib/percpu_counter.c                              |    2 
 lib/radix-tree.c                                  |    2 
 lib/scatterlist.c                                 |    2 
 lib/strncpy_from_user.c                           |    3 
 lib/syscall.c                                     |    2 
 lib/test_hmm.c                                    |    2 
 lib/test_sysctl.c                                 |    2 
 lib/test_xarray.c                                 |   65 ++++
 lib/usercopy.c                                    |    5 
 lib/xarray.c                                      |  208 ++++++++++++
 mm/Kconfig                                        |    2 
 mm/compaction.c                                   |    6 
 mm/debug_vm_pgtable.c                             |  267 ++++++++--------
 mm/filemap.c                                      |   58 ++-
 mm/gup.c                                          |   73 ++--
 mm/highmem.c                                      |    4 
 mm/huge_memory.c                                  |   47 +-
 mm/hwpoison-inject.c                              |   18 -
 mm/internal.h                                     |   47 +-
 mm/khugepaged.c                                   |    2 
 mm/madvise.c                                      |   52 ---
 mm/memory-failure.c                               |  357 ++++++++++------------
 mm/memory.c                                       |    7 
 mm/memory_hotplug.c                               |  223 +++++--------
 mm/memremap.c                                     |    3 
 mm/migrate.c                                      |   11 
 mm/mmap.c                                         |    7 
 mm/mmu_notifier.c                                 |    2 
 mm/page-writeback.c                               |    1 
 mm/page_alloc.c                                   |  289 +++++++++++------
 mm/page_isolation.c                               |   16 
 mm/page_owner.c                                   |   10 
 mm/page_poison.c                                  |   20 -
 mm/page_reporting.c                               |    4 
 mm/readahead.c                                    |  174 ++++------
 mm/rmap.c                                         |   10 
 mm/shmem.c                                        |    2 
 mm/shuffle.c                                      |    2 
 mm/slab.c                                         |    2 
 mm/slab.h                                         |    1 
 mm/slub.c                                         |    2 
 mm/sparse.c                                       |    2 
 mm/swap_state.c                                   |    2 
 mm/truncate.c                                     |    6 
 mm/util.c                                         |    3 
 mm/vmscan.c                                       |    5 
 mm/vmstat.c                                       |    8 
 mm/workingset.c                                   |    2 
 scripts/Makefile.ubsan                            |   10 
 scripts/checkpatch.pl                             |  238 ++++++++++----
 scripts/const_structs.checkpatch                  |    3 
 scripts/gdb/linux/proc.py                         |   15 
 scripts/gdb/linux/tasks.py                        |    9 
 scripts/get_maintainer.pl                         |    9 
 tools/testing/selftests/exec/.gitignore           |    1 
 tools/testing/selftests/exec/Makefile             |    9 
 tools/testing/selftests/exec/load_address.c       |   68 ++++
 161 files changed, 2532 insertions(+), 1864 deletions(-)

incoming

[Andrew Morton]

181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c.

Subsystems affected by this patch series:

  kbuild
  scripts
  ntfs
  ocfs2
  vfs
  mm/slab
  mm/slub
  mm/kmemleak
  mm/dax
  mm/debug
  mm/pagecache
  mm/fadvise
  mm/gup
  mm/swap
  mm/memremap
  mm/memcg
  mm/selftests
  mm/pagemap
  mm/mincore
  mm/hmm
  mm/dma
  mm/memory-failure
  mm/vmalloc
  mm/documentation
  mm/kasan
  mm/pagealloc
  mm/hugetlb
  mm/vmscan
  mm/z3fold
  mm/zbud
  mm/compaction
  mm/mempolicy
  mm/mempool
  mm/memblock
  mm/oom-kill
  mm/migration

Subsystem: kbuild

    Nick Desaulniers <ndesaulniers@google.com>:
    Patch series "set clang minimum version to 10.0.1", v3:
      compiler-clang: add build check for clang 10.0.1
      Revert "kbuild: disable clang's default use of -fmerge-all-constants"
      Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support"
      Revert "arm64: vdso: Fix compilation with clang older than 8"
      Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer"

    Marco Elver <elver@google.com>:
      kasan: remove mentions of unsupported Clang versions

    Nick Desaulniers <ndesaulniers@google.com>:
      compiler-gcc: improve version error
      compiler.h: avoid escaped section names
      export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang

    Lukas Bulwahn <lukas.bulwahn@gmail.com>:
      kbuild: doc: describe proper script invocation

Subsystem: scripts

    Wang Qing <wangqing@vivo.com>:
      scripts/spelling.txt: increase error-prone spell checking

    Naoki Hayama <naoki.hayama@lineo.co.jp>:
      scripts/spelling.txt: add "arbitrary" typo

    Borislav Petkov <bp@suse.de>:
      scripts/decodecode: add the capability to supply the program counter

Subsystem: ntfs

    Rustam Kovhaev <rkovhaev@gmail.com>:
      ntfs: add check for mft record size in superblock

Subsystem: ocfs2

    Randy Dunlap <rdunlap@infradead.org>:
      ocfs2: delete repeated words in comments

    Gang He <ghe@suse.com>:
      ocfs2: fix potential soft lockup during fstrim

Subsystem: vfs

    Randy Dunlap <rdunlap@infradead.org>:
      fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr

    Luo Jiaxing <luojiaxing@huawei.com>:
      fs_parse: mark fs_param_bad_value() as static

Subsystem: mm/slab

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/slab.c: clean code by removing redundant if condition

    tangjianqiang <wyqt1985@gmail.com>:
      include/linux/slab.h: fix a typo error in comment

Subsystem: mm/slub

    Abel Wu <wuyun.wu@huawei.com>:
      mm/slub.c: branch optimization in free slowpath
      mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc
      mm/slub: make add_full() condition more explicit

Subsystem: mm/kmemleak

    Davidlohr Bueso <dave@stgolabs.net>:
      mm/kmemleak: rely on rcu for task stack scanning

    Hui Su <sh_def@163.com>:
      mm,kmemleak-test.c: move kmemleak-test.c to samples dir

Subsystem: mm/dax

    Dan Williams <dan.j.williams@intel.com>:
    Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5:
      x86/numa: cleanup configuration dependent command-line options
      x86/numa: add 'nohmat' option
      efi/fake_mem: arrange for a resource entry per efi_fake_mem instance
      ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device
      resource: report parent to walk_iomem_res_desc() callback
      mm/memory_hotplug: introduce default phys_to_target_node() implementation
      ACPI: HMAT: attach a device for each soft-reserved range
      device-dax: drop the dax_region.pfn_flags attribute
      device-dax: move instance creation parameters to 'struct dev_dax_data'
      device-dax: make pgmap optional for instance creation
      device-dax/kmem: introduce dax_kmem_range()
      device-dax/kmem: move resource name tracking to drvdata
      device-dax/kmem: replace release_resource() with release_mem_region()
      device-dax: add an allocation interface for device-dax instances
      device-dax: introduce 'struct dev_dax' typed-driver operations
      device-dax: introduce 'seed' devices
      drivers/base: make device_find_child_by_name() compatible with sysfs inputs
      device-dax: add resize support
      mm/memremap_pages: convert to 'struct range'
      mm/memremap_pages: support multiple ranges per invocation
      device-dax: add dis-contiguous resource support
      device-dax: introduce 'mapping' devices

    Joao Martins <joao.m.martins@oracle.com>:
      device-dax: make align a per-device property

    Dan Williams <dan.j.williams@intel.com>:
      device-dax: add an 'align' attribute

    Joao Martins <joao.m.martins@oracle.com>:
      dax/hmem: introduce dax_hmem.region_idle parameter
      device-dax: add a range mapping allocation attribute

Subsystem: mm/debug

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/debug.c: do not dereference i_ino blindly

    John Hubbard <jhubbard@nvidia.com>:
      mm, dump_page: rename head_mapcount() --> head_compound_mapcount()

Subsystem: mm/pagecache

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Return head pages from find_*_entry", v2:
      mm: factor find_get_incore_page out of mincore_page
      mm: use find_get_incore_page in memcontrol
      mm: optimise madvise WILLNEED
      proc: optimise smaps for shmem entries
      i915: use find_lock_page instead of find_lock_entry
      mm: convert find_get_entry to return the head page
      mm/shmem: return head page from find_lock_entry
      mm: add find_lock_head
      mm/filemap: fix filemap_map_pages for THP

Subsystem: mm/fadvise

    Yafang Shao <laoar.shao@gmail.com>:
      mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED

Subsystem: mm/gup

    Barry Song <song.bao.hua@hisilicon.com>:
      mm/gup_benchmark: update the documentation in Kconfig
      mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag
      mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM

    John Hubbard <jhubbard@nvidia.com>:
      mm/gup: protect unpin_user_pages() against npages==-ERRNO

Subsystem: mm/swap

    Gao Xiang <hsiangkao@redhat.com>:
      swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity

    Yu Zhao <yuzhao@google.com>:
      mm: remove activate_page() from unuse_pte()
      mm: remove superfluous __ClearPageActive()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/swap.c: fix confusing comment in release_pages()
      mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache()
      mm/page_io.c: remove useless out label in __swap_writepage()
      mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable()
      mm/swapfile.c: remove unnecessary goto out in _swap_info_get()
      mm/swapfile.c: fix potential memory leak in sys_swapon

Subsystem: mm/memremap

    Ira Weiny <ira.weiny@intel.com>:
      mm/memremap.c: convert devmap static branch to {inc,dec}

Subsystem: mm/memcg

    "Gustavo A. R. Silva" <gustavoars@kernel.org>:
      mm: memcontrol: use flex_array_size() helper in memcpy()
      mm: memcontrol: use the preferred form for passing the size of a structure type

    Roman Gushchin <guro@fb.com>:
      mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj()

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: memcontrol: correct the comment of mem_cgroup_iter()

    Waiman Long <longman@redhat.com>:
    Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2:
      mm/memcg: clean up obsolete enum charge_type
      mm/memcg: simplify mem_cgroup_get_max()
      mm/memcg: unify swap and memsw page counters

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: add the missing numa_stat interface for cgroup v2

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge()
      mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom()

    Bharata B Rao <bharata@linux.ibm.com>:
      mm: memcg/slab: uncharge during kmem_cache_free_bulk()

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/memcg: fix device private memcg accounting

Subsystem: mm/selftests

    John Hubbard <jhubbard@nvidia.com>:
    Patch series "selftests/vm: fix some minor aggravating factors in the Makefile":
      selftests/vm: fix false build success on the second and later attempts
      selftests/vm: fix incorrect gcc invocation in some cases

Subsystem: mm/pagemap

    Matthew Wilcox <willy@infradead.org>:
      mm: account PMD tables like PTE tables

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/memory.c: fix typo in __do_fault() comment
      mm/memory.c: replace vmf->vma with variable vma

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: rename __vma_unlink_common() to __vma_unlink()
      mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase()

    Chinwen Chang <chinwen.chang@mediatek.com>:
    Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4:
      mmap locking API: add mmap_lock_is_contended()
      mm: smaps*: extend smap_gather_stats to support specified beginning
      mm: proc: smaps_rollup: do not stall write attempts on mmap_lock

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "Fix PageDoubleMap":
      mm: move PageDoubleMap bit
      mm: simplify PageDoubleMap with PF_SECOND policy

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: leave adjust_next as virtual address instead of page frame number

    Randy Dunlap <rdunlap@infradead.org>:
      mm/memory.c: fix spello of "function"

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mmap: not necessary to check mapping separately
      mm/mmap: check on file instead of the rb_root_cached of its address_space

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: use helper function mapping_allow_writable()
      mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct()

    Liao Pingfang <liao.pingfang@zte.com.cn>:
      mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct()

    Peter Xu <peterx@redhat.com>:
      mm: remove src/dst mm parameter in copy_page_range()

Subsystem: mm/mincore

    yuleixzhang <yulei.kernel@gmail.com>:
      include/linux/huge_mm.h: remove mincore_huge_pmd declaration

Subsystem: mm/hmm

    Ralph Campbell <rcampbell@nvidia.com>:
      tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro
      lib/test_hmm.c: remove unused dmirror_zero_page

Subsystem: mm/dma

    Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
      mm/dmapool.c: replace open-coded list_for_each_entry_safe()
      mm/dmapool.c: replace hard coded function name with __func__

Subsystem: mm/memory-failure

    Xianting Tian <tian.xianting@h3c.com>:
      mm/memory-failure: do pgoff calculation before for_each_process()

    Alex Shi <alex.shi@linux.alibaba.com>:
      mm/memory-failure.c: remove unused macro `writeback'

Subsystem: mm/vmalloc

    Hui Su <sh_def@163.com>:
      mm/vmalloc.c: update the comment in __vmalloc_area_node()
      mm/vmalloc.c: fix the comment of find_vm_area

Subsystem: mm/documentation

    Alexander Gordeev <agordeev@linux.ibm.com>:
      docs/vm: fix 'mm_count' vs 'mm_users' counter confusion

Subsystem: mm/kasan

    Patricia Alfonso <trishalfonso@google.com>:
    Patch series "KASAN-KUnit Integration", v14:
      kasan/kunit: add KUnit Struct to Current Task
      KUnit: KASAN Integration
      KASAN: port KASAN Tests to KUnit
      KASAN: Testing Documentation

    David Gow <davidgow@google.com>:
      mm: kasan: do not panic if both panic_on_warn and kasan_multishot set

Subsystem: mm/pagealloc

    David Hildenbrand <david@redhat.com>:
    Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5:
      mm/page_alloc: tweak comments in has_unmovable_pages()
      mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate()
      mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate()
      mm/page_isolation: cleanup set_migratetype_isolate()
      virtio-mem: don't special-case ZONE_MOVABLE
      mm: document semantics of ZONE_MOVABLE

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm, isolation: avoid checking unmovable pages across pageblock boundary

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/page_alloc.c: clean code by removing unnecessary initialization
      mm/page_alloc.c: micro-optimization remove unnecessary branch
      mm/page_alloc.c: fix early params garbage value accesses
      mm/page_alloc.c: clean code by merging two functions

    Yanfei Xu <yanfei.xu@windriver.com>:
      mm/page_alloc.c: __perform_reclaim should return 'unsigned long'

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mmzone: clean code by removing unused macro parameter

    Ralph Campbell <rcampbell@nvidia.com>:
      mm: move call to compound_head() in release_pages()

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
      mm/page_alloc.c: fix freeing non-compound pages

    Michal Hocko <mhocko@suse.com>:
      include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts

Subsystem: mm/hugetlb

    Baoquan He <bhe@redhat.com>:
    Patch series "mm/hugetlb: Small cleanup and improvement", v2:
      mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool
      mm/hugetlb.c: remove the unnecessary non_swap_entry()
      doc/vm: fix typo in the hugetlb admin documentation

    Wei Yang <richard.weiyang@linux.alibaba.com>:
    Patch series "mm/hugetlb: code refine and simplification", v4:
      mm/hugetlb: not necessary to coalesce regions recursively
      mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache()
      mm/hugetlb: use list_splice to merge two list at once
      mm/hugetlb: count file_region to be added when regions_needed != NULL
      mm/hugetlb: a page from buddy is not on any list
      mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page
      mm/hugetlb: take the free hpage during the iteration directly

    Mike Kravetz <mike.kravetz@oracle.com>:
      hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share

Subsystem: mm/vmscan

    Chunxin Zang <zangchunxin@bytedance.com>:
      mm/vmscan: fix infinite loop in drop_slab_node

    Hui Su <sh_def@163.com>:
      mm/vmscan: fix comments for isolate_lru_page()

Subsystem: mm/z3fold

    Hui Su <sh_def@163.com>:
      mm/z3fold.c: use xx_zalloc instead xx_alloc and memset

Subsystem: mm/zbud

    Xiang Chen <chenxiang66@hisilicon.com>:
      mm/zbud: remove redundant initialization

Subsystem: mm/compaction

    Mateusz Nosek <mateusznosek0@gmail.com>:
      mm/compaction.c: micro-optimization remove unnecessary branch
      include/linux/compaction.h: clean code by removing unused enum value

    John Hubbard <jhubbard@nvidia.com>:
      selftests/vm: 8x compaction_test speedup

Subsystem: mm/mempolicy

    Wei Yang <richard.weiyang@linux.alibaba.com>:
      mm/mempolicy: remove or narrow the lock on current
      mm: remove unused alloc_page_vma_node()

Subsystem: mm/mempool

    Miaohe Lin <linmiaohe@huawei.com>:
      mm/mempool: add 'else' to split mutually exclusive case

Subsystem: mm/memblock

    Mike Rapoport <rppt@linux.ibm.com>:
    Patch series "memblock: seasonal cleaning^w cleanup", v3:
      KVM: PPC: Book3S HV: simplify kvm_cma_reserve()
      dma-contiguous: simplify cma_early_percent_memory()
      arm, xtensa: simplify initialization of high memory pages
      arm64: numa: simplify dummy_numa_init()
      h8300, nds32, openrisc: simplify detection of memory extents
      riscv: drop unneeded node initialization
      mircoblaze: drop unneeded NUMA and sparsemem initializations
      memblock: make for_each_memblock_type() iterator private
      memblock: make memblock_debug and related functionality private
      memblock: reduce number of parameters in for_each_mem_range()
      arch, mm: replace for_each_memblock() with for_each_mem_pfn_range()
      arch, drivers: replace for_each_membock() with for_each_mem_range()
      x86/setup: simplify initrd relocation and reservation
      x86/setup: simplify reserve_crashkernel()
      memblock: remove unused memblock_mem_size()
      memblock: implement for_each_reserved_mem_region() using __next_mem_region()
      memblock: use separate iterators for memory and reserved regions

Subsystem: mm/oom-kill

    Suren Baghdasaryan <surenb@google.com>:
      mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary

Subsystem: mm/migration

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/migrate: remove cpages-- in migrate_vma_finalize()
      mm/migrate: remove obsolete comment about device public

 .clang-format                                |    7 
 Documentation/admin-guide/cgroup-v2.rst      |   69 +
 Documentation/admin-guide/mm/hugetlbpage.rst |    2 
 Documentation/dev-tools/kasan.rst            |   74 +
 Documentation/dev-tools/kmemleak.rst         |    2 
 Documentation/kbuild/makefiles.rst           |   20 
 Documentation/vm/active_mm.rst               |    2 
 Documentation/x86/x86_64/boot-options.rst    |    4 
 MAINTAINERS                                  |    2 
 Makefile                                     |    9 
 arch/arm/Kconfig                             |    2 
 arch/arm/include/asm/tlb.h                   |    1 
 arch/arm/kernel/setup.c                      |   18 
 arch/arm/mm/init.c                           |   59 -
 arch/arm/mm/mmu.c                            |   39 
 arch/arm/mm/pmsa-v7.c                        |   23 
 arch/arm/mm/pmsa-v8.c                        |   17 
 arch/arm/xen/mm.c                            |    7 
 arch/arm64/Kconfig                           |    2 
 arch/arm64/kernel/machine_kexec_file.c       |    6 
 arch/arm64/kernel/setup.c                    |    4 
 arch/arm64/kernel/vdso/Makefile              |    7 
 arch/arm64/mm/init.c                         |   11 
 arch/arm64/mm/kasan_init.c                   |   10 
 arch/arm64/mm/mmu.c                          |   11 
 arch/arm64/mm/numa.c                         |   15 
 arch/c6x/kernel/setup.c                      |    9 
 arch/h8300/kernel/setup.c                    |    8 
 arch/microblaze/mm/init.c                    |   23 
 arch/mips/cavium-octeon/dma-octeon.c         |   14 
 arch/mips/kernel/setup.c                     |   31 
 arch/mips/netlogic/xlp/setup.c               |    2 
 arch/nds32/kernel/setup.c                    |    8 
 arch/openrisc/kernel/setup.c                 |    9 
 arch/openrisc/mm/init.c                      |    8 
 arch/powerpc/kernel/fadump.c                 |   61 -
 arch/powerpc/kexec/file_load_64.c            |   16 
 arch/powerpc/kvm/book3s_hv_builtin.c         |   12 
 arch/powerpc/kvm/book3s_hv_uvmem.c           |   14 
 arch/powerpc/mm/book3s64/hash_utils.c        |   16 
 arch/powerpc/mm/book3s64/radix_pgtable.c     |   10 
 arch/powerpc/mm/kasan/kasan_init_32.c        |    8 
 arch/powerpc/mm/mem.c                        |   31 
 arch/powerpc/mm/numa.c                       |    7 
 arch/powerpc/mm/pgtable_32.c                 |    8 
 arch/riscv/mm/init.c                         |   36 
 arch/riscv/mm/kasan_init.c                   |   10 
 arch/s390/kernel/setup.c                     |   27 
 arch/s390/mm/page-states.c                   |    6 
 arch/s390/mm/vmem.c                          |    7 
 arch/sh/mm/init.c                            |    9 
 arch/sparc/mm/init_64.c                      |   12 
 arch/x86/include/asm/numa.h                  |    8 
 arch/x86/kernel/e820.c                       |   16 
 arch/x86/kernel/setup.c                      |   56 -
 arch/x86/mm/numa.c                           |   13 
 arch/x86/mm/numa_emulation.c                 |    3 
 arch/x86/xen/enlighten_pv.c                  |    2 
 arch/xtensa/mm/init.c                        |   55 -
 drivers/acpi/numa/hmat.c                     |   76 -
 drivers/acpi/numa/srat.c                     |    9 
 drivers/base/core.c                          |    2 
 drivers/bus/mvebu-mbus.c                     |   12 
 drivers/dax/Kconfig                          |    6 
 drivers/dax/Makefile                         |    3 
 drivers/dax/bus.c                            | 1237 +++++++++++++++++++++++----
 drivers/dax/bus.h                            |   34 
 drivers/dax/dax-private.h                    |   74 +
 drivers/dax/device.c                         |  164 +--
 drivers/dax/hmem.c                           |   56 -
 drivers/dax/hmem/Makefile                    |    8 
 drivers/dax/hmem/device.c                    |  100 ++
 drivers/dax/hmem/hmem.c                      |   93 +-
 drivers/dax/kmem.c                           |  236 ++---
 drivers/dax/pmem/compat.c                    |    2 
 drivers/dax/pmem/core.c                      |   36 
 drivers/firmware/efi/x86_fake_mem.c          |   12 
 drivers/gpu/drm/i915/gem/i915_gem_shmem.c    |    4 
 drivers/gpu/drm/nouveau/nouveau_dmem.c       |   15 
 drivers/irqchip/irq-gic-v3-its.c             |    2 
 drivers/nvdimm/badrange.c                    |   26 
 drivers/nvdimm/claim.c                       |   13 
 drivers/nvdimm/nd.h                          |    3 
 drivers/nvdimm/pfn_devs.c                    |   13 
 drivers/nvdimm/pmem.c                        |   27 
 drivers/nvdimm/region.c                      |   21 
 drivers/pci/p2pdma.c                         |   12 
 drivers/virtio/virtio_mem.c                  |   47 -
 drivers/xen/unpopulated-alloc.c              |   45 
 fs/fs_parser.c                               |    2 
 fs/ntfs/inode.c                              |    6 
 fs/ocfs2/alloc.c                             |    6 
 fs/ocfs2/localalloc.c                        |    2 
 fs/proc/base.c                               |    3 
 fs/proc/task_mmu.c                           |  104 +-
 fs/xattr.c                                   |   22 
 include/acpi/acpi_numa.h                     |   14 
 include/kunit/test.h                         |    5 
 include/linux/acpi.h                         |    2 
 include/linux/compaction.h                   |    3 
 include/linux/compiler-clang.h               |    8 
 include/linux/compiler-gcc.h                 |    2 
 include/linux/compiler.h                     |    2 
 include/linux/dax.h                          |    8 
 include/linux/export.h                       |    2 
 include/linux/fs.h                           |    4 
 include/linux/gfp.h                          |    6 
 include/linux/huge_mm.h                      |    3 
 include/linux/kasan.h                        |    6 
 include/linux/memblock.h                     |   90 +
 include/linux/memcontrol.h                   |   13 
 include/linux/memory_hotplug.h               |   23 
 include/linux/memremap.h                     |   15 
 include/linux/mm.h                           |   36 
 include/linux/mmap_lock.h                    |    5 
 include/linux/mmzone.h                       |   37 
 include/linux/numa.h                         |   11 
 include/linux/oom.h                          |    1 
 include/linux/page-flags.h                   |   42 
 include/linux/pagemap.h                      |   43 
 include/linux/range.h                        |    6 
 include/linux/sched.h                        |    4 
 include/linux/sched/coredump.h               |    1 
 include/linux/slab.h                         |    2 
 include/linux/swap.h                         |   10 
 include/linux/swap_slots.h                   |    2 
 kernel/dma/contiguous.c                      |   11 
 kernel/fork.c                                |   25 
 kernel/resource.c                            |   11 
 lib/Kconfig.debug                            |    9 
 lib/Kconfig.kasan                            |   31 
 lib/Makefile                                 |    5 
 lib/kunit/test.c                             |   13 
 lib/test_free_pages.c                        |   42 
 lib/test_hmm.c                               |   65 -
 lib/test_kasan.c                             |  732 ++++++---------
 lib/test_kasan_module.c                      |  111 ++
 mm/Kconfig                                   |    4 
 mm/Makefile                                  |    1 
 mm/compaction.c                              |    5 
 mm/debug.c                                   |   18 
 mm/dmapool.c                                 |   46 -
 mm/fadvise.c                                 |    9 
 mm/filemap.c                                 |   78 -
 mm/gup.c                                     |   44 
 mm/gup_benchmark.c                           |   23 
 mm/huge_memory.c                             |    4 
 mm/hugetlb.c                                 |  100 +-
 mm/internal.h                                |    3 
 mm/kasan/report.c                            |   34 
 mm/kmemleak-test.c                           |   99 --
 mm/kmemleak.c                                |    8 
 mm/madvise.c                                 |   21 
 mm/memblock.c                                |  102 --
 mm/memcontrol.c                              |  262 +++--
 mm/memory-failure.c                          |    5 
 mm/memory.c                                  |  147 +--
 mm/memory_hotplug.c                          |   10 
 mm/mempolicy.c                               |    8 
 mm/mempool.c                                 |   18 
 mm/memremap.c                                |  344 ++++---
 mm/migrate.c                                 |    3 
 mm/mincore.c                                 |   28 
 mm/mmap.c                                    |   45 
 mm/oom_kill.c                                |    2 
 mm/page_alloc.c                              |   82 -
 mm/page_counter.c                            |    2 
 mm/page_io.c                                 |   14 
 mm/page_isolation.c                          |   41 
 mm/shmem.c                                   |   19 
 mm/slab.c                                    |    4 
 mm/slab.h                                    |   50 -
 mm/slub.c                                    |   33 
 mm/sparse.c                                  |   10 
 mm/swap.c                                    |   14 
 mm/swap_slots.c                              |    3 
 mm/swap_state.c                              |   38 
 mm/swapfile.c                                |   12 
 mm/truncate.c                                |   58 -
 mm/vmalloc.c                                 |    6 
 mm/vmscan.c                                  |    5 
 mm/z3fold.c                                  |    3 
 mm/zbud.c                                    |    1 
 samples/Makefile                             |    1 
 samples/kmemleak/Makefile                    |    3 
 samples/kmemleak/kmemleak-test.c             |   99 ++
 scripts/decodecode                           |   29 
 scripts/spelling.txt                         |    4 
 tools/testing/nvdimm/dax-dev.c               |   28 
 tools/testing/nvdimm/test/iomap.c            |    2 
 tools/testing/selftests/vm/Makefile          |   17 
 tools/testing/selftests/vm/compaction_test.c |   11 
 tools/testing/selftests/vm/gup_benchmark.c   |   14 
 tools/testing/selftests/vm/hmm-tests.c       |    4 
 194 files changed, 4273 insertions(+), 2777 deletions(-)

incoming

[Andrew Morton]

5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d.

Subsystems affected by this patch series:

  MAINTAINERS
  mm/pagemap
  mm/swap
  mm/hugetlb

Subsystem: MAINTAINERS

    Kees Cook <keescook@chromium.org>:
      MAINTAINERS: change hardening mailing list

    Antoine Tenart <atenart@kernel.org>:
      MAINTAINERS: Antoine Tenart's email address

Subsystem: mm/pagemap

    Miaohe Lin <linmiaohe@huawei.com>:
      mm: mmap: Fix general protection fault in unlink_file_vma()

Subsystem: mm/swap

    Minchan Kim <minchan@kernel.org>:
      mm: validate inode in mapping_set_error()

Subsystem: mm/hugetlb

    Vijay Balakrishna <vijayb@linux.microsoft.com>:
      mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged

 .mailmap                   |    4 +++-
 MAINTAINERS                |    8 ++++----
 include/linux/khugepaged.h |    5 +++++
 include/linux/pagemap.h    |    3 ++-
 mm/khugepaged.c            |   13 +++++++++++--
 mm/mmap.c                  |    6 +++++-
 mm/page_alloc.c            |    3 +++
 7 files changed, 33 insertions(+), 9 deletions(-)

incoming

[Andrew Morton]

3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e.

Subsystems affected by this patch series:

  mm/slub
  mm/cma
  scripts

Subsystem: mm/slub

    Eric Farman <farman@linux.ibm.com>:
      mm, slub: restore initial kmem_cache flags

Subsystem: mm/cma

    Joonsoo Kim <iamjoonsoo.kim@lge.com>:
      mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs

Subsystem: scripts

    Eric Biggers <ebiggers@google.com>:
      scripts/spelling.txt: fix malformed entry

 mm/page_alloc.c      |   19 ++++++++++++++++---
 mm/slub.c            |    6 +-----
 scripts/spelling.txt |    2 +-
 3 files changed, 18 insertions(+), 9 deletions(-)

incoming

[Andrew Morton]

9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6.

Subsystems affected by this patch series:

  mm/thp
  mm/memcg
  mm/gup
  mm/migration
  lib
  x86
  mm/memory-hotplug

Subsystem: mm/thp

    Gao Xiang <hsiangkao@redhat.com>:
      mm, THP, swap: fix allocating cluster for swapfile by mistake

Subsystem: mm/memcg

    Muchun Song <songmuchun@bytedance.com>:
      mm: memcontrol: fix missing suffix of workingset_restore

Subsystem: mm/gup

    Vasily Gorbik <gor@linux.ibm.com>:
      mm/gup: fix gup_fast with dynamic page table folding

Subsystem: mm/migration

    Zi Yan <ziy@nvidia.com>:
      mm/migrate: correct thp migration stats

Subsystem: lib

    Nick Desaulniers <ndesaulniers@google.com>:
      lib/string.c: implement stpcpy

    Jason Yan <yanaijie@huawei.com>:
      lib/memregion.c: include memregion.h

Subsystem: x86

    Mikulas Patocka <mpatocka@redhat.com>:
      arch/x86/lib/usercopy_64.c: fix  __copy_user_flushcache() cache writeback

Subsystem: mm/memory-hotplug

    Laurent Dufour <ldufour@linux.ibm.com>:
    Patch series "mm: fix memory to node bad links in sysfs", v3:
      mm: replace memmap_context by meminit_context
      mm: don't rely on system state to detect hot-plug operations

 Documentation/admin-guide/cgroup-v2.rst |   25 ++++++---
 arch/ia64/mm/init.c                     |    6 +-
 arch/s390/include/asm/pgtable.h         |   42 +++++++++++----
 arch/x86/lib/usercopy_64.c              |    2 
 drivers/base/node.c                     |   85 ++++++++++++++++++++------------
 include/linux/mm.h                      |    2 
 include/linux/mmzone.h                  |   11 +++-
 include/linux/node.h                    |   11 ++--
 include/linux/pgtable.h                 |   10 +++
 lib/memregion.c                         |    1 
 lib/string.c                            |   24 +++++++++
 mm/gup.c                                |   18 +++---
 mm/memcontrol.c                         |    4 -
 mm/memory_hotplug.c                     |    5 +
 mm/migrate.c                            |    7 +-
 mm/page_alloc.c                         |   10 +--
 mm/swapfile.c                           |    2 
 17 files changed, 181 insertions(+), 84 deletions(-)

incoming

[Andrew Morton]

15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b.

Subsystems affected by this patch series:

  mailmap
  mm/hotfixes
  mm/thp
  mm/memory-hotplug
  misc
  kcsan

Subsystem: mailmap

    Kees Cook <keescook@chromium.org>:
      mailmap: add older email addresses for Kees Cook

Subsystem: mm/hotfixes

    Hugh Dickins <hughd@google.com>:
    Patch series "mm: fixes to past from future testing":
      ksm: reinstate memcg charge on copied pages
      mm: migration of hugetlbfs page skip memcg
      shmem: shmem_writepage() split unlikely i915 THP
      mm: fix check_move_unevictable_pages() on THP
      mlock: fix unevictable_pgs event counts on THP

    Byron Stanoszek <gandalf@winds.org>:
      tmpfs: restore functionality of nr_inodes=0

    Muchun Song <songmuchun@bytedance.com>:
      kprobes: fix kill kprobe which has been marked as gone

Subsystem: mm/thp

    Ralph Campbell <rcampbell@nvidia.com>:
      mm/thp: fix __split_huge_pmd_locked() for migration PMD

    Christophe Leroy <christophe.leroy@csgroup.eu>:
      selftests/vm: fix display of page size in map_hugetlb

Subsystem: mm/memory-hotplug

    Pavel Tatashin <pasha.tatashin@soleen.com>:
      mm/memory_hotplug: drain per-cpu pages again during memory offline

Subsystem: misc

    Tobias Klauser <tklauser@distanz.ch>:
      ftrace: let ftrace_enable_sysctl take a kernel pointer buffer
      stackleak: let stack_erasing_sysctl take a kernel pointer buffer
      fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype

Subsystem: kcsan

    Changbin Du <changbin.du@gmail.com>:
      kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments'

 .mailmap                                 |    4 ++
 fs/fs-writeback.c                        |    2 -
 include/linux/ftrace.h                   |    3 --
 include/linux/stackleak.h                |    2 -
 kernel/kprobes.c                         |    9 +++++-
 kernel/stackleak.c                       |    2 -
 kernel/trace/ftrace.c                    |    3 --
 lib/Kconfig.debug                        |    4 --
 mm/huge_memory.c                         |   42 ++++++++++++++++---------------
 mm/ksm.c                                 |    4 ++
 mm/memory_hotplug.c                      |   14 ++++++++++
 mm/migrate.c                             |    3 +-
 mm/mlock.c                               |   24 +++++++++++------
 mm/page_isolation.c                      |    8 +++++
 mm/shmem.c                               |   20 +++++++++++---
 mm/swap.c                                |    6 ++--
 mm/vmscan.c                              |   10 +++++--
 tools/testing/selftests/vm/map_hugetlb.c |    2 -
 18 files changed, 111 insertions(+), 51 deletions(-)

incoming

[Andrew Morton]

19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6.

Subsystems affected by this patch series:

  mm/memcg
  mm/slub
  MAINTAINERS
  mm/pagemap
  ipc
  fork
  checkpatch
  mm/madvise
  mm/migration
  mm/hugetlb
  lib

Subsystem: mm/memcg

    Michal Hocko <mhocko@suse.com>:
      memcg: fix use-after-free in uncharge_batch

    Xunlei Pang <xlpang@linux.alibaba.com>:
      mm: memcg: fix memcg reclaim soft lockup

Subsystem: mm/slub

    Eugeniu Rosca <erosca@de.adit-jv.com>:
      mm: slub: fix conversion of freelist_corrupted()

Subsystem: MAINTAINERS

    Robert Richter <rric@kernel.org>:
      MAINTAINERS: update Cavium/Marvell entries

    Nick Desaulniers <ndesaulniers@google.com>:
      MAINTAINERS: add LLVM maintainers

    Randy Dunlap <rdunlap@infradead.org>:
      MAINTAINERS: IA64: mark Status as Odd Fixes only

Subsystem: mm/pagemap

    Joerg Roedel <jroedel@suse.de>:
      mm: track page table modifications in __apply_to_page_range()

Subsystem: ipc

    Tobias Klauser <tklauser@distanz.ch>:
      ipc: adjust proc_ipc_sem_dointvec definition to match prototype

Subsystem: fork

    Tobias Klauser <tklauser@distanz.ch>:
      fork: adjust sysctl_max_threads definition to match prototype

Subsystem: checkpatch

    Mrinal Pandey <mrinalmni@gmail.com>:
      checkpatch: fix the usage of capture group ( ... )

Subsystem: mm/madvise

    Yang Shi <shy828301@gmail.com>:
      mm: madvise: fix vma user-after-free

Subsystem: mm/migration

    Alistair Popple <alistair@popple.id.au>:
      mm/migrate: fixup setting UFFD_WP flag
      mm/rmap: fixup copying of soft dirty and uffd ptes

    Ralph Campbell <rcampbell@nvidia.com>:
    Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()":
      mm/migrate: remove unnecessary is_zone_device_page() check
      mm/migrate: preserve soft dirty in remove_migration_pte()

Subsystem: mm/hugetlb

    Li Xinhai <lixinhai.lxh@gmail.com>:
      mm/hugetlb: try preferred node first when alloc gigantic page from cma

    Muchun Song <songmuchun@bytedance.com>:
      mm/hugetlb: fix a race between hugetlb sysctl handlers

    David Howells <dhowells@redhat.com>:
      mm/khugepaged.c: fix khugepaged's request size in collapse_file

Subsystem: lib

    Jason Gunthorpe <jgg@nvidia.com>:
      include/linux/log2.h: add missing () around n in roundup_pow_of_two()

 MAINTAINERS           |   32 ++++++++++++++++----------------
 include/linux/log2.h  |    2 +-
 ipc/ipc_sysctl.c      |    2 +-
 kernel/fork.c         |    2 +-
 mm/hugetlb.c          |   49 +++++++++++++++++++++++++++++++++++++------------
 mm/khugepaged.c       |    2 +-
 mm/madvise.c          |    2 +-
 mm/memcontrol.c       |    6 ++++++
 mm/memory.c           |   37 ++++++++++++++++++++++++-------------
 mm/migrate.c          |   31 +++++++++++++++++++------------
 mm/rmap.c             |    9 +++++++--
 mm/slub.c             |   12 ++++++------
 mm/vmscan.c           |    8 ++++++++
 scripts/checkpatch.pl |    4 ++--
 14 files changed, 130 insertions(+), 68 deletions(-)

incoming

[Andrew Morton]

11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da.

Subsystems affected by this patch series:

  misc
  mm/hugetlb
  mm/vmalloc
  mm/misc
  romfs
  relay
  uprobes
  squashfs
  mm/cma
  mm/pagealloc

Subsystem: misc

    Nick Desaulniers <ndesaulniers@google.com>:
      mailmap: add Andi Kleen

Subsystem: mm/hugetlb

    Xu Wang <vulab@iscas.ac.cn>:
      hugetlb_cgroup: convert comma to semicolon

    Hugh Dickins <hughd@google.com>:
      khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter()

Subsystem: mm/vmalloc

    "Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
      mm/vunmap: add cond_resched() in vunmap_pmd_range

Subsystem: mm/misc

    Leon Romanovsky <leonro@nvidia.com>:
      mm/rodata_test.c: fix missing function declaration

Subsystem: romfs

    Jann Horn <jannh@google.com>:
      romfs: fix uninitialized memory leak in romfs_dev_read()

Subsystem: relay

    Wei Yongjun <weiyongjun1@huawei.com>:
      kernel/relay.c: fix memleak on destroy relay channel

Subsystem: uprobes

    Hugh Dickins <hughd@google.com>:
      uprobes: __replace_page() avoid BUG in munlock_vma_page()

Subsystem: squashfs

    Phillip Lougher <phillip@squashfs.org.uk>:
      squashfs: avoid bio_alloc() failure with 1Mbyte blocks

Subsystem: mm/cma

    Doug Berger <opendmb@gmail.com>:
      mm: include CMA pages in lowmem_reserve at boot

Subsystem: mm/pagealloc

    Charan Teja Reddy <charante@codeaurora.org>:
      mm, page_alloc: fix core hung in free_pcppages_bulk()

 .mailmap                |    1 +
 fs/romfs/storage.c      |    4 +---
 fs/squashfs/block.c     |    6 +++++-
 kernel/events/uprobes.c |    2 +-
 kernel/relay.c          |    1 +
 mm/hugetlb_cgroup.c     |    4 ++--
 mm/khugepaged.c         |    2 +-
 mm/page_alloc.c         |    7 ++++++-
 mm/rodata_test.c        |    1 +
 mm/vmalloc.c            |    2 ++
 10 files changed, 21 insertions(+), 9 deletions(-)

incoming

[Andrew Morton]

39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66.

Subsystems affected by this patch series:

  mm/hotfixes
  lz4
  exec
  mailmap
  mm/thp
  autofs
  mm/madvise
  sysctl
  mm/kmemleak
  mm/misc
  lib

Subsystem: mm/hotfixes

    Mike Rapoport <rppt@linux.ibm.com>:
      asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one()

    Baoquan He <bhe@redhat.com>:
      Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone"

Subsystem: lz4

    Nick Terrell <terrelln@fb.com>:
      lz4: fix kernel decompression speed

Subsystem: exec

    Kees Cook <keescook@chromium.org>:
    Patch series "Fix S_ISDIR execve() errno":
      exec: restore EACCES of S_ISDIR execve()
      selftests/exec: add file type errno tests

Subsystem: mailmap

    Greg Kurz <groug@kaod.org>:
      mailmap: add entry for Greg Kurz

Subsystem: mm/thp

    "Matthew Wilcox (Oracle)" <willy@infradead.org>:
    Patch series "THP prep patches":
      mm: store compound_nr as well as compound_order
      mm: move page-flags include to top of file
      mm: add thp_order
      mm: add thp_size
      mm: replace hpage_nr_pages with thp_nr_pages
      mm: add thp_head
      mm: introduce offset_in_thp

Subsystem: autofs

    Randy Dunlap <rdunlap@infradead.org>:
      fs: autofs: delete repeated words in comments

Subsystem: mm/madvise

    Minchan Kim <minchan@kernel.org>:
    Patch series "introduce memory hinting API for external process", v8:
      mm/madvise: pass task and mm to do_madvise
      pid: move pidfd_get_pid() to pid.c
      mm/madvise: introduce process_madvise() syscall: an external memory hinting API
      mm/madvise: check fatal signal pending of target process

Subsystem: sysctl

    Xiaoming Ni <nixiaoming@huawei.com>:
      all arch: remove system call sys_sysctl

Subsystem: mm/kmemleak

    Qian Cai <cai@lca.pw>:
      mm/kmemleak: silence KCSAN splats in checksum

Subsystem: mm/misc

    Qian Cai <cai@lca.pw>:
      mm/frontswap: mark various intentional data races
      mm/page_io: mark various intentional data races
      mm/swap_state: mark various intentional data races

    Kirill A. Shutemov <kirill@shutemov.name>:
      mm/filemap.c: fix a data race in filemap_fault()

    Qian Cai <cai@lca.pw>:
      mm/swapfile: fix and annotate various data races
      mm/page_counter: fix various data races at memsw
      mm/memcontrol: fix a data race in scan count
      mm/list_lru: fix a data race in list_lru_count_one
      mm/mempool: fix a data race in mempool_free()
      mm/rmap: annotate a data race at tlb_flush_batched
      mm/swap.c: annotate data races for lru_rotate_pvecs
      mm: annotate a data race in page_zonenum()

    Romain Naour <romain.naour@gmail.com>:
      include/asm-generic/vmlinux.lds.h: align ro_after_init

    Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>:
      sh: clkfwk: remove r8/r16/r32
      sh: use generic strncpy()

Subsystem: lib

    Krzysztof Kozlowski <krzk@kernel.org>:
    Patch series "iomap: Constify ioreadX() iomem argument", v3:
      iomap: constify ioreadX() iomem argument (as in generic implementation)
      rtl818x: constify ioreadX() iomem argument (as in generic implementation)
      ntb: intel: constify ioreadX() iomem argument (as in generic implementation)
      virtio: pci: constify ioreadX() iomem argument (as in generic implementation)

 .mailmap                                               |    1 
 arch/alpha/include/asm/core_apecs.h                    |    6 
 arch/alpha/include/asm/core_cia.h                      |    6 
 arch/alpha/include/asm/core_lca.h                      |    6 
 arch/alpha/include/asm/core_marvel.h                   |    4 
 arch/alpha/include/asm/core_mcpcia.h                   |    6 
 arch/alpha/include/asm/core_t2.h                       |    2 
 arch/alpha/include/asm/io.h                            |   12 -
 arch/alpha/include/asm/io_trivial.h                    |   16 -
 arch/alpha/include/asm/jensen.h                        |    2 
 arch/alpha/include/asm/machvec.h                       |    6 
 arch/alpha/kernel/core_marvel.c                        |    2 
 arch/alpha/kernel/io.c                                 |   12 -
 arch/alpha/kernel/syscalls/syscall.tbl                 |    3 
 arch/arm/configs/am200epdkit_defconfig                 |    1 
 arch/arm/tools/syscall.tbl                             |    3 
 arch/arm64/include/asm/unistd.h                        |    2 
 arch/arm64/include/asm/unistd32.h                      |    6 
 arch/ia64/kernel/syscalls/syscall.tbl                  |    3 
 arch/m68k/kernel/syscalls/syscall.tbl                  |    3 
 arch/microblaze/kernel/syscalls/syscall.tbl            |    3 
 arch/mips/configs/cu1000-neo_defconfig                 |    1 
 arch/mips/kernel/syscalls/syscall_n32.tbl              |    3 
 arch/mips/kernel/syscalls/syscall_n64.tbl              |    3 
 arch/mips/kernel/syscalls/syscall_o32.tbl              |    3 
 arch/parisc/include/asm/io.h                           |    4 
 arch/parisc/kernel/syscalls/syscall.tbl                |    3 
 arch/parisc/lib/iomap.c                                |   72 +++---
 arch/powerpc/kernel/iomap.c                            |   28 +-
 arch/powerpc/kernel/syscalls/syscall.tbl               |    3 
 arch/s390/kernel/syscalls/syscall.tbl                  |    3 
 arch/sh/configs/dreamcast_defconfig                    |    1 
 arch/sh/configs/espt_defconfig                         |    1 
 arch/sh/configs/hp6xx_defconfig                        |    1 
 arch/sh/configs/landisk_defconfig                      |    1 
 arch/sh/configs/lboxre2_defconfig                      |    1 
 arch/sh/configs/microdev_defconfig                     |    1 
 arch/sh/configs/migor_defconfig                        |    1 
 arch/sh/configs/r7780mp_defconfig                      |    1 
 arch/sh/configs/r7785rp_defconfig                      |    1 
 arch/sh/configs/rts7751r2d1_defconfig                  |    1 
 arch/sh/configs/rts7751r2dplus_defconfig               |    1 
 arch/sh/configs/se7206_defconfig                       |    1 
 arch/sh/configs/se7343_defconfig                       |    1 
 arch/sh/configs/se7619_defconfig                       |    1 
 arch/sh/configs/se7705_defconfig                       |    1 
 arch/sh/configs/se7750_defconfig                       |    1 
 arch/sh/configs/se7751_defconfig                       |    1 
 arch/sh/configs/secureedge5410_defconfig               |    1 
 arch/sh/configs/sh03_defconfig                         |    1 
 arch/sh/configs/sh7710voipgw_defconfig                 |    1 
 arch/sh/configs/sh7757lcr_defconfig                    |    1 
 arch/sh/configs/sh7763rdp_defconfig                    |    1 
 arch/sh/configs/shmin_defconfig                        |    1 
 arch/sh/configs/titan_defconfig                        |    1 
 arch/sh/include/asm/string_32.h                        |   26 --
 arch/sh/kernel/iomap.c                                 |   22 -
 arch/sh/kernel/syscalls/syscall.tbl                    |    3 
 arch/sparc/kernel/syscalls/syscall.tbl                 |    3 
 arch/x86/entry/syscalls/syscall_32.tbl                 |    3 
 arch/x86/entry/syscalls/syscall_64.tbl                 |    4 
 arch/xtensa/kernel/syscalls/syscall.tbl                |    3 
 drivers/mailbox/bcm-pdc-mailbox.c                      |    2 
 drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h |    6 
 drivers/ntb/hw/intel/ntb_hw_gen1.c                     |    2 
 drivers/ntb/hw/intel/ntb_hw_gen3.h                     |    2 
 drivers/ntb/hw/intel/ntb_hw_intel.h                    |    2 
 drivers/nvdimm/btt.c                                   |    4 
 drivers/nvdimm/pmem.c                                  |    6 
 drivers/sh/clk/cpg.c                                   |   25 --
 drivers/virtio/virtio_pci_modern.c                     |    6 
 fs/autofs/dev-ioctl.c                                  |    4 
 fs/io_uring.c                                          |    2 
 fs/namei.c                                             |    4 
 include/asm-generic/iomap.h                            |   28 +-
 include/asm-generic/pgalloc.h                          |    2 
 include/asm-generic/vmlinux.lds.h                      |    1 
 include/linux/compat.h                                 |    5 
 include/linux/huge_mm.h                                |   58 ++++-
 include/linux/io-64-nonatomic-hi-lo.h                  |    4 
 include/linux/io-64-nonatomic-lo-hi.h                  |    4 
 include/linux/memcontrol.h                             |    2 
 include/linux/mm.h                                     |   16 -
 include/linux/mm_inline.h                              |    6 
 include/linux/mm_types.h                               |    1 
 include/linux/pagemap.h                                |    6 
 include/linux/pid.h                                    |    1 
 include/linux/syscalls.h                               |    4 
 include/linux/sysctl.h                                 |    6 
 include/uapi/asm-generic/unistd.h                      |    4 
 kernel/Makefile                                        |    2 
 kernel/exit.c                                          |   17 -
 kernel/pid.c                                           |   17 +
 kernel/sys_ni.c                                        |    3 
 kernel/sysctl_binary.c                                 |  171 --------------
 lib/iomap.c                                            |   30 +-
 lib/lz4/lz4_compress.c                                 |    4 
 lib/lz4/lz4_decompress.c                               |   18 -
 lib/lz4/lz4defs.h                                      |   10 
 lib/lz4/lz4hc_compress.c                               |    2 
 mm/compaction.c